F381995

General Info

Members Datasets Scaffolds Average Seq Length
277 192 554 157

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0006572|Ga0495686_0006572_4017_4559
Length 180
Sequence MQTNGEQIAADGPIGRKSRRGTMANITLTVNRQTHKIECEPTTLLVEALREHLRLTGTHVGCDTSQCGACTVHVDGRSIKSCTMLAAEAEGAEVTTIEGLAQKNGELHPMQAAFREHHGLQCGFCTPGMIMSSTDLCARTPDPSEDEVRHWLEGNLCRCTGYHNIVKAVRAGAASMRGDK

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
58 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
100 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
185 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
186 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
187 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
188 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
189 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
192 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0
Rhizoplane 4.33
Rhizosphere 84.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0006572 3300047472 Bacteria 8870
2 Ga0070690_100110297 3300005330 Bacteria 1835
3 Ga0070690_100201030 3300005330 Bacteria 1386
4 Ga0070690_100306166 3300005330 Bacteria 1141
5 Ga0068869_100494969 3300005334 Bacteria 1020
6 Ga0070680_100995346 3300005336 Bacteria 724
7 Ga0070689_100024677 3300005340 Bacteria 4510
8 Ga0070689_100304573 3300005340 Bacteria 1327
9 Ga0070687_100177534 3300005343 Bacteria 1273
10 Ga0070669_100000022 3300005353 Bacteria 177723
11 Ga0070671_100002389 3300005355 Bacteria 14509
12 Ga0070673_100003146 3300005364 Bacteria 10227
13 Ga0070688_100123054 3300005365 Bacteria 1740
14 Ga0070688_100131784 3300005365 Bacteria 1687
15 Ga0070667_100054749 3300005367 Bacteria 3369
16 Ga0070667_100272785 3300005367 Bacteria 1517
17 Ga0070709_10000160 3300005434 Bacteria 43304
18 Ga0070709_10090118 3300005434 Bacteria 2021
19 Ga0070714_100582706 3300005435 Bacteria 1073
20 Ga0070713_100318155 3300005436 Bacteria 1437
21 Ga0070713_100471303 3300005436 Bacteria 1182
22 Ga0070710_10183130 3300005437 Bacteria 1313
23 Ga0070711_100004320 3300005439 Bacteria 8367
24 Ga0070700_100271925 3300005441 Bacteria 1225
25 Ga0070708_100236380 3300005445 Bacteria 1715
26 Ga0070685_10545577 3300005466 Bacteria 827
27 Ga0070706_100816832 3300005467 Bacteria 863
28 Ga0070707_100022285 3300005468 Bacteria 5988
29 Ga0070707_100604690 3300005468 Bacteria 1059
30 Ga0070679_100022394 3300005530 Bacteria 6176
31 Ga0070672_100069456 3300005543 Bacteria 2797
32 Ga0070686_100085949 3300005544 Bacteria 2093
33 Ga0070686_100150298 3300005544 Bacteria 1630
34 Ga0070693_100557911 3300005547 Bacteria 821
35 Ga0070665_100012072 3300005548 Bacteria 8714
36 Ga0070665_100154579 3300005548 Bacteria 2296
37 Ga0068855_100733415 3300005563 Bacteria 1055
38 Ga0068855_101827866 3300005563 Bacteria 617
39 Ga0068864_100224175 3300005618 Bacteria 1736
40 Ga0068861_100076073 3300005719 Bacteria 2615
41 Ga0068861_100269700 3300005719 Bacteria 1461
42 Ga0068863_100008806 3300005841 Bacteria 9855
43 Ga0068858_100127307 3300005842 Bacteria 2386
44 Ga0068858_101212354 3300005842 Bacteria 742
45 Ga0068860_100465246 3300005843 Bacteria 1259
