F382002

General Info

Members Datasets Scaffolds Average Seq Length
277 156 554 357

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0113372|Ga0496104_0113372_358_1527
Length 389
Sequence MSISGPPARRENGGSSMKKSLFLTLGTIALFLFALGFVKTAQIKTAMAAGHFTPPPEAVTTVIAKQESWPASLNAIGTVTAIQGVTVSADQPGIVDKIEFESGRRVAQGAVLVRLDTKQEQAQLVAAESQKELTRLNYERAKDLLAKKVLAQSEYDRSAAEWRQADARVNEIKATILRKTIKAPFTGVLGIRQVNVGQYLAAGAAVVPLQSLDPIYVNFNVPQQDVASLTSGVEVTVTAEGAKAPSKGKVTAVDSVIDSGTRNIQVQATFPNPDGRLRPGMFVKADVTLGASAPIVSLPASSISYAPYGDSVFVVKELTDPKGKSYRGVSQQFVKLGARKGDQIAVVSGLPAGSEVVTSGVFKLRNGAAVLVDNKVQPGNSLAPKPENS

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 2.89
Rhizosphere 96.03
Stem 0
Stem Tuber 0
Unclassified 4.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0113372 3300048907 Bacteria 2600
2 rootH2_10002141 3300003320 Bacteria 26675
3 Ga0065715_10009186 3300005293 Bacteria 2618
4 Ga0065707_10006927 3300005295 Bacteria 3779
5 Ga0070658_10080749 3300005327 Bacteria 2671
6 Ga0070690_100000842 3300005330 Bacteria 15561
7 Ga0070690_100120626 3300005330 Bacteria 1759
8 Ga0070670_100027081 3300005331 Bacteria 4930
9 Ga0070677_10002224 3300005333 Bacteria 6190
10 Ga0068869_100101653 3300005334 Bacteria 2175
11 Ga0070666_10000948 3300005335 Bacteria 17672
12 Ga0070666_10010715 3300005335 Bacteria 5738
13 Ga0068868_100085062 3300005338 Bacteria 2541
14 Ga0070689_100001991 3300005340 Bacteria 13237
15 Ga0070689_100050623 3300005340 Bacteria 3210
16 Ga0070689_100053431 3300005340 Bacteria 3126
17 Ga0070687_100010202 3300005343 Bacteria 4052
18 Ga0070687_100096841 3300005343 Bacteria 1643
19 Ga0070692_10046635 3300005345 Bacteria 2241
20 Ga0070668_100180410 3300005347 Unclassified 1724
21 Ga0070669_100205679 3300005353 Bacteria 1551
22 Ga0070675_100015171 3300005354 Bacteria 6084
23 Ga0070671_100064545 3300005355 Bacteria 3049
24 Ga0070671_100293355 3300005355 Bacteria 1384
25 Ga0070674_100119640 3300005356 Unclassified 1948
26 Ga0070673_100008439 3300005364 Bacteria 6850
27 Ga0070673_100022933 3300005364 Bacteria 4554
28 Ga0070673_100357828 3300005364 Unclassified 1297
29 Ga0070688_100000548 3300005365 Bacteria 18971
30 Ga0070688_100034248 3300005365 Bacteria 3075
31 Ga0070688_100066643 3300005365 Bacteria 2291
32 Ga0070659_100053891 3300005366 Bacteria 3167
33 Ga0070667_100000982 3300005367 Bacteria 26221
34 Ga0070703_10022190 3300005406 Bacteria 1862
35 Ga0070714_100000567 3300005435 Bacteria 26632
36 Ga0070701_10035476 3300005438 Bacteria 2505
37 Ga0070701_10061578 3300005438 Bacteria 1979
38 Ga0070701_10097867 3300005438 Bacteria 1619
39 Ga0070711_100035269 3300005439 Bacteria 3343
40 Ga0070705_100037881 3300005440 Bacteria 2723
41 Ga0070700_100123541 3300005441 Bacteria 1738
42 Ga0070694_100004019 3300005444 Bacteria 8808
43 Ga0070694_100064832 3300005444 Bacteria 2501
