F381640

General Info

Members Datasets Scaffolds Average Seq Length
277 190 264 150

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100380894|Ga0068867_1003808942
Length 170
Sequence LFTGKKCLQHYLTNMENILINILIVLASFLSMEGVAWFTHKYVMHGLLWTLHKDHHKKESSAFFEHNDFFTLIFSLPGIAGLFFGMQQDSNFLFWIGLGITIYGLAYFLVHDIFIHQRFKLFRNADNNYFKAIRRAHKVHHKHLGKQDGECFGMLWVPFKYFKNLNSKKL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
3 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
4 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
5 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
6 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
7 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
8 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
9 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
10 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
11 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
12 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
13 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
14 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
130 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
157 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
158 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
169 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
170 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
171 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
172 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
173 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
174 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
175 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
176 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
177 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
178 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
179 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
180 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
181 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
182 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
183 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
184 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.89
Nodule 0
Rhizoplane 1.44
Rhizosphere 87.73
Stem 0
Stem Tuber 0
Unclassified 7.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2879104 2162886007 Bacteria 104588
2 JGI25158J39367_1021941 3300002739 Bacteria 772
3 JGI25164J39214_1001715 3300002772 Bacteria 4417
4 rootH2_10130614 3300003320 Unclassified 1778
5 rootH2_10225484 3300003320 Unclassified 1128
6 rootH2_10327907 3300003320 Bacteria 1564
7 rootL2_10048850 3300003322 Bacteria 41711
8 rootL2_10174140 3300003322 Bacteria 8552
9 rootH1_10008479 3300003323 Bacteria 21334
10 rootH1_10138576 3300003323 Bacteria 11483
11 rootH1_10207745 3300003323 Bacteria 3332
12 Ga0065165_1009998 3300005262 Bacteria 4170
13 Ga0065704_10070133 3300005289 Bacteria 1266035
14 Ga0065704_10329107 3300005289 Bacteria 840
15 Ga0065704_10580231 3300005289 Bacteria 618
16 Ga0065715_10097432 3300005293 Bacteria 3705
17 Ga0070658_10068279 3300005327 Bacteria 2906
18 Ga0070683_100006900 3300005329 Bacteria 9542
19 Ga0070683_100165177 3300005329 Bacteria 2100
20 Ga0070670_100732950 3300005331 Bacteria 890
21 Ga0070666_10168947 3300005335 Unclassified 1531
22 Ga0070660_100386257 3300005339 Bacteria 1156
23 Ga0070661_100005613 3300005344 Bacteria 8643
24 Ga0070661_100429052 3300005344 Bacteria 1049