46 Ga0068860_100742555 3300005843 Bacteria 993
47 Ga0068862_100360577 3300005844 Bacteria 1351
48 Ga0081455_10215703 3300005937 Bacteria 1427
49 Ga0070717_10002560 3300006028 Bacteria 12820
50 Ga0070717_10064732 3300006028 Bacteria 3037
51 Ga0070717_10212227 3300006028 Bacteria 1699
52 Ga0070717_10215825 3300006028 Bacteria 1685
53 Ga0070716_100008243 3300006173 Bacteria 5165
54 Ga0070716_100102708 3300006173 Bacteria 1756
55 Ga0070712_100301702 3300006175 Bacteria 1297
56 Ga0070712_100876868 3300006175 Bacteria 773
57 Ga0075362_10069489 3300006177 Bacteria 1606
58 Ga0075367_10194889 3300006178 Bacteria 1265
59 Ga0075366_10000245 3300006195 Bacteria 23798
60 Ga0075366_10322827 3300006195 Bacteria 946
61 Ga0068871_100316934 3300006358 Bacteria 1372
62 Ga0068871_100519521 3300006358 Bacteria 1075
63 Ga0068871_100738727 3300006358 Bacteria 904
64 Ga0075428_100174375 3300006844 Bacteria 2329
65 Ga0075433_10428841 3300006852 Bacteria 1166
66 Ga0075429_100122951 3300006880 Bacteria 2269
67 Ga0075436_100000908 3300006914 Bacteria 19699
68 Ga0075436_100561037 3300006914 Bacteria 839
69 Ga0075435_100059426 3300007076 Bacteria 3099
70 Ga0075435_100162447 3300007076 Bacteria 1882
71 Ga0075435_100453515 3300007076 Bacteria 1106
72 Ga0105245_10000074 3300009098 Bacteria 103733
73 Ga0105245_10349905 3300009098 Bacteria 1464
74 Ga0105245_11004336 3300009098 Bacteria 879
75 Ga0114129_10445420 3300009147 Bacteria 1699
76 Ga0114129_10564590 3300009147 Bacteria 1478
77 Ga0114129_11260697 3300009147 Bacteria 918
78 Ga0105241_11464739 3300009174 Bacteria 656
79 Ga0105242_10318414 3300009176 Bacteria 1426
80 Ga0105248_10311069 3300009177 Bacteria 1774
81 Ga0105248_11025898 3300009177 Bacteria 932
82 Ga0105248_11144719 3300009177 Bacteria 879
83 Ga0105249_10014151 3300009553 Bacteria 7052
84 Ga0105249_10159633 3300009553 Bacteria 2177
85 Ga0105239_10481709 3300010375 Bacteria 1410
86 Ga0105246_10247232 3300011119 Bacteria 1413
87 Ga0163163_10076874 3300014325 Bacteria 3334
88 Ga0157376_10032644 3300014969 Bacteria 4183
89 Ga0157376_11431562 3300014969 Bacteria 723
90 Ga0228598_1094032 3300024227 Bacteria 604
91 Ga0207699_10000118 3300025906 Bacteria 55994
92 Ga0207699_10277972 3300025906 Bacteria 1162
93 Ga0207707_10606824 3300025912 Bacteria 926
94 Ga0207693_10031935 3300025915 Bacteria 4160
95 Ga0207693_10592590 3300025915 Bacteria 863
96 Ga0207663_10031858 3300025916 Bacteria 3124
97 Ga0207662_10281098 3300025918 Bacteria 1101
98 Ga0207652_10730561 3300025921 Bacteria 882
99 Ga0207646_10101771 3300025922 Bacteria 2575
100 Ga0207646_10559459 3300025922 Bacteria 1028
101 Ga0207681_10000033 3300025923 Bacteria 166731
102 Ga0207659_10069465 3300025926 Bacteria 2566
103 Ga0207687_10000195 3300025927 Bacteria 40937
104 Ga0207687_10206015 3300025927 Bacteria 1540
105 Ga0207644_10003926 3300025931 Bacteria 9648
106 Ga0207686_10445240 3300025934 Bacteria 995
107 Ga0207686_10496907 3300025934 Bacteria 946
108 Ga0207709_11210546 3300025935 Bacteria 622
109 Ga0207670_10054330 3300025936 Bacteria 2702
110 Ga0207665_10025342 3300025939 Bacteria 3912
111 Ga0207665_10597337 3300025939 Bacteria 861
112 Ga0207691_10062705 3300025940 Bacteria 3372