44 Ga0070663_100066395 3300005455 Bacteria 2614
45 Ga0070678_100008312 3300005456 Bacteria 6214
46 Ga0068867_100031499 3300005459 Bacteria 3829
47 Ga0068867_100033464 3300005459 Bacteria 3723
48 Ga0068867_100034543 3300005459 Bacteria 3665
49 Ga0068867_100197242 3300005459 Bacteria 1610
50 Ga0070685_10000462 3300005466 Bacteria 23667
51 Ga0070685_10004888 3300005466 Bacteria 6780
52 Ga0070685_10148659 3300005466 Unclassified 1482
53 Ga0070707_100051002 3300005468 Bacteria 3966
54 Ga0070698_100004677 3300005471 Bacteria 15046
55 Ga0070698_100004770 3300005471 Bacteria 14880
56 Ga0070698_100009685 3300005471 Bacteria 10305
57 Ga0070699_100017059 3300005518 Bacteria 6236
58 Ga0070697_100034790 3300005536 Bacteria 4062
59 Ga0070697_100066267 3300005536 Bacteria 2953
60 Ga0070672_100017992 3300005543 Bacteria 5099
61 Ga0070686_100062677 3300005544 Bacteria 2406
62 Ga0070686_100155547 3300005544 Bacteria 1605
63 Ga0070696_100010085 3300005546 Bacteria 6322
64 Ga0070665_100001596 3300005548 Bacteria 26117
65 Ga0070665_100005371 3300005548 Bacteria 13229
66 Ga0070665_100045850 3300005548 Bacteria 4390
67 Ga0070665_100104685 3300005548 Bacteria 2832
68 Ga0070704_100019879 3300005549 Bacteria 4322
69 Ga0070704_100038772 3300005549 Bacteria 3266
70 Ga0070704_100051645 3300005549 Bacteria 2896
71 Ga0070704_100076944 3300005549 Bacteria 2442
72 Ga0068855_100002325 3300005563 Bacteria 23491
73 Ga0070664_100172847 3300005564 Bacteria 1917
74 Ga0068856_100004440 3300005614 Bacteria 13967
75 Ga0068856_100010928 3300005614 Bacteria 8809
76 Ga0070702_100005651 3300005615 Bacteria 5851
77 Ga0070702_100025673 3300005615 Bacteria 3159
78 Ga0068859_100070561 3300005617 Bacteria 3529
79 Ga0068859_100084929 3300005617 Bacteria 3210
80 Ga0068864_100104053 3300005618 Bacteria 2521
81 Ga0068864_100135243 3300005618 Bacteria 2219
82 Ga0068866_10012704 3300005718 Bacteria 3675
83 Ga0068861_100043538 3300005719 Bacteria 3371
84 Ga0068863_100153475 3300005841 Bacteria 2204
85 Ga0068863_100244480 3300005841 Bacteria 1732
86 Ga0068863_100249796 3300005841 Bacteria 1713
87 Ga0068858_100007305 3300005842 Bacteria 10701
88 Ga0068858_100037859 3300005842 Bacteria 4473
89 Ga0068860_100003387 3300005843 Bacteria 16400
90 Ga0068862_100057005 3300005844 Bacteria 3349
91 Ga0068862_100396333 3300005844 Unclassified 1290
92 Ga0081455_10005569 3300005937 Bacteria 13785
93 Ga0097621_100025769 3300006237 Bacteria 4604
94 Ga0075428_100002937 3300006844 Bacteria 18586
95 Ga0075428_100016043 3300006844 Bacteria 8284
96 Ga0075428_100129756 3300006844 Bacteria 2742
97 Ga0075428_100200255 3300006844 Bacteria 2159
98 Ga0075428_100420667 3300006844 Bacteria 1432
99 Ga0075428_100468456 3300006844 Bacteria 1349
100 Ga0075431_100037455 3300006847 Bacteria 4996
101 Ga0075431_100089605 3300006847 Bacteria 3175