25 Ga0070661_100566559 3300005344 Bacteria 915
26 Ga0070692_10415937 3300005345 Bacteria 852
27 Ga0070671_100176134 3300005355 Unclassified 1810
28 Ga0070671_100332428 3300005355 Unclassified 1295
29 Ga0070671_101166914 3300005355 Bacteria 677
30 Ga0070659_100014272 3300005366 Bacteria 5931
31 Ga0070659_100031753 3300005366 Bacteria 4092
32 Ga0070659_100050397 3300005366 Bacteria 3273
33 Ga0070659_100085025 3300005366 Bacteria 2530
34 Ga0070667_100027934 3300005367 Bacteria 4695
35 Ga0070667_101060007 3300005367 Bacteria 757
36 Ga0070700_100743645 3300005441 Bacteria 784
37 Ga0070700_100852652 3300005441 Bacteria 738
38 Ga0070678_100296188 3300005456 Unclassified 1373
39 Ga0070678_101047737 3300005456 Bacteria 751
40 Ga0070662_100218368 3300005457 Bacteria 1520
41 Ga0068867_100380894 3300005459 Bacteria 1185
42 Ga0068867_100564898 3300005459 Bacteria 987
43 Ga0070685_10002749 3300005466 Bacteria 9013
44 Ga0070679_100006163 3300005530 Bacteria 11160
45 Ga0070679_100028782 3300005530 Bacteria 5480
46 Ga0070679_100038910 3300005530 Bacteria 4729
47 Ga0070684_100001436 3300005535 Bacteria 17157
48 Ga0070684_100585545 3300005535 Bacteria 1037
49 Ga0068853_100034853 3300005539 Bacteria 4273
50 Ga0068853_100696429 3300005539 Bacteria 969
51 Ga0070672_101235342 3300005543 Bacteria 666
52 Ga0070665_100003784 3300005548 Bacteria 16014
53 Ga0070665_100082991 3300005548 Bacteria 3210
54 Ga0068855_100002609 3300005563 Bacteria 22210
55 Ga0068855_101340372 3300005563 Bacteria 739
56 Ga0070664_100005627 3300005564 Bacteria 10087
57 Ga0070664_100101104 3300005564 Bacteria 2507
58 Ga0070664_100384321 3300005564 Bacteria 1282
59 Ga0068857_100008296 3300005577 Bacteria 8977
60 Ga0068856_100089559 3300005614 Bacteria 3060
61 Ga0068852_100307994 3300005616 Bacteria 1535
62 Ga0068859_100257284 3300005617 Bacteria 1836
63 Ga0068864_101848544 3300005618 Bacteria 609
64 Ga0068851_10000051 3300005834 Bacteria 72304
65 Ga0068863_100807336 3300005841 Bacteria 936
66 Ga0068858_100210926 3300005842 Bacteria 1838
67 Ga0070716_101235513 3300006173 Bacteria 601
68 Ga0068871_100175778 3300006358 Bacteria 1838
69 Ga0068871_100657510 3300006358 Bacteria 957
70 Ga0068871_100778412 3300006358 Bacteria 881
71 Ga0068871_101268472 3300006358 Bacteria 692
72 Ga0075428_100094271 3300006844 Unclassified 3264
73 Ga0075429_101699787 3300006880 Unclassified 548
74 Ga0097620_100257295 3300006931 Bacteria 1836
75 Ga0097620_101905863 3300006931 Unclassified 656
76 Ga0105240_10186219 3300009093 Bacteria 2445
77 Ga0105240_10204820 3300009093 Bacteria 2310
78 Ga0111539_10136238 3300009094 Bacteria 2875
79 Ga0105247_10293589 3300009101 Unclassified 1125
80 Ga0105241_11427168 3300009174 Bacteria 664
81 Ga0105237_10002134 3300009545 Bacteria 24902
82 Ga0105239_10022542 3300010375 Bacteria 6943
83 Ga0105239_10373181 3300010375 Unclassified 1612
84 Ga0157373_10012718 3300013100 Bacteria 6185
85 Ga0157373_10249756 3300013100 Bacteria 1255
86 Ga0157371_10015505 3300013102 Bacteria 5716
87 Ga0157371_10077083 3300013102 Unclassified 2360
88 Ga0157370_10003879 3300013104 Bacteria 17425
89 Ga0157369_10844914 3300013105 Bacteria 940
90 Ga0157374_10094322 3300013296 Bacteria 2860
91 Ga0163162_10116965 3300013306 Bacteria 2767
92 Ga0163162_10300714 3300013306 Bacteria 1736
93 Ga0163162_10747493 3300013306 Bacteria 1097
94 Ga0163162_12795412 3300013306 Bacteria 562
95 Ga0157372_10025332 3300013307 Bacteria 6447
96 Ga0157372_10647996 3300013307 Bacteria 1230