113 Ga0207689_10017304 3300025942 Bacteria 6101
114 Ga0207689_10102627 3300025942 Bacteria 2350
115 Ga0207689_10345010 3300025942 Bacteria 1237
116 Ga0207689_10703347 3300025942 Bacteria 852
117 Ga0207679_10322474 3300025945 Bacteria 1338
118 Ga0207667_10630584 3300025949 Bacteria 1079
119 Ga0207651_10023237 3300025960 Bacteria 3808
120 Ga0207712_10036663 3300025961 Bacteria 3341
121 Ga0207712_10049488 3300025961 Bacteria 2928
122 Ga0207658_10039650 3300025986 Bacteria 3399
123 Ga0207658_10067888 3300025986 Bacteria 2688
124 Ga0207708_10066412 3300026075 Bacteria 2758
125 Ga0207708_10883413 3300026075 Bacteria 773
126 Ga0207641_10133879 3300026088 Bacteria 2229
127 Ga0207641_10508471 3300026088 Bacteria 1171
128 Ga0207641_10897763 3300026088 Bacteria 880
129 Ga0207648_10395354 3300026089 Bacteria 1252
130 Ga0207676_10072919 3300026095 Bacteria 2762
131 Ga0207676_10656237 3300026095 Bacteria 1013
132 Ga0207675_100028437 3300026118 Bacteria 5205
133 Ga0207675_100051035 3300026118 Bacteria 3860
134 Ga0207683_10194412 3300026121 Bacteria 1843
135 Ga0268266_10005348 3300028379 Bacteria 12007
136 Ga0268266_11034431 3300028379 Bacteria 795
137 Ga0268265_10507801 3300028380 Bacteria 1137
138 Ga0268264_10418464 3300028381 Bacteria 1292
139 Ga0268264_10545142 3300028381 Bacteria 1137
140 Ga0268264_11870973 3300028381 Bacteria 610
141 Ga0307515_10001985 3300028794 Bacteria 45299
142 Ga0307513_10012513 3300031456 Bacteria 10463
143 Ga0307509_10014531 3300031507 Bacteria 9248
144 Ga0307509_10165843 3300031507 Bacteria 2098
145 Ga0307509_10597077 3300031507 Bacteria 777
146 Ga0307508_10038576 3300031616 Bacteria 4293
147 Ga0307508_10490173 3300031616 Bacteria 823
148 Ga0307508_10667764 3300031616 Bacteria 646
149 Ga0307508_10706632 3300031616 Bacteria 618
150 Ga0265314_10342477 3300031711 Bacteria 825
151 Ga0316576_10471397 3300031727 Bacteria 926
152 Ga0307516_10010058 3300031730 Bacteria 10463
153 Ga0307516_10029329 3300031730 Bacteria 5563
154 Ga0307409_102162293 3300031995 Bacteria 586
155 Ga0307416_100953120 3300032002 Bacteria 960
156 Ga0307415_100122584 3300032126 Bacteria 1952
157 Ga0373949_0000274 3300035090 Bacteria 18974
158 Ga0373923_0005216 3300035111 Bacteria 4397
159 Ga0373936_0000007 3300035113 Bacteria 290641
160 Ga0373953_0144124 3300035117 Bacteria 1019
161 Ga0373956_0022002 3300035119 Bacteria 2724
162 Ga0373956_0104150 3300035119 Bacteria 1318
163 Ga0373957_0025892 3300035120 Bacteria 2118
164 Ga0373955_0007554 3300035172 Bacteria 5002
165 Ga0373961_0000005 3300035241 Bacteria 146538
166 Ga0373924_0490857 3300035410 Bacteria 552
167 Ga0373935_0055510 3300035692 Bacteria 2524
168 Ga0373927_0394778 3300035695 Bacteria 913
169 Ga0373933_0001025 3300035724 Bacteria 16988
170 Ga0373937_0001408 3300036401 Bacteria 20071
171 Ga0316584_0053515 3300036712 Bacteria 3021
172 Ga0373925_0081387 3300037068 Bacteria 2462
173 Ga0436360_1330731 3300039438 Bacteria 2478
174 Ga0436363_0417192 3300039450 Bacteria 1419
175 Ga0451795_1494455 3300041456 Bacteria 1140
176 Ga0450923_082476 3300042125 Bacteria 725
177 Ga0466963_0415359 3300044694 Bacteria 949
178 Ga0466957_0150053 3300044842 Bacteria 1507
