F381696

General Info

Members Datasets Scaffolds Average Seq Length
277 202 554 149

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1006830|Ga0081540_10068307
Length 164
Sequence MLLSDKWEQTERHDMSKEDDNKAIVGRWFTHFWGKTCNLGIVDELAAPDMLLQYSLHEPRRGRDDIKAFMTDFRKAFPDLNFWGAADLLAEGDYVVGRWEGGGTHTGPAFNDFLIGGLPANTGRKMKFTGTTVLKLKDGKILEEIGLDDGVTALTQLGLIKKAA

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
94 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
111 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
112 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
113 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
114 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
190 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
196 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
197 2643221736 Bosea sp. Root483D1 Isolate Unclassified
198 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
199 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
200 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
201 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
202 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 1.08
Rhizoplane 2.89
Rhizosphere 86.64
Stem 0
Stem Tuber 0
Unclassified 5.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1006830 3300005983 Bacteria 8240
2 JGI25406J46586_10000956 3300003203 Bacteria 13581
3 JGI25404J52841_10000736 3300003659 Bacteria 5113
4 JGI25404J52841_10039704 3300003659 Bacteria 996
5 JGI25405J52794_10084861 3300003911 Bacteria 699
6 Ga0065715_10214663 3300005293 Bacteria 1298
7 Ga0068869_101066600 3300005334 Bacteria 706
8 Ga0070691_10350091 3300005341 Bacteria 820
9 Ga0070661_100752938 3300005344 Bacteria 797
10 Ga0070692_10150861 3300005345 Bacteria 1324
11 Ga0070668_100010660 3300005347 Bacteria 6834
12 Ga0070709_10236050 3300005434 Bacteria 1311
13 Ga0070713_100011591 3300005436 Bacteria 6427
14 Ga0070713_100318119 3300005436 Bacteria 1437
15 Ga0070710_10599953 3300005437 Bacteria 766
16 Ga0070711_101437806 3300005439 Bacteria 601
17 Ga0070700_100609082 3300005441 Bacteria 857
18 Ga0070708_100756829 3300005445 Bacteria 914
19 Ga0070662_100077789 3300005457 Bacteria 2462
20 Ga0070662_100272960 3300005457 Bacteria 1366
21 Ga0070681_10103817 3300005458 Bacteria 2786
22 Ga0068867_100365031 3300005459 Bacteria 1209
23 Ga0070706_100069325 3300005467 Bacteria 3262
24 Ga0070706_101633944 3300005467 Bacteria 588
25 Ga0070707_100658722 3300005468 Unclassified 1009
26 Ga0070698_100013516 3300005471 Bacteria 8642
27 Ga0070698_100765729 3300005471 Bacteria 909
28 Ga0070699_100439821 3300005518 Bacteria 1182
29 Ga0070679_100296530 3300005530 Unclassified 1568
30 Ga0070697_100093365 3300005536 Bacteria 2491
31 Ga0070672_100030337 3300005543 Bacteria 4061
32 Ga0070672_100075231 3300005543 Bacteria 2696
33 Ga0070696_100362127 3300005546 Bacteria 1126
34 Ga0068857_100952710 3300005577 Bacteria 825
35 Ga0068854_100507877 3300005578 Bacteria 1016
36 Ga0068866_10555029 3300005718 Bacteria 769
37 Ga0068861_100230790 3300005719 Bacteria 1569
38 Ga0068860_100157894 3300005843 Unclassified 2186
39 Ga0068862_100002633 3300005844 Bacteria 15808