102 Ga0075431_100110917 3300006847 Bacteria 2831
103 Ga0075433_10004043 3300006852 Bacteria 11352
104 Ga0075433_10057570 3300006852 Bacteria 3398
105 Ga0075433_10125348 3300006852 Bacteria 2281
106 Ga0075433_10146201 3300006852 Bacteria 2101
107 Ga0075434_100009157 3300006871 Bacteria 9224
108 Ga0075434_100009239 3300006871 Bacteria 9184
109 Ga0075434_100013422 3300006871 Bacteria 7796
110 Ga0075434_100022003 3300006871 Bacteria 6206
111 Ga0075434_100023672 3300006871 Bacteria 5989
112 Ga0075434_100024498 3300006871 Bacteria 5899
113 Ga0075434_100032046 3300006871 Bacteria 5181
114 Ga0075434_100093810 3300006871 Bacteria 3005
115 Ga0075434_100128002 3300006871 Bacteria 2557
116 Ga0075434_100156984 3300006871 Bacteria 2294
117 Ga0075429_100021631 3300006880 Bacteria 5575
118 Ga0075429_100048471 3300006880 Bacteria 3694
119 Ga0075429_100114157 3300006880 Bacteria 2361
120 Ga0075429_100250871 3300006880 Bacteria 1550
121 Ga0068865_100018702 3300006881 Bacteria 4475
122 Ga0075436_100151889 3300006914 Bacteria 1630
123 Ga0097620_100070559 3300006931 Bacteria 3529
124 Ga0097620_100084933 3300006931 Bacteria 3210
125 Ga0075435_100004690 3300007076 Bacteria 9426
126 Ga0075435_100013640 3300007076 Bacteria 6053
127 Ga0075435_100019406 3300007076 Bacteria 5193
128 Ga0075435_100112047 3300007076 Bacteria 2270
129 Ga0075435_100152530 3300007076 Bacteria 1943
130 Ga0105240_10000018 3300009093 Bacteria 434461
131 Ga0111539_10009276 3300009094 Bacteria 12430
132 Ga0111539_10022407 3300009094 Bacteria 7763
133 Ga0111539_10086068 3300009094 Bacteria 3694
134 Ga0111539_10627819 3300009094 Unclassified 1251
135 Ga0114129_10006654 3300009147 Bacteria 16408
136 Ga0114129_10082119 3300009147 Bacteria 4479
137 Ga0114129_10105791 3300009147 Bacteria 3888
138 Ga0114129_10238890 3300009147 Bacteria 2443
139 Ga0114129_10329064 3300009147 Bacteria 2029
140 Ga0114129_10376779 3300009147 Bacteria 1875
141 Ga0105242_10077611 3300009176 Bacteria 2771
142 Ga0105248_10000853 3300009177 Bacteria 34296
143 Ga0105248_10061201 3300009177 Bacteria 4226
144 Ga0105248_10124492 3300009177 Bacteria 2908
145 Ga0105239_10066056 3300010375 Bacteria 3974
146 Ga0105239_10114814 3300010375 Bacteria 2986
147 Ga0157369_10000248 3300013105 Bacteria 74496
148 Ga0157378_10034538 3300013297 Bacteria 4472
149 Ga0157378_10276991 3300013297 Bacteria 1616
150 Ga0157378_10338828 3300013297 Bacteria 1466
151 Ga0157375_10011703 3300013308 Bacteria 7754
152 Ga0157375_10018802 3300013308 Bacteria 6271
153 Ga0157380_10023902 3300014326 Bacteria 4617
154 Ga0157379_10014046 3300014968 Bacteria 7018
155 Ga0157376_10059780 3300014969 Bacteria 3197
156 Ga0163161_10115531 3300017792 Unclassified 2011
157 Ga0207697_10016039 3300025315 Bacteria 3090
158 Ga0207653_10021990 3300025885 Bacteria 2025