179 Ga0495592_0013020 3300046454 Bacteria 6328
180 Ga0495629_0005822 3300046459 Bacteria 9194
181 Ga0495629_0028088 3300046459 Bacteria 3995
182 Ga0495629_0183075 3300046459 Bacteria 1451
183 Ga0495638_0180037 3300046460 Bacteria 1207
184 Ga0495651_0011779 3300046462 Bacteria 6721
185 Ga0495651_0043446 3300046462 Bacteria 3487
186 Ga0495653_0001469 3300046463 Bacteria 18392
187 Ga0495650_0094653 3300046471 Bacteria 1130
188 Ga0495582_0049091 3300046473 Bacteria 2324
189 Ga0495662_0252446 3300046476 Bacteria 869
190 Ga0495664_0045930 3300046477 Bacteria 2591
191 Ga0495608_0002240 3300046511 Bacteria 13969
192 Ga0495618_0004624 3300046514 Bacteria 8430
193 Ga0495618_0042277 3300046514 Bacteria 2872
194 Ga0495628_0006177 3300046516 Bacteria 10473
195 Ga0495628_0039744 3300046516 Bacteria 3761
196 Ga0495652_0039122 3300046529 Bacteria 4102
197 Ga0495652_0151700 3300046529 Bacteria 1810
198 Ga0495652_0380863 3300046529 Bacteria 1003
199 Ga0495640_0010392 3300046533 Bacteria 7200
200 Ga0495640_0176613 3300046533 Bacteria 1363
201 Ga0495586_0044090 3300046535 Bacteria 2402
202 Ga0495645_0066196 3300046543 Bacteria 2612
203 Ga0495667_0001366 3300046559 Bacteria 16043
204 Ga0495634_0014141 3300046642 Bacteria 5761
205 Ga0495634_0072634 3300046642 Bacteria 2263
206 Ga0495635_0010781 3300046663 Bacteria 6403
207 Ga0495635_0607573 3300046663 Bacteria 714
208 Ga0495599_0201290 3300046678 Bacteria 1223
209 Ga0495599_0296765 3300046678 Bacteria 976
210 Ga0495623_0004923 3300046679 Bacteria 8752
211 Ga0495623_0048118 3300046679 Bacteria 2706
212 Ga0495646_0023907 3300046680 Bacteria 3847
213 Ga0495613_0072666 3300046689 Bacteria 2508
214 Ga0495613_0387854 3300046689 Bacteria 954
215 Ga0495624_0126791 3300046690 Bacteria 1566
216 Ga0495649_0212885 3300046694 Bacteria 1001
217 Ga0495649_0465958 3300046694 Bacteria 630
218 Ga0495600_0009749 3300046809 Bacteria 5937
219 Ga0495604_0004339 3300047317 Bacteria 11229
220 Ga0495604_0265730 3300047317 Bacteria 1164
221 Ga0495674_0004750 3300047319 Bacteria 13064
222 Ga0495680_0005899 3300047322 Bacteria 11456
223 Ga0495675_0036194 3300047444 Bacteria 3149
224 Ga0495675_0804927 3300047444 Bacteria 520
225 Ga0495684_0125936 3300047471 Bacteria 1927
226 Ga0495686_0027058 3300047472 Bacteria 3748
227 Ga0495593_0022008 3300047673 Bacteria 3557
228 Ga0495602_0014748 3300048088 Bacteria 7923
229 Ga0495602_0042659 3300048088 Bacteria 4131
230 Ga0496100_0560968 3300048903 Bacteria 884
231 Ga0496102_0366649 3300048905 Bacteria 1356
232 Ga0496104_0312665 3300048907 Bacteria 1484
233 Ga0496106_0068648 3300048909 Bacteria 2704
234 Ga0496109_0094604 3300048912 Bacteria 2766
235 Ga0496109_0412128 3300048912 Bacteria 1277
236 Ga0496110_0300143 3300048913 Bacteria 1463
237 Ga0496112_0004441 3300048915 Bacteria 11884
238 Ga0496112_0463283 3300048915 Bacteria 1205
239 Ga0496113_0170747 3300048916 Bacteria 1722
240 Ga0496115_0373289 3300048918 Bacteria 1161
241 Ga0496118_0027646 3300048921 Bacteria 4793
242 Ga0496119_0006012 3300048922 Bacteria 11395
243 Ga0496120_0007967 3300048923 Bacteria 7801
244 Ga0496121_0030476 3300048924 Bacteria 4954