40 Ga0068862_100220162 3300005844 Bacteria 1718
41 Ga0081455_10012488 3300005937 Bacteria 8475
42 Ga0081455_10314638 3300005937 Bacteria 1118
43 Ga0081538_10029391 3300005981 Bacteria 3755
44 Ga0081540_1000668 3300005983 Bacteria 32289
45 Ga0081540_1001589 3300005983 Bacteria 19424
46 Ga0081539_10001182 3300005985 Bacteria 47183
47 Ga0070717_10003168 3300006028 Bacteria 11749
48 Ga0070717_10453594 3300006028 Bacteria 1156
49 Ga0070717_10639155 3300006028 Bacteria 966
50 Ga0070717_10957123 3300006028 Bacteria 780
51 Ga0075369_10018494 3300006186 Bacteria 2838
52 Ga0075431_100438855 3300006847 Bacteria 1303
53 Ga0075431_101430040 3300006847 Bacteria 651
54 Ga0075434_100281062 3300006871 Bacteria 1684
55 Ga0075434_100805599 3300006871 Bacteria 955
56 Ga0075434_101300282 3300006871 Bacteria 738
57 Ga0075429_100188026 3300006880 Bacteria 1810
58 Ga0075429_100501526 3300006880 Unclassified 1064
59 Ga0075435_100183391 3300007076 Bacteria 1769
60 Ga0075435_100743512 3300007076 Bacteria 853
61 Ga0075435_100757035 3300007076 Bacteria 845
62 Ga0099795_10025404 3300007788 Bacteria 1986
63 Ga0105240_10133644 3300009093 Bacteria 2973
64 Ga0111539_10003051 3300009094 Bacteria 22187
65 Ga0111539_10199936 3300009094 Bacteria 2331
66 Ga0111539_10629457 3300009094 Bacteria 1249
67 Ga0111539_10978825 3300009094 Bacteria 983
68 Ga0114129_11226930 3300009147 Bacteria 933
69 Ga0105243_10021792 3300009148 Bacteria 4866
70 Ga0105243_10891863 3300009148 Bacteria 884
71 Ga0105249_10020852 3300009553 Bacteria 5861
72 Ga0105249_10173625 3300009553 Bacteria 2092
73 Ga0099796_10151681 3300010159 Bacteria 913
74 Ga0105239_10023875 3300010375 Bacteria 6734
75 Ga0157314_1021848 3300012500 Bacteria 658
76 Ga0163163_10057449 3300014325 Bacteria 3848
77 Ga0157380_10010929 3300014326 Bacteria 6546
78 Ga0157377_11223594 3300014745 Bacteria 583
79 Ga0157379_10213532 3300014968 Bacteria 1747
80 Ga0157376_10745053 3300014969 Bacteria 988
81 Ga0163161_10167200 3300017792 Bacteria 1680
82 Ga0213873_10053983 3300021358 Bacteria 1072
83 Ga0213871_10039193 3300021441 Bacteria 1267
84 Ga0213871_10156611 3300021441 Bacteria 695
85 Ga0207692_10135575 3300025898 Bacteria 1395
86 Ga0207685_10304685 3300025905 Bacteria 789
87 Ga0207699_10192762 3300025906 Bacteria 1376
88 Ga0207645_10046082 3300025907 Bacteria 2786
89 Ga0207684_11051710 3300025910 Bacteria 679
90 Ga0207654_10086467 3300025911 Bacteria 1901
91 Ga0207707_10455325 3300025912 Bacteria 1095
92 Ga0207695_10402395 3300025913 Bacteria 1253
93 Ga0207695_10863454 3300025913 Bacteria 785
94 Ga0207693_10298646 3300025915 Bacteria 1262
95 Ga0207693_10384261 3300025915 Bacteria 1098
96 Ga0207646_10112082 3300025922 Bacteria 2448
97 Ga0207700_10008242 3300025928 Bacteria 6439
98 Ga0207700_10143526 3300025928 Bacteria 1965
99 Ga0207706_10103396 3300025933 Bacteria 2506
100 Ga0207706_10145258 3300025933 Bacteria 2086
101 Ga0207706_10574449 3300025933 Bacteria 969
102 Ga0207670_10356082 3300025936 Bacteria 1160
103 Ga0207665_10188420 3300025939 Bacteria 1497
104 Ga0207691_10050248 3300025940 Bacteria 3818
105 Ga0207691_10464036 3300025940 Bacteria 1077
106 Ga0207668_11079964 3300025972 Bacteria 719