97 Ga0157372_10785644 3300013307 Bacteria 1106
98 Ga0157375_10272072 3300013308 Bacteria 1856
99 Ga0157375_10490844 3300013308 Bacteria 1393
100 Ga0157375_10670965 3300013308 Bacteria 1192
101 Ga0163163_10172367 3300014325 Bacteria 2210
102 Ga0163163_10236081 3300014325 Unclassified 1878
103 Ga0163163_10491212 3300014325 Bacteria 1289
104 Ga0157380_10367811 3300014326 Bacteria 1352
105 Ga0157380_10691608 3300014326 Bacteria 1023
106 Ga0157380_12219089 3300014326 Bacteria 613
107 Ga0157379_10108590 3300014968 Bacteria 2491
108 Ga0157379_11231856 3300014968 Bacteria 721
109 Ga0157376_10001065 3300014969 Bacteria 17971
110 Ga0157376_10075603 3300014969 Unclassified 2875
111 Ga0157376_10707953 3300014969 Bacteria 1013
112 Ga0182006_1002698 3300015261 Bacteria 9531
113 Ga0163161_10001288 3300017792 Bacteria 18690
114 Ga0213876_10076571 3300021384 Bacteria 1767
115 Ga0209436_101283 3300025208 Bacteria 8990
116 Ga0207427_100043 3300025231 Bacteria 249595
117 Ga0209437_100170 3300025233 Bacteria 142489
118 Ga0209026_1005989 3300025250 Bacteria 3106
119 Ga0209233_1000349 3300025261 Bacteria 43702
120 Ga0207426_1011778 3300025302 Bacteria 3311
121 Ga0207656_10000487 3300025321 Bacteria 13133
122 Ga0207680_10208104 3300025903 Unclassified 1336
123 Ga0207647_10006111 3300025904 Bacteria 8774
124 Ga0207705_10155750 3300025909 Bacteria 1714
125 Ga0207654_11229303 3300025911 Bacteria 546
126 Ga0207707_10314113 3300025912 Bacteria 1354
127 Ga0207695_10002928 3300025913 Bacteria 24643
128 Ga0207695_10855230 3300025913 Unclassified 789
129 Ga0207671_10002711 3300025914 Bacteria 18546
130 Ga0207657_10261179 3300025919 Bacteria 1378
131 Ga0207657_10476402 3300025919 Bacteria 979
132 Ga0207649_10013797 3300025920 Bacteria 4518
133 Ga0207649_10558004 3300025920 Bacteria 877
134 Ga0207652_10000168 3300025921 Bacteria 71181
135 Ga0207652_10001770 3300025921 Bacteria 18826
136 Ga0207652_10434144 3300025921 Bacteria 1184
137 Ga0207650_10217351 3300025925 Bacteria 1537
138 Ga0207644_10211386 3300025931 Unclassified 1534
139 Ga0207690_10034479 3300025932 Bacteria 3262
140 Ga0207690_10062628 3300025932 Bacteria 2533
141 Ga0207690_10147860 3300025932 Bacteria 1739
142 Ga0207706_10437698 3300025933 Bacteria 1132
143 Ga0207661_10115544 3300025944 Bacteria 2277
144 Ga0207661_10167135 3300025944 Bacteria 1912
145 Ga0207679_10003836 3300025945 Bacteria 9319
146 Ga0207679_10277520 3300025945 Bacteria 1436
147 Ga0207679_10538764 3300025945 Unclassified 1046
148 Ga0207667_10028249 3300025949 Bacteria 6095
149 Ga0207667_11233212 3300025949 Bacteria 726
150 Ga0207703_10277159 3300026035 Bacteria 1522
151 Ga0207639_10185447 3300026041 Bacteria 1773
152 Ga0207708_10556758 3300026075 Bacteria 967
153 Ga0207702_10045993 3300026078 Bacteria 3673
154 Ga0207702_11794005 3300026078 Bacteria 606
155 Ga0207641_10287749 3300026088 Bacteria 1548
156 Ga0207674_10001383 3300026116 Bacteria 31265
157 Ga0207683_10488447 3300026121 Unclassified 1137
158 Ga0207683_10902995 3300026121 Bacteria 820
159 Ga0207698_10080378 3300026142 Bacteria 2626
160 Ga0268266_10004125 3300028379 Bacteria 14039
161 Ga0265327_10000614 3300031251 Bacteria 58841
162 Ga0265327_10012297 3300031251 Bacteria 5793
163 Ga0307408_100000366 3300031548 Bacteria 41450
164 Ga0307405_10184842 3300031731 Bacteria 1500
165 Ga0307412_10115132 3300031911 Unclassified 1927
166 Ga0307412_10266443 3300031911 Bacteria 1338
167 Ga0307414_10000011 3300032004 Bacteria 338253