245 Ga0496125_0010133 3300048928 Bacteria 9560
246 Ga0501032_0809092 3300049569 Bacteria 592
247 Ga0501039_0048564 3300049575 Bacteria 3281
248 Ga0501040_0236039 3300049576 Bacteria 1303
249 Ga0501042_0397606 3300049578 Bacteria 998
250 Ga0501046_0288692 3300049580 Bacteria 1200
251 Ga0501074_1090100 3300049590 Bacteria 561
252 Ga0501077_0696837 3300049593 Bacteria 653
253 nmdc:mga0k408_307342_c1 3300050493 Bacteria 946
254 nmdc:mga0k408_706_c1 3300050493 Bacteria 18274
255 nmdc:mga09592_268307_c1 3300050508 Bacteria 1480
256 nmdc:mga09592_59441_c1 3300050508 Bacteria 3231
257 nmdc:mga06r32_1122039_c1 3300050510 Bacteria 735
258 nmdc:mga0n895_207533_c1 3300050512 Bacteria 1990
259 nmdc:mga0n895_231060_c2 3300050512 Bacteria 1288
260 nmdc:mga0rr50_265812_c1 3300050513 Bacteria 1428
261 nmdc:mga0rr50_646641_c1 3300050513 Bacteria 902
262 nmdc:mga08x19_2494_c1 3300050514 Bacteria 11203
263 nmdc:mga0a205_138996_c1 3300050515 Bacteria 2329
264 Ga0495601_0002930 3300053077 Bacteria 9708
265 Ga0495595_0000418 3300053084 Bacteria 16105
266 Ga0495595_0088420 3300053084 Bacteria 1484
267 Ga0495619_0002991 3300053085 Bacteria 10977
268 Ga0495619_0633348 3300053085 Bacteria 730
269 Ga0500583_0185381 3300053092 Bacteria 1036
270 Ga0500566_0085524 3300053094 Bacteria 1749
271 Ga0500595_064827 3300053119 Bacteria 1095
272 Ga0500597_012622 3300053120 Bacteria 3106
273 Ga0500614_001999 3300053123 Bacteria 4663
274 Ga0500642_0151167 3300053130 Bacteria 1089
275 Ga0500658_0404350 3300053134 Bacteria 625
276 Ga0500636_0041218 3300053177 Bacteria 2731
277 Ga0587062_055729 3300059639 Bacteria 681
278 Ga0495686_0006572
279 Ga0070690_100110297
280 Ga0070690_100201030
281 Ga0070690_100306166
282 Ga0068869_100494969
283 Ga0070680_100995346
284 Ga0070689_100024677
285 Ga0070689_100304573
286 Ga0070687_100177534
287 Ga0070669_100000022
288 Ga0070671_100002389
289 Ga0070673_100003146
290 Ga0070688_100123054
291 Ga0070688_100131784
292 Ga0070667_100054749
293 Ga0070667_100272785
294 Ga0070709_10000160
295 Ga0070709_10090118
296 Ga0070714_100582706
297 Ga0070713_100318155
298 Ga0070713_100471303
299 Ga0070710_10183130
300 Ga0070711_100004320
301 Ga0070700_100271925
302 Ga0070708_100236380
303 Ga0070685_10545577
304 Ga0070706_100816832
305 Ga0070707_100022285
306 Ga0070707_100604690
307 Ga0070679_100022394
308 Ga0070672_100069456
309 Ga0070686_100085949
310 Ga0070686_100150298
311 Ga0070693_100557911
312 Ga0070665_100012072
313 Ga0070665_100154579
314 Ga0068855_100733415
315 Ga0068855_101827866
316 Ga0068864_100224175
317 Ga0068861_100076073
318 Ga0068861_100269700
319 Ga0068863_100008806
320 Ga0068858_100127307
321 Ga0068858_101212354
322 Ga0068860_100465246
323 Ga0068860_100742555
324 Ga0068862_100360577
325 Ga0081455_10215703
326 Ga0070717_10002560
327 Ga0070717_10064732
328 Ga0070717_10212227
329 Ga0070717_10215825
330 Ga0070716_100008243
331 Ga0070716_100102708
332 Ga0070712_100301702
333 Ga0070712_100876868
334 Ga0075362_10069489
335 Ga0075367_10194889
336 Ga0075366_10000245
337 Ga0075366_10322827
338 Ga0068871_100316934
339 Ga0068871_100519521
340 Ga0068871_100738727
341 Ga0075428_100174375
342 Ga0075433_10428841