107 Ga0207708_10168848 3300026075 Bacteria 1731
108 Ga0207641_10590925 3300026088 Bacteria 1086
109 Ga0207648_10557323 3300026089 Bacteria 1053
110 Ga0207674_10399690 3300026116 Bacteria 1328
111 Ga0207674_11525417 3300026116 Bacteria 637
112 Ga0207675_100001765 3300026118 Bacteria 21613
113 Ga0209179_1037323 3300027512 Bacteria 1014
114 Ga0207428_10055826 3300027907 Bacteria 3139
115 Ga0207428_10059641 3300027907 Bacteria 3025
116 Ga0207428_10141871 3300027907 Bacteria 1833
117 Ga0207428_10353618 3300027907 Bacteria 1081
118 Ga0268265_10003810 3300028380 Bacteria 10685
119 Ga0268264_10137554 3300028381 Unclassified 2174
120 Ga0268264_10221030 3300028381 Bacteria 1744
121 Ga0307517_10164598 3300028786 Bacteria 1477
122 Ga0307515_10373686 3300028794 Bacteria 1061
123 Ga0265338_10534248 3300028800 Bacteria 822
124 Ga0307513_10063210 3300031456 Bacteria 3907
125 Ga0307513_10636332 3300031456 Bacteria 774
126 Ga0307508_10012290 3300031616 Bacteria 7829
127 Ga0307508_10653493 3300031616 Unclassified 657
128 Ga0265314_10119618 3300031711 Bacteria 1660
129 Ga0307516_11017014 3300031730 Bacteria 502
130 Ga0307510_10019442 3300033180 Bacteria 7969
131 Ga0373938_0211894 3300034957 Bacteria 541
132 Ga0373944_0066690 3300035089 Unclassified 1164
133 Ga0373923_0108195 3300035111 Bacteria 1232
134 Ga0373936_0030516 3300035113 Bacteria 2126
135 Ga0373945_0301325 3300035116 Bacteria 686
136 Ga0373956_0136445 3300035119 Bacteria 1151
137 Ga0373943_0033050 3300035170 Bacteria 2461
138 Ga0373943_0061030 3300035170 Bacteria 1884
139 Ga0373955_0674751 3300035172 Bacteria 634
140 Ga0373931_0923537 3300035691 Bacteria 587
141 Ga0373935_0276133 3300035692 Bacteria 1182
142 Ga0373935_0761936 3300035692 Bacteria 713
143 Ga0373933_0338738 3300035724 Bacteria 976
144 Ga0373947_0012359 3300035725 Bacteria 4892
145 Ga0373947_0310919 3300035725 Bacteria 1052
146 Ga0373947_0992128 3300035725 Bacteria 573
147 Ga0373937_0005701 3300036401 Bacteria 10691
148 Ga0373937_0255170 3300036401 Bacteria 1653
149 Ga0373925_0201382 3300037068 Bacteria 1583
150 Ga0395900_1345595 3300037418 Bacteria 628
151 Ga0436360_0437941 3300039438 Bacteria 1219
152 Ga0436360_1323105 3300039438 Bacteria 2594
153 Ga0436361_0145971 3300039447 Bacteria 1826
154 Ga0436361_0265085 3300039447 Bacteria 1815
155 Ga0436363_1161100 3300039450 Bacteria 2150
156 Ga0451802_1792736 3300041460 Bacteria 595
157 Ga0439448_0049808 3300042005 Bacteria 1370
158 Ga0450902_078160 3300042137 Bacteria 580
159 Ga0439440_0260189 3300042993 Bacteria 531
160 Ga0495592_0113500 3300046454 Bacteria 1914
161 Ga0495591_002573 3300046458 Bacteria 9975
162 Ga0495629_0007083 3300046459 Bacteria 8263
163 Ga0495651_0007053 3300046462 Bacteria 8590
164 Ga0495651_0023473 3300046462 Bacteria 4795
165 Ga0495651_0167437 3300046462 Bacteria 1568
166 Ga0495653_0043423 3300046463 Bacteria 3494
167 Ga0495580_0098086 3300046472 Bacteria 2038
168 Ga0495582_0035669 3300046473 Bacteria 2735
169 Ga0495605_0259487 3300046474 Bacteria 742
170 Ga0495639_0524323 3300046475 Bacteria 606
171 Ga0495662_0450691 3300046476 Bacteria 631
172 Ga0495664_0378779 3300046477 Bacteria 851
173 Ga0495596_0009489 3300046500 Bacteria 4279