168 Ga0307414_10017531 3300032004 Bacteria 4383
169 Ga0307414_10031865 3300032004 Bacteria 3463
170 Ga0307414_10197300 3300032004 Bacteria 1634
171 Ga0307414_10202865 3300032004 Bacteria 1614
172 Ga0307414_10376765 3300032004 Unclassified 1226
173 Ga0373934_0136271 3300035086 Bacteria 1003
174 Ga0373934_0174068 3300035086 Unclassified 884
175 Ga0373936_0340756 3300035113 Unclassified 681
176 Ga0373956_0089511 3300035119 Unclassified 1419
177 Ga0316574_0005486 3300035398 Bacteria 6763
178 Ga0316574_0406448 3300035398 Bacteria 857
179 Ga0373933_0071456 3300035724 Unclassified 2113
180 Ga0373947_1265348 3300035725 Unclassified 502
181 Ga0373937_0038233 3300036401 Unclassified 4374
182 Ga0373937_0315496 3300036401 Bacteria 1479
183 Ga0395899_0002260 3300037312 Bacteria 15752
184 Ga0395899_0003693 3300037312 Bacteria 12111
185 Ga0395899_0006417 3300037312 Bacteria 9113
186 Ga0395899_0450532 3300037312 Bacteria 843
187 Ga0395900_0000413 3300037418 Bacteria 61555
188 Ga0395900_0012986 3300037418 Bacteria 8509
189 Ga0395900_0043531 3300037418 Bacteria 4627
190 Ga0395900_0221558 3300037418 Bacteria 1906
191 Ga0395898_0002918 3300037466 Bacteria 19458
192 Ga0395898_0008939 3300037466 Bacteria 10551
193 Ga0395898_0019747 3300037466 Bacteria 6852
194 Ga0395905_0000003 3300037471 Bacteria 1347396
195 Ga0395905_0000188 3300037471 Bacteria 98070
196 Ga0395905_0063365 3300037471 Bacteria 3459
197 Ga0395901_0002175 3300038443 Bacteria 20011
198 Ga0395901_0004792 3300038443 Bacteria 13652
199 Ga0395901_0023218 3300038443 Bacteria 6358
200 Ga0395901_1573096 3300038443 Bacteria 611
201 Ga0436365_0148470 3300039437 Bacteria 907
202 Ga0451804_0476071 3300041463 Bacteria 783
203 Ga0451849_0438968 3300041505 Bacteria 686
204 Ga0451853_3347682 3300041512 Bacteria 1242
205 Ga0451577_0031143 3300042876 Bacteria 4815
206 Ga0453684_0145458 3300044712 Bacteria 2824
207 Ga0466957_0011800 3300044842 Bacteria 5052
208 Ga0466957_0877428 3300044842 Bacteria 640
209 Ga0495592_0416181 3300046454 Unclassified 848
210 Ga0495629_0841367 3300046459 Bacteria 604
211 Ga0495651_0407037 3300046462 Unclassified 887
212 Ga0495653_0264837 3300046463 Unclassified 1134
213 Ga0495608_0110103 3300046511 Unclassified 1771
214 Ga0495610_0355946 3300046512 Bacteria 550
215 Ga0495618_0018669 3300046514 Bacteria 4260
216 Ga0495628_0026986 3300046516 Bacteria 4675
217 Ga0495630_0385497 3300046517 Unclassified 1073
218 Ga0495645_0319387 3300046543 Unclassified 1009
219 Ga0495634_0031046 3300046642 Bacteria 3683
220 Ga0495657_0182297 3300046675 Unclassified 1288
221 Ga0495599_0130907 3300046678 Unclassified 1558
222 Ga0495613_0163189 3300046689 Unclassified 1584
223 Ga0495604_0102239 3300047317 Unclassified 2104
224 Ga0495674_0418637 3300047319 Unclassified 1080
225 Ga0495680_0159932 3300047322 Unclassified 1636
226 Ga0495684_0111773 3300047471 Unclassified 2061
227 Ga0496110_1092604 3300048913 Bacteria 706
228 Ga0496113_0545440 3300048916 Bacteria 930
229 Ga0496115_0002302 3300048918 Bacteria 13673
230 Ga0501290_003805 3300049513 Bacteria 1890
231 Ga0501297_001313 3300049520 Bacteria 2279
232 Ga0501298_033121 3300049521 Bacteria 1022
233 Ga0501031_0074231 3300049568 Bacteria 2214
234 Ga0501033_0000034 3300049570 Bacteria 152329
235 Ga0501034_0008038 3300049571 Bacteria 11191
236 Ga0501036_0232303 3300049572 Bacteria 1547
237 Ga0501037_0003401 3300049573 Bacteria 11573
238 Ga0501038_0024914 3300049574 Bacteria 5332
239 Ga0501039_0213700 3300049575 Bacteria 1516