343 Ga0075429_100122951
344 Ga0075436_100000908
345 Ga0075436_100561037
346 Ga0075435_100059426
347 Ga0075435_100162447
348 Ga0075435_100453515
349 Ga0105245_10000074
350 Ga0105245_10349905
351 Ga0105245_11004336
352 Ga0114129_10445420
353 Ga0114129_10564590
354 Ga0114129_11260697
355 Ga0105241_11464739
356 Ga0105242_10318414
357 Ga0105248_10311069
358 Ga0105248_11025898
359 Ga0105248_11144719
360 Ga0105249_10014151
361 Ga0105249_10159633
362 Ga0105239_10481709
363 Ga0105246_10247232
364 Ga0163163_10076874
365 Ga0157376_10032644
366 Ga0157376_11431562
367 Ga0228598_1094032
368 Ga0207699_10000118
369 Ga0207699_10277972
370 Ga0207707_10606824
371 Ga0207693_10031935
372 Ga0207693_10592590
373 Ga0207663_10031858
374 Ga0207662_10281098
375 Ga0207652_10730561
376 Ga0207646_10101771
377 Ga0207646_10559459
378 Ga0207681_10000033
379 Ga0207659_10069465
380 Ga0207687_10000195
381 Ga0207687_10206015
382 Ga0207644_10003926
383 Ga0207686_10445240
384 Ga0207686_10496907
385 Ga0207709_11210546
386 Ga0207670_10054330
387 Ga0207665_10025342
388 Ga0207665_10597337
389 Ga0207691_10062705
390 Ga0207689_10017304
391 Ga0207689_10102627
392 Ga0207689_10345010
393 Ga0207689_10703347
394 Ga0207679_10322474
395 Ga0207667_10630584
396 Ga0207651_10023237
397 Ga0207712_10036663
398 Ga0207712_10049488
399 Ga0207658_10039650
400 Ga0207658_10067888
401 Ga0207708_10066412
402 Ga0207708_10883413
403 Ga0207641_10133879
404 Ga0207641_10508471
405 Ga0207641_10897763
406 Ga0207648_10395354
407 Ga0207676_10072919
408 Ga0207676_10656237
409 Ga0207675_100028437
410 Ga0207675_100051035
411 Ga0207683_10194412
412 Ga0268266_10005348
413 Ga0268266_11034431
414 Ga0268265_10507801
415 Ga0268264_10418464
416 Ga0268264_10545142
417 Ga0268264_11870973
418 Ga0307515_10001985
419 Ga0307513_10012513
420 Ga0307509_10014531
421 Ga0307509_10165843
422 Ga0307509_10597077
423 Ga0307508_10038576
424 Ga0307508_10490173
425 Ga0307508_10667764
426 Ga0307508_10706632
427 Ga0265314_10342477
428 Ga0316576_10471397
429 Ga0307516_10010058
430 Ga0307516_10029329
431 Ga0307409_102162293
432 Ga0307416_100953120
433 Ga0307415_100122584
434 Ga0373949_0000274
435 Ga0373923_0005216
436 Ga0373936_0000007
437 Ga0373953_0144124
438 Ga0373956_0022002
439 Ga0373956_0104150
440 Ga0373957_0025892
441 Ga0373955_0007554
442 Ga0373961_0000005
443 Ga0373924_0490857
444 Ga0373935_0055510
445 Ga0373927_0394778
446 Ga0373933_0001025
447 Ga0373937_0001408
448 Ga0316584_0053515
449 Ga0373925_0081387
450 Ga0436360_1330731
451 Ga0436363_0417192
452 Ga0451795_1494455
453 Ga0450923_082476
454 Ga0466963_0415359
455 Ga0466957_0150053
456 Ga0495592_0013020
457 Ga0495629_0005822
458 Ga0495629_0028088
459 Ga0495629_0183075
460 Ga0495638_0180037
461 Ga0495651_0011779
462 Ga0495651_0043446
463 Ga0495653_0001469
464 Ga0495650_0094653
465 Ga0495582_0049091
466 Ga0495662_0252446
467 Ga0495664_0045930
468 Ga0495608_0002240
469 Ga0495618_0004624
470 Ga0495618_0042277
471 Ga0495628_0006177
472 Ga0495628_0039744
473 Ga0495652_0039122
474 Ga0495652_0151700
475 Ga0495652_0380863
476 Ga0495640_0010392
477 Ga0495640_0176613
478 Ga0495586_0044090
479 Ga0495645_0066196
480 Ga0495667_0001366