174 Ga0495606_0142377 3300046507 Bacteria 1415
175 Ga0495608_0005115 3300046511 Bacteria 9372
176 Ga0495608_0184675 3300046511 Bacteria 1318
177 Ga0495610_0171690 3300046512 Bacteria 909
178 Ga0495618_0002688 3300046514 Bacteria 11332
179 Ga0495618_0179381 3300046514 Unclassified 1346
180 Ga0495628_0250040 3300046516 Bacteria 1324
181 Ga0495628_0533088 3300046516 Bacteria 844
182 Ga0495630_0004733 3300046517 Bacteria 9547
183 Ga0495630_0466926 3300046517 Bacteria 967
184 Ga0495630_0472445 3300046517 Bacteria 961
185 Ga0495648_0018651 3300046524 Bacteria 4901
186 Ga0495663_0089219 3300046525 Bacteria 1003
187 Ga0495666_0002840 3300046526 Bacteria 8667
188 Ga0495652_0177247 3300046529 Bacteria 1639
189 Ga0495652_0463917 3300046529 Bacteria 884
190 Ga0495665_0010909 3300046531 Bacteria 4916
191 Ga0495640_0010615 3300046533 Bacteria 7105
192 Ga0495640_0019990 3300046533 Bacteria 4936
193 Ga0495621_0003579 3300046539 Bacteria 4288
194 Ga0495645_0112039 3300046543 Bacteria 1930
195 Ga0495645_0131850 3300046543 Bacteria 1750
196 Ga0495633_0152543 3300046558 Bacteria 1067
197 Ga0495667_0132051 3300046559 Bacteria 1610
198 Ga0495656_0000127 3300046615 Bacteria 28720
199 Ga0495668_0508803 3300046616 Bacteria 664
200 Ga0495634_0064524 3300046642 Bacteria 2427
201 Ga0495634_0118439 3300046642 Unclassified 1697
202 Ga0495625_0389485 3300046660 Bacteria 873
203 Ga0495635_0002302 3300046663 Bacteria 12987
204 Ga0495661_0001386 3300046665 Bacteria 20365
205 Ga0495657_0022156 3300046675 Bacteria 4555
206 Ga0495599_0032648 3300046678 Bacteria 3268
207 Ga0495599_0119868 3300046678 Unclassified 1636
208 Ga0495623_0003661 3300046679 Bacteria 10156
209 Ga0495646_0034012 3300046680 Bacteria 3167
210 Ga0495646_0097265 3300046680 Bacteria 1692
211 Ga0495647_0016512 3300046681 Bacteria 2599
212 Ga0495613_0010858 3300046689 Bacteria 6757
213 Ga0495613_0068643 3300046689 Bacteria 2585
214 Ga0495613_0320562 3300046689 Bacteria 1070
215 Ga0495624_0738102 3300046690 Bacteria 583
216 Ga0495589_0011920 3300046794 Bacteria 4508
217 Ga0495600_0008523 3300046809 Bacteria 6303
218 Ga0495604_0017106 3300047317 Bacteria 5800
219 Ga0495674_0009409 3300047319 Bacteria 9283
220 Ga0495674_0163446 3300047319 Bacteria 1861
221 Ga0495676_0023154 3300047321 Bacteria 5394
222 Ga0495680_0042734 3300047322 Bacteria 3594
223 Ga0495680_0109340 3300047322 Bacteria 2050
224 Ga0495683_0002068 3300047323 Bacteria 12436
225 Ga0495675_0001280 3300047444 Bacteria 15253
226 Ga0495675_0230520 3300047444 Bacteria 1118
227 Ga0495679_001198 3300047446 Bacteria 15417
228 Ga0495673_0004686 3300047469 Bacteria 8491
229 Ga0495593_0011438 3300047673 Bacteria 5098
230 Ga0495593_0012060 3300047673 Bacteria 4953
231 Ga0495602_0466503 3300048088 Bacteria 888
232 Ga0496106_0550537 3300048909 Bacteria 926
233 Ga0496112_0520418 3300048915 Bacteria 1124
234 Ga0496113_0015855 3300048916 Bacteria 5193
235 Ga0496114_0113680 3300048917 Bacteria 2321
236 Ga0496115_0086528 3300048918 Bacteria 2557
237 Ga0496115_0185860 3300048918 Bacteria 1717
238 Ga0496126_0133466 3300048929 Bacteria 2143
239 nmdc:mga05p37_71516_c1 3300050507 Bacteria 4268
240 nmdc:mga09592_283883_c1 3300050508 Unclassified 1436