159 Ga0207682_10001485 3300025893 Bacteria 10832
160 Ga0207688_10023232 3300025901 Bacteria 3394
161 Ga0207680_10010313 3300025903 Bacteria 4669
162 Ga0207645_10006358 3300025907 Bacteria 8489
163 Ga0207645_10025997 3300025907 Bacteria 3786
164 Ga0207643_10002493 3300025908 Bacteria 9949
165 Ga0207705_10125999 3300025909 Bacteria 1904
166 Ga0207684_10005942 3300025910 Bacteria 11174
167 Ga0207654_10066434 3300025911 Bacteria 2127
168 Ga0207695_10000415 3300025913 Bacteria 94965
169 Ga0207663_10026833 3300025916 Bacteria 3348
170 Ga0207681_10008269 3300025923 Bacteria 6362
171 Ga0207681_10165320 3300025923 Bacteria 1672
172 Ga0207659_10012448 3300025926 Bacteria 5414
173 Ga0207687_10124674 3300025927 Bacteria 1932
174 Ga0207706_10042685 3300025933 Bacteria 4020
175 Ga0207706_10175520 3300025933 Bacteria 1882
176 Ga0207670_10000554 3300025936 Bacteria 20673
177 Ga0207670_10036637 3300025936 Bacteria 3191
178 Ga0207670_10040890 3300025936 Bacteria 3045
179 Ga0207669_10107925 3300025937 Bacteria 1858
180 Ga0207691_10002724 3300025940 Bacteria 17260
181 Ga0207691_10005750 3300025940 Bacteria 11998
182 Ga0207691_10063529 3300025940 Bacteria 3348
183 Ga0207711_10000935 3300025941 Bacteria 28165
184 Ga0207711_10125749 3300025941 Bacteria 2293
185 Ga0207689_10022540 3300025942 Bacteria 5293
186 Ga0207679_10046667 3300025945 Bacteria 3142
187 Ga0207667_10004136 3300025949 Bacteria 17830
188 Ga0207651_10022339 3300025960 Bacteria 3866
189 Ga0207651_10077292 3300025960 Bacteria 2382
190 Ga0207640_10076812 3300025981 Bacteria 2268
191 Ga0207658_10053273 3300025986 Bacteria 2989
192 Ga0207703_10026698 3300026035 Bacteria 4548
193 Ga0207703_10034035 3300026035 Bacteria 4041
194 Ga0207703_10194168 3300026035 Bacteria 1800
195 Ga0207678_10088542 3300026067 Bacteria 2646
196 Ga0207678_10102645 3300026067 Bacteria 2441
197 Ga0207708_10022872 3300026075 Bacteria 4721
198 Ga0207702_10000424 3300026078 Bacteria 48376
199 Ga0207702_10028219 3300026078 Bacteria 4663
200 Ga0207641_10253833 3300026088 Unclassified 1643
201 Ga0207648_10002741 3300026089 Bacteria 18717
202 Ga0207648_10009119 3300026089 Bacteria 9535
203 Ga0207648_10018206 3300026089 Bacteria 6362
204 Ga0207675_100023512 3300026118 Bacteria 5733
205 Ga0207675_100062322 3300026118 Unclassified 3483
206 Ga0207683_10016567 3300026121 Bacteria 6275
207 Ga0207683_10089011 3300026121 Bacteria 2747
208 Ga0268266_10000272 3300028379 Bacteria 85423
209 Ga0268266_10080692 3300028379 Bacteria 2835
210 Ga0268264_10002640 3300028381 Bacteria 15658
211 Ga0268264_10133839 3300028381 Bacteria 2202
212 Ga0265330_10051555 3300031235 Unclassified 1804
213 Ga0265331_10020423 3300031250 Bacteria 3400
214 Ga0373951_0001072 3300035091 Bacteria 7321
215 Ga0373947_0092542 3300035725 Bacteria 1888
216 Ga0373937_0052493 3300036401 Bacteria 3738