481 Ga0495634_0014141
482 Ga0495634_0072634
483 Ga0495635_0010781
484 Ga0495635_0607573
485 Ga0495599_0201290
486 Ga0495599_0296765
487 Ga0495623_0004923
488 Ga0495623_0048118
489 Ga0495646_0023907
490 Ga0495613_0072666
491 Ga0495613_0387854
492 Ga0495624_0126791
493 Ga0495649_0212885
494 Ga0495649_0465958
495 Ga0495600_0009749
496 Ga0495604_0004339
497 Ga0495604_0265730
498 Ga0495674_0004750
499 Ga0495680_0005899
500 Ga0495675_0036194
501 Ga0495675_0804927
502 Ga0495684_0125936
503 Ga0495686_0027058
504 Ga0495593_0022008
505 Ga0495602_0014748
506 Ga0495602_0042659
507 Ga0496100_0560968
508 Ga0496102_0366649
509 Ga0496104_0312665
510 Ga0496106_0068648
511 Ga0496109_0094604
512 Ga0496109_0412128
513 Ga0496110_0300143
514 Ga0496112_0004441
515 Ga0496112_0463283
516 Ga0496113_0170747
517 Ga0496115_0373289
518 Ga0496118_0027646
519 Ga0496119_0006012
520 Ga0496120_0007967
521 Ga0496121_0030476
522 Ga0496125_0010133
523 Ga0501032_0809092
524 Ga0501039_0048564
525 Ga0501040_0236039
526 Ga0501042_0397606
527 Ga0501046_0288692
528 Ga0501074_1090100
529 Ga0501077_0696837
530 nmdc:mga0k408_307342_c1
531 nmdc:mga0k408_706_c1
532 nmdc:mga09592_268307_c1
533 nmdc:mga09592_59441_c1
534 nmdc:mga06r32_1122039_c1
535 nmdc:mga0n895_207533_c1
536 nmdc:mga0n895_231060_c2
537 nmdc:mga0rr50_265812_c1
538 nmdc:mga0rr50_646641_c1
539 nmdc:mga08x19_2494_c1
540 nmdc:mga0a205_138996_c1
541 Ga0495601_0002930
542 Ga0495595_0000418
543 Ga0495595_0088420
544 Ga0495619_0002991
545 Ga0495619_0633348
546 Ga0500583_0185381
547 Ga0500566_0085524
548 Ga0500595_064827
549 Ga0500597_012622
550 Ga0500614_001999
551 Ga0500642_0151167
552 Ga0500658_0404350
553 Ga0500636_0041218
554 Ga0587062_055729

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

96

170

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

28

101

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9342 1 152
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9314 1 152
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9297 1 152
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9253 1 155
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9217 2 152
ID Description Score Start End Superfamily
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9496 1 75 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.947 1 75 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9449 1 73 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9365 1 75 3.10.20.30
1alo001 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9232 1 72 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7W8S293-F1-model_v4 Carbon-monoxide dehydrogenase small subunit (EC 1.2.7.4) 0.9464 1 152 GO:0043885
GO:0046872
GO:0051537
AF-A0A7Y6K3I1-F1-model_v4 (2Fe-2S)-binding protein 0.9453 1 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A536YUW3-F1-model_v4 (2Fe-2S)-binding protein 0.9411 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A1F5BAU0-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9405 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A537Y022-F1-model_v4 (2Fe-2S)-binding protein 0.9404 1 152 GO:0016491
GO:0046872
GO:0051537

Map