241 nmdc:mga09592_387035_c1 3300050508 Bacteria 1209
242 nmdc:mga0qj67_1257066_c1 3300050509 Unclassified 575
243 nmdc:mga06r32_153717_c1 3300050510 Unclassified 2281
244 nmdc:mga08y16_4663_c1 3300050511 Bacteria 14279
245 nmdc:mga08y16_488444_c1 3300050511 Bacteria 1252
246 nmdc:mga08y16_711681_c1 3300050511 Bacteria 1003
247 nmdc:mga0n895_116498_c1 3300050512 Bacteria 2690
248 nmdc:mga0n895_1365873_c1 3300050512 Bacteria 678
249 nmdc:mga0n895_662315_c1 3300050512 Bacteria 1042
250 nmdc:mga0n895_76634_c1 3300050512 Bacteria 3325
251 nmdc:mga0rr50_504810_c1 3300050513 Bacteria 1028
252 nmdc:mga08x19_27181_c1 3300050514 Unclassified 3577
253 nmdc:mga0a205_393822_c1 3300050515 Bacteria 1249
254 nmdc:mga0a205_592902_c1 3300050515 Unclassified 962
255 Ga0495601_0004122 3300053077 Bacteria 8371
256 Ga0495601_0007777 3300053077 Bacteria 6303
257 Ga0495612_0016427 3300053078 Bacteria 2966
258 Ga0495619_0006485 3300053085 Bacteria 7410
259 Ga0500646_0007816 3300053090 Bacteria 2733
260 Ga0500583_0389619 3300053092 Bacteria 670
261 Ga0500562_114322 3300053108 Bacteria 735
262 Ga0500655_003712 3300053133 Bacteria 2752
263 Ga0500658_0010590 3300053134 Bacteria 3401
264 Ga0500568_0017635 3300053139 Bacteria 3148
265 Ga0500568_0018829 3300053139 Bacteria 3012
266 Ga0500568_0203784 3300053139 Bacteria 724
267 Ga0500616_0224445 3300053153 Bacteria 817
268 Ga0500622_0001533 3300053156 Bacteria 18308
269 Ga0500645_076486 3300053730 Bacteria 957
270 2513637544 2513237094 Bacteria 8789602
271 2600192819 2599185352 Bacteria 7228948
272 2644746544 2643221736 Bacteria 6608466
273 2842485757 2842482326 Bacteria 7212537
274 2844316976 2844315083 Bacteria 8138177
275 2903734023 2903727486 Bacteria 8281579
276 2906604639 2906602504 Bacteria 8295279
277 8056969955 8056967851 Bacteria 9038162
278 Ga0081540_1006830
279 JGI25406J46586_10000956
280 JGI25404J52841_10000736
281 JGI25404J52841_10039704
282 JGI25405J52794_10084861
283 Ga0065715_10214663
284 Ga0068869_101066600
285 Ga0070691_10350091
286 Ga0070661_100752938
287 Ga0070692_10150861
288 Ga0070668_100010660
289 Ga0070709_10236050
290 Ga0070713_100011591
291 Ga0070713_100318119
292 Ga0070710_10599953
293 Ga0070711_101437806
294 Ga0070700_100609082
295 Ga0070708_100756829
296 Ga0070662_100077789
297 Ga0070662_100272960
298 Ga0070681_10103817
299 Ga0068867_100365031
300 Ga0070706_100069325
301 Ga0070706_101633944
302 Ga0070707_100658722
303 Ga0070698_100013516
304 Ga0070698_100765729
305 Ga0070699_100439821
306 Ga0070679_100296530
307 Ga0070697_100093365
308 Ga0070672_100030337
309 Ga0070672_100075231
310 Ga0070696_100362127
311 Ga0068857_100952710
312 Ga0068854_100507877
313 Ga0068866_10555029
314 Ga0068861_100230790
315 Ga0068860_100157894
316 Ga0068862_100002633
317 Ga0068862_100220162
318 Ga0081455_10012488
319 Ga0081455_10314638
320 Ga0081538_10029391
321 Ga0081540_1000668
322 Ga0081540_1001589
323 Ga0081539_10001182
324 Ga0070717_10003168
325 Ga0070717_10453594
326 Ga0070717_10639155
327 Ga0070717_10957123
328 Ga0075369_10018494
329 Ga0075431_100438855
330 Ga0075431_101430040
331 Ga0075434_100281062
332 Ga0075434_100805599
333 Ga0075434_101300282
334 Ga0075429_100188026