217 Ga0373937_0123263 3300036401 Unclassified 2416
218 Ga0395905_0335618 3300037471 Bacteria 1402
219 Ga0451577_0052709 3300042876 Bacteria 3632
220 Ga0453683_0033495 3300044673 Bacteria 3240
221 Ga0453684_0086854 3300044712 Bacteria 3880
222 Ga0466971_0000147 3300044719 Bacteria 26376
223 Ga0466957_0000761 3300044842 Bacteria 16407
224 Ga0495592_0043669 3300046454 Bacteria 3352
225 Ga0495603_0077367 3300046455 Bacteria 1952
226 Ga0495584_0034742 3300046491 Bacteria 2548
227 Ga0495620_0003813 3300046515 Bacteria 8600
228 Ga0495628_0041880 3300046516 Bacteria 3654
229 Ga0495621_0006084 3300046539 Bacteria 3506
230 Ga0495636_0007907 3300047318 Bacteria 4186
231 Ga0495636_0028331 3300047318 Bacteria 2284
232 Ga0496100_0009920 3300048903 Bacteria 5371
233 Ga0496102_0003199 3300048905 Bacteria 13891
234 Ga0496103_0012276 3300048906 Bacteria 5084
235 Ga0496105_0043373 3300048908 Bacteria 3710
236 Ga0496106_0004074 3300048909 Bacteria 10898
237 Ga0496107_0004159 3300048910 Bacteria 9765
238 Ga0496109_0075328 3300048912 Bacteria 3103
239 Ga0501037_0000073 3300049573 Bacteria 93756
240 Ga0501038_0000194 3300049574 Bacteria 52581
241 Ga0501069_0045262 3300049585 Bacteria 2438
242 Ga0501071_0138445 3300049587 Bacteria 1812
243 Ga0501044_0004184 3300049823 Bacteria 16218
244 Ga0501045_0030866 3300049824 Bacteria 3880
245 nmdc:mga05p37_256181_c1 3300050507 Bacteria 2097
246 nmdc:mga05p37_265205_c1 3300050507 Bacteria 2054
247 nmdc:mga05p37_350973_c1 3300050507 Bacteria 1737
248 nmdc:mga05p37_63098_c1 3300050507 Bacteria 4560
249 nmdc:mga05p37_85210_c1 3300050507 Bacteria 3893
250 nmdc:mga05p37_96264_c1 3300050507 Bacteria 3647
251 nmdc:mga09592_103421_c1 3300050508 Bacteria 2440
252 nmdc:mga09592_19034_c2 3300050508 Bacteria 4838
253 nmdc:mga06r32_122103_c1 3300050510 Bacteria 2570
254 nmdc:mga06r32_13446_c1 3300050510 Bacteria 7412
255 nmdc:mga06r32_36637_c1 3300050510 Bacteria 4637
256 nmdc:mga06r32_77136_c1 3300050510 Bacteria 3236
257 nmdc:mga08y16_306045_c1 3300050511 Bacteria 1637
258 nmdc:mga08y16_59495_c1 3300050511 Bacteria 3990
259 nmdc:mga0n895_136164_c1 3300050512 Bacteria 2483
260 nmdc:mga0n895_145760_c1 3300050512 Bacteria 2397
261 nmdc:mga0n895_15897_c1 3300050512 Bacteria 6884
262 nmdc:mga0n895_24368_c1 3300050512 Bacteria 5702
263 nmdc:mga0n895_37595_c1 3300050512 Bacteria 4685
264 nmdc:mga0n895_40106_c1 3300050512 Bacteria 4547
265 nmdc:mga0n895_74081_c1 3300050512 Bacteria 3381
266 nmdc:mga0n895_7658_c1 3300050512 Bacteria 9286
267 nmdc:mga0rr50_19028_c1 3300050513 Bacteria 4625
268 nmdc:mga0rr50_40189_c1 3300050513 Bacteria 3399
269 nmdc:mga0a205_136820_c1 3300050515 Bacteria 2350
270 nmdc:mga0a205_19257_c1 3300050515 Bacteria 6432
271 nmdc:mga0a205_38241_c1 3300050515 Unclassified 4615
272 nmdc:mga0a205_38707_c2 3300050515 Bacteria 4143