240 Ga0501043_0000923 3300049579 Bacteria 26062
241 Ga0501047_0108840 3300049581 Bacteria 2654
242 Ga0501199_061443 3300049650 Bacteria 525
243 Ga0501201_008482 3300049651 Bacteria 994
244 Ga0501202_000603 3300049652 Bacteria 5270
245 Ga0501206_001229 3300049653 Bacteria 3208
246 Ga0501217_004413 3300049661 Bacteria 2891
247 Ga0501223_104906 3300049663 Bacteria 585
248 Ga0501224_028163 3300049664 Bacteria 840
249 Ga0501235_008568 3300049669 Bacteria 2232
250 Ga0501240_047566 3300049673 Bacteria 728
251 Ga0501243_015456 3300049675 Bacteria 1227
252 Ga0501252_000747 3300049682 Bacteria 2693
253 Ga0501221_009592 3300049704 Bacteria 1702
254 Ga0501225_0001468 3300049705 Bacteria 7383
255 Ga0501225_0133551 3300049705 Bacteria 745
256 Ga0501245_008982 3300049708 Bacteria 1430
257 Ga0501241_002215 3300049758 Bacteria 3802
258 Ga0501263_041426 3300049760 Bacteria 678
259 Ga0501273_094003 3300049770 Unclassified 513
260 Ga0501035_0002384 3300049822 Bacteria 18456
261 Ga0501044_0012839 3300049823 Bacteria 9069
262 Ga0501045_0000118 3300049824 Bacteria 40712
263 Ga0501204_004322 3300049850 Bacteria 1527
264 Ga0495619_0264096 3300053085 Unclassified 1193

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026078 Ga0207702_11794005 Ga0207702_117940052 115
2 3300005539 Ga0068853_100034853 Ga0068853_1000348533 117
3 3300005577 Ga0068857_100008296 Ga0068857_1000082962 117
4 3300025920 Ga0207649_10013797 Ga0207649_100137972 117
5 3300026041 Ga0207639_10185447 Ga0207639_101854472 117
6 3300026116 Ga0207674_10001383 Ga0207674_1000138321 117
7 3300044842 Ga0466957_0877428 Ga0466957_0877428_223_606 118
8 3300009093 Ga0105240_10204820 Ga0105240_102048203 119
9 3300032004 Ga0307414_10202865 Ga0307414_102028653 127
10 3300041505 Ga0451849_0438968 Ga0451849_0438968_68_481 128
11 3300042876 Ga0451577_0031143 Ga0451577_0031143_700_1131 128
12 3300044712 Ga0453684_0145458 Ga0453684_0145458_166_597 128
13 3300005335 Ga0070666_10168947 Ga0070666_101689472 129
14 3300005344 Ga0070661_100566559 Ga0070661_1005665592 129
15 3300005355 Ga0070671_100176134 Ga0070671_1001761342 129
16 3300005366 Ga0070659_100050397 Ga0070659_1000503971 129
17 3300005367 Ga0070667_100027934 Ga0070667_1000279346 129
18 3300005441 Ga0070700_100743645 Ga0070700_1007436451 129
19 3300005457 Ga0070662_100218368 Ga0070662_1002183682 129
20 3300005459 Ga0068867_100564898 Ga0068867_1005648982 129
21 3300005548 Ga0070665_100082991 Ga0070665_1000829912 129
22 3300005616 Ga0068852_100307994 Ga0068852_1003079943 129
23 3300005617 Ga0068859_100257284 Ga0068859_1002572842 129
24 3300006931 Ga0097620_100257295 Ga0097620_1002572953 129
25 3300009101 Ga0105247_10293589 Ga0105247_102935892 129
26 3300010375 Ga0105239_10373181 Ga0105239_103731812 129
27 3300013306 Ga0163162_10300714 Ga0163162_103007142 129
28 3300014325 Ga0163163_10236081 Ga0163163_102360812 129
29 3300025903 Ga0207680_10208104 Ga0207680_102081042 129
30 3300025920 Ga0207649_10558004 Ga0207649_105580042 129
31 3300025931 Ga0207644_10211386 Ga0207644_102113862 129
32 3300025932 Ga0207690_10034479 Ga0207690_100344791 129
33 3300025933 Ga0207706_10437698 Ga0207706_104376982 129
34 3300026035 Ga0207703_10277159 Ga0207703_102771592 129
35 3300026075 Ga0207708_10556758 Ga0207708_105567582 129
36 3300026142 Ga0207698_10080378 Ga0207698_100803783 129
37 3300049513 Ga0501290_003805 Ga0501290_003805_111_578 129
38 3300049520 Ga0501297_001313 Ga0501297_001313_886_1353 129
39 3300049521 Ga0501298_033121 Ga0