335 Ga0075429_100501526
336 Ga0075435_100183391
337 Ga0075435_100743512
338 Ga0075435_100757035
339 Ga0099795_10025404
340 Ga0105240_10133644
341 Ga0111539_10003051
342 Ga0111539_10199936
343 Ga0111539_10629457
344 Ga0111539_10978825
345 Ga0114129_11226930
346 Ga0105243_10021792
347 Ga0105243_10891863
348 Ga0105249_10020852
349 Ga0105249_10173625
350 Ga0099796_10151681
351 Ga0105239_10023875
352 Ga0157314_1021848
353 Ga0163163_10057449
354 Ga0157380_10010929
355 Ga0157377_11223594
356 Ga0157379_10213532
357 Ga0157376_10745053
358 Ga0163161_10167200
359 Ga0213873_10053983
360 Ga0213871_10039193
361 Ga0213871_10156611
362 Ga0207692_10135575
363 Ga0207685_10304685
364 Ga0207699_10192762
365 Ga0207645_10046082
366 Ga0207684_11051710
367 Ga0207654_10086467
368 Ga0207707_10455325
369 Ga0207695_10402395
370 Ga0207695_10863454
371 Ga0207693_10298646
372 Ga0207693_10384261
373 Ga0207646_10112082
374 Ga0207700_10008242
375 Ga0207700_10143526
376 Ga0207706_10103396
377 Ga0207706_10145258
378 Ga0207706_10574449
379 Ga0207670_10356082
380 Ga0207665_10188420
381 Ga0207691_10050248
382 Ga0207691_10464036
383 Ga0207668_11079964
384 Ga0207708_10168848
385 Ga0207641_10590925
386 Ga0207648_10557323
387 Ga0207674_10399690
388 Ga0207674_11525417
389 Ga0207675_100001765
390 Ga0209179_1037323
391 Ga0207428_10055826
392 Ga0207428_10059641
393 Ga0207428_10141871
394 Ga0207428_10353618
395 Ga0268265_10003810
396 Ga0268264_10137554
397 Ga0268264_10221030
398 Ga0307517_10164598
399 Ga0307515_10373686
400 Ga0265338_10534248
401 Ga0307513_10063210
402 Ga0307513_10636332
403 Ga0307508_10012290
404 Ga0307508_10653493
405 Ga0265314_10119618
406 Ga0307516_11017014
407 Ga0307510_10019442
408 Ga0373938_0211894
409 Ga0373944_0066690
410 Ga0373923_0108195
411 Ga0373936_0030516
412 Ga0373945_0301325
413 Ga0373956_0136445
414 Ga0373943_0033050
415 Ga0373943_0061030
416 Ga0373955_0674751
417 Ga0373931_0923537
418 Ga0373935_0276133
419 Ga0373935_0761936
420 Ga0373933_0338738
421 Ga0373947_0012359
422 Ga0373947_0310919
423 Ga0373947_0992128
424 Ga0373937_0005701
425 Ga0373937_0255170
426 Ga0373925_0201382
427 Ga0395900_1345595
428 Ga0436360_0437941
429 Ga0436360_1323105
430 Ga0436361_0145971
431 Ga0436361_0265085
432 Ga0436363_1161100
433 Ga0451802_1792736
434 Ga0439448_0049808
435 Ga0450902_078160
436 Ga0439440_0260189
437 Ga0495592_0113500
438 Ga0495591_002573
439 Ga0495629_0007083
440 Ga0495651_0007053
441 Ga0495651_0023473
442 Ga0495651_0167437
443 Ga0495653_0043423
444 Ga0495580_0098086
445 Ga0495582_0035669
446 Ga0495605_0259487
447 Ga0495639_0524323
448 Ga0495662_0450691
449 Ga0495664_0378779
450 Ga0495596_0009489
451 Ga0495606_0142377
452 Ga0495608_0005115
453 Ga0495608_0184675
454 Ga0495610_0171690
455 Ga0495618_0002688
456 Ga0495618_0179381
457 Ga0495628_0250040
458 Ga0495628_0533088
459 Ga0495630_0004733
460 Ga0495630_0466926
461 Ga0495630_0472445
462 Ga0495648_0018651
463 Ga0495663_0089219
464 Ga0495666_0002840
465 Ga0495652_0177247
466 Ga0495652_0463917
467 Ga0495665_0010909
468 Ga0495640_0010615
469 Ga0495640_0019990
470 Ga0495621_0003579
471 Ga0495645_0112039
472 Ga0495645_0131850
473 Ga0495633_0152543
474 Ga0495667_0132051