273 nmdc:mga0a205_41418_c1 3300050515 Bacteria 4435
274 Ga0500559_0099081 3300053136 Unclassified 1342
275 Ga0500645_011084 3300053730 Bacteria 2956
276 Ga0501082_0046703 3300060353 Bacteria 3732
277 Ga0501082_0351172 3300060353 Bacteria 1286
278 Ga0496104_0113372
279 rootH2_10002141
280 Ga0065715_10009186
281 Ga0065707_10006927
282 Ga0070658_10080749
283 Ga0070690_100000842
284 Ga0070690_100120626
285 Ga0070670_100027081
286 Ga0070677_10002224
287 Ga0068869_100101653
288 Ga0070666_10000948
289 Ga0070666_10010715
290 Ga0068868_100085062
291 Ga0070689_100001991
292 Ga0070689_100050623
293 Ga0070689_100053431
294 Ga0070687_100010202
295 Ga0070687_100096841
296 Ga0070692_10046635
297 Ga0070668_100180410
298 Ga0070669_100205679
299 Ga0070675_100015171
300 Ga0070671_100064545
301 Ga0070671_100293355
302 Ga0070674_100119640
303 Ga0070673_100008439
304 Ga0070673_100022933
305 Ga0070673_100357828
306 Ga0070688_100000548
307 Ga0070688_100034248
308 Ga0070688_100066643
309 Ga0070659_100053891
310 Ga0070667_100000982
311 Ga0070703_10022190
312 Ga0070714_100000567
313 Ga0070701_10035476
314 Ga0070701_10061578
315 Ga0070701_10097867
316 Ga0070711_100035269
317 Ga0070705_100037881
318 Ga0070700_100123541
319 Ga0070694_100004019
320 Ga0070694_100064832
321 Ga0070663_100066395
322 Ga0070678_100008312
323 Ga0068867_100031499
324 Ga0068867_100033464
325 Ga0068867_100034543
326 Ga0068867_100197242
327 Ga0070685_10000462
328 Ga0070685_10004888
329 Ga0070685_10148659
330 Ga0070707_100051002
331 Ga0070698_100004677
332 Ga0070698_100004770
333 Ga0070698_100009685
334 Ga0070699_100017059
335 Ga0070697_100034790
336 Ga0070697_100066267
337 Ga0070672_100017992
338 Ga0070686_100062677
339 Ga0070686_100155547
340 Ga0070696_100010085
341 Ga0070665_100001596
342 Ga0070665_100005371
343 Ga0070665_100045850
344 Ga0070665_100104685
345 Ga0070704_100019879
346 Ga0070704_100038772
347 Ga0070704_100051645
348 Ga0070704_100076944
349 Ga0068855_100002325
350 Ga0070664_100172847
351 Ga0068856_100004440
352 Ga0068856_100010928
353 Ga0070702_100005651
354 Ga0070702_100025673
355 Ga0068859_100070561
356 Ga0068859_100084929
357 Ga0068864_100104053
358 Ga0068864_100135243
359 Ga0068866_10012704
360 Ga0068861_100043538
361 Ga0068863_100153475
362 Ga0068863_100244480
363 Ga0068863_100249796
364 Ga0068858_100007305
365 Ga0068858_100037859
366 Ga0068860_100003387
367 Ga0068862_100057005
368 Ga0068862_100396333
369 Ga0081455_10005569
370 Ga0097621_100025769
371 Ga0075428_100002937
372 Ga0075428_100016043
373 Ga0075428_100129756
374 Ga0075428_100200255
375 Ga0075428_100420667
376 Ga0075428_100468456
377 Ga0075431_100037455
378 Ga0075431_100089605
379 Ga0075431_100110917
380 Ga0075433_10004043
381 Ga0075433_10057570
382 Ga0075433_10125348
383 Ga0075433_10146201
384 Ga0075434_100009157