475 Ga0495656_0000127
476 Ga0495668_0508803
477 Ga0495634_0064524
478 Ga0495634_0118439
479 Ga0495625_0389485
480 Ga0495635_0002302
481 Ga0495661_0001386
482 Ga0495657_0022156
483 Ga0495599_0032648
484 Ga0495599_0119868
485 Ga0495623_0003661
486 Ga0495646_0034012
487 Ga0495646_0097265
488 Ga0495647_0016512
489 Ga0495613_0010858
490 Ga0495613_0068643
491 Ga0495613_0320562
492 Ga0495624_0738102
493 Ga0495589_0011920
494 Ga0495600_0008523
495 Ga0495604_0017106
496 Ga0495674_0009409
497 Ga0495674_0163446
498 Ga0495676_0023154
499 Ga0495680_0042734
500 Ga0495680_0109340
501 Ga0495683_0002068
502 Ga0495675_0001280
503 Ga0495675_0230520
504 Ga0495679_001198
505 Ga0495673_0004686
506 Ga0495593_0011438
507 Ga0495593_0012060
508 Ga0495602_0466503
509 Ga0496106_0550537
510 Ga0496112_0520418
511 Ga0496113_0015855
512 Ga0496114_0113680
513 Ga0496115_0086528
514 Ga0496115_0185860
515 Ga0496126_0133466
516 nmdc:mga05p37_71516_c1
517 nmdc:mga09592_283883_c1
518 nmdc:mga09592_387035_c1
519 nmdc:mga0qj67_1257066_c1
520 nmdc:mga06r32_153717_c1
521 nmdc:mga08y16_4663_c1
522 nmdc:mga08y16_488444_c1
523 nmdc:mga08y16_711681_c1
524 nmdc:mga0n895_116498_c1
525 nmdc:mga0n895_1365873_c1
526 nmdc:mga0n895_662315_c1
527 nmdc:mga0n895_76634_c1
528 nmdc:mga0rr50_504810_c1
529 nmdc:mga08x19_27181_c1
530 nmdc:mga0a205_393822_c1
531 nmdc:mga0a205_592902_c1
532 Ga0495601_0004122
533 Ga0495601_0007777
534 Ga0495612_0016427
535 Ga0495619_0006485
536 Ga0500646_0007816
537 Ga0500583_0389619
538 Ga0500562_114322
539 Ga0500655_003712
540 Ga0500658_0010590
541 Ga0500568_0017635
542 Ga0500568_0018829
543 Ga0500568_0203784
544 Ga0500616_0224445
545 Ga0500622_0001533
546 Ga0500645_076486
547 2513637544
548 2600192819
549 2644746544
550 2842485757
551 2844316976
552 2903734023
553 2906604639
554 8056969955

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07366

SnoaL

SnoaL-like polyketide cyclase

23

157

0.96

PF12680

SnoaL_2

SnoaL-like domain

25

144

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8925 2 138
5dre-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) 0.8827 1 133
6uae-assembly4.cif.gz_D ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8756 2 133
3ov4-assembly2.cif.gz_C crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8704 1 138
3owy-assembly2.cif.gz_B crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/m105c-cn from p. putida with bound equilenin 0.8702 4 138
ID Description Score Start End Superfamily
af_P96818_5_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8784 6 143 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8592 4 134 3.10.450.50
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.858 1 142 3.10.450.50
4hvnB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.857 10 146 3.10.450.50
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8497 2 143 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7R6XDI2-F1-model_v4 deleted 1.002 1 149
AF-A0A435RNW8-F1-model_v4 deleted 1.002 1 149
AF-A0A2V5AXB3-F1-model_v4 deleted 1.002 1 149
AF-A0A158FAJ9-F1-model_v4 SnoaL-like polyketide cyclase 1.001 1 149 GO:0030638
AF-A0A6A7MEV7-F1-model_v4 Ester cyclase 1.001 1 149 GO:0030638

Map