385 Ga0075434_100009239
386 Ga0075434_100013422
387 Ga0075434_100022003
388 Ga0075434_100023672
389 Ga0075434_100024498
390 Ga0075434_100032046
391 Ga0075434_100093810
392 Ga0075434_100128002
393 Ga0075434_100156984
394 Ga0075429_100021631
395 Ga0075429_100048471
396 Ga0075429_100114157
397 Ga0075429_100250871
398 Ga0068865_100018702
399 Ga0075436_100151889
400 Ga0097620_100070559
401 Ga0097620_100084933
402 Ga0075435_100004690
403 Ga0075435_100013640
404 Ga0075435_100019406
405 Ga0075435_100112047
406 Ga0075435_100152530
407 Ga0105240_10000018
408 Ga0111539_10009276
409 Ga0111539_10022407
410 Ga0111539_10086068
411 Ga0111539_10627819
412 Ga0114129_10006654
413 Ga0114129_10082119
414 Ga0114129_10105791
415 Ga0114129_10238890
416 Ga0114129_10329064
417 Ga0114129_10376779
418 Ga0105242_10077611
419 Ga0105248_10000853
420 Ga0105248_10061201
421 Ga0105248_10124492
422 Ga0105239_10066056
423 Ga0105239_10114814
424 Ga0157369_10000248
425 Ga0157378_10034538
426 Ga0157378_10276991
427 Ga0157378_10338828
428 Ga0157375_10011703
429 Ga0157375_10018802
430 Ga0157380_10023902
431 Ga0157379_10014046
432 Ga0157376_10059780
433 Ga0163161_10115531
434 Ga0207697_10016039
435 Ga0207653_10021990
436 Ga0207682_10001485
437 Ga0207688_10023232
438 Ga0207680_10010313
439 Ga0207645_10006358
440 Ga0207645_10025997
441 Ga0207643_10002493
442 Ga0207705_10125999
443 Ga0207684_10005942
444 Ga0207654_10066434
445 Ga0207695_10000415
446 Ga0207663_10026833
447 Ga0207681_10008269
448 Ga0207681_10165320
449 Ga0207659_10012448
450 Ga0207687_10124674
451 Ga0207706_10042685
452 Ga0207706_10175520
453 Ga0207670_10000554
454 Ga0207670_10036637
455 Ga0207670_10040890
456 Ga0207669_10107925
457 Ga0207691_10002724
458 Ga0207691_10005750
459 Ga0207691_10063529
460 Ga0207711_10000935
461 Ga0207711_10125749
462 Ga0207689_10022540
463 Ga0207679_10046667
464 Ga0207667_10004136
465 Ga0207651_10022339
466 Ga0207651_10077292
467 Ga0207640_10076812
468 Ga0207658_10053273
469 Ga0207703_10026698
470 Ga0207703_10034035
471 Ga0207703_10194168
472 Ga0207678_10088542
473 Ga0207678_10102645
474 Ga0207708_10022872
475 Ga0207702_10000424
476 Ga0207702_10028219
477 Ga0207641_10253833
478 Ga0207648_10002741
479 Ga0207648_10009119
480 Ga0207648_10018206
481 Ga0207675_100023512
482 Ga0207675_100062322
483 Ga0207683_10016567
484 Ga0207683_10089011
485 Ga0268266_10000272
486 Ga0268266_10080692
487 Ga0268264_10002640
488 Ga0268264_10133839
489 Ga0265330_10051555
490 Ga0265331_10020423
491 Ga0373951_0001072
492 Ga0373947_0092542
493 Ga0373937_0052493
494 Ga0373937_0123263
495 Ga0395905_0335618
496 Ga0451577_0052709
497 Ga0453683_0033495
498 Ga0453684_0086854
499 Ga0466971_0000147
500 Ga0466957_0000761
501 Ga0495592_0043669
502 Ga0495603_0077367
503 Ga0495584_0034742
504 Ga0495620_0003813
505 Ga0495628_0041880
506 Ga0495621_0006084
507 Ga0495636_0007907
508 Ga0495636_0028331
509 Ga0496100_0009920
510 Ga0496102_0003199
511 Ga0496103_0012276
512 Ga0496105_0043373
513 Ga0496106_0004074
514 Ga0496107_0004159
515 Ga0496109_0075328
516 Ga0501037_0000073
517 Ga0501038_0000194
518 Ga0501069_0045262
519 Ga0501071_0138445
520 Ga0501044_0004184
521 Ga0501045_0030866
522 nmdc:mga05p37_256181_c1
523 nmdc:mga05p37_265205_c1
524 nmdc:mga05p37_350973_c1
525 nmdc:mga05p37_63098_c1
526 nmdc:mga05p37_85210_c1
527 nmdc:mga05p37_96264_c1
528 nmdc:mga09592_103421_c1
529 nmdc:mga09592_19034_c2
530 nmdc:mga06r32_122103_c1
531 nmdc:mga06r32_13446_c1
532 nmdc:mga06r32_36637_c1
533 nmdc:mga06r32_77136_c1
534 nmdc:mga08y16_306045_c1
535 nmdc:mga08y16_59495_c1
536 nmdc:mga0n895_136164_c1
537 nmdc:mga0n895_145760_c1
538 nmdc:mga0n895_15897_c1
539 nmdc:mga0n895_24368_c1
540 nmdc:mga0n895_37595_c1
541 nmdc:mga0n895_40106_c1
542 nmdc:mga0n895_74081_c1
543 nmdc:mga0n895_7658_c1
544 nmdc:mga0rr50_19028_c1
545 nmdc:mga0rr50_40189_c1
546 nmdc:mga0a205_136820_c1
547 nmdc:mga0a205_19257_c1
548 nmdc:mga0a205_38241_c1
549 nmdc:mga0a205_38707_c2
550 nmdc:mga0a205_41418_c1
551 Ga0500559_0099081
552 Ga0500645_011084
553 Ga0501082_0046703
554 Ga0501082_0351172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13437

HlyD_3

HlyD family secretion protein

180

280

0.97

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

70

283

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.905 74 189
3n6r-assembly1.cif.gz_K crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) 0.894 74 189
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.8897 74 189
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.8877 71 189
7wta-assembly1.cif.gz_D cryo-em structure of human pyruvate carboxylase in apo state 0.8812 74 189
ID Description Score Start End Superfamily
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9671 71 191 2.40.50.100
4tkoB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9416 71 189 2.40.50.100
3n6rA04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9049 73 187 2.40.50.100
4kkuC03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9037 75 187 2.40.50.100
4l8jA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9034 71 191 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A4Y3IP66-F1-model_v4 RND efflux pump membrane fusion protein barrel-sandwich domain-containing protein 0.8865 57 268 GO:0015562
GO:1990281
AF-A0A7R9NC92-F1-model_v4 deleted 0.8593 163 271
AF-A0A6G6K8P5-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8507 63 264 GO:0015562
GO:1990281
AF-A0A157SNJ6-F1-model_v4 HlyD family secretion protein 0.8497 84 266 GO:0015562
GO:1990281
AF-A0A3C0HIP4-F1-model_v4 Efflux transporter periplasmic adaptor subunit 0.8428 65 205 GO:0005886
GO:0015562
GO:1990281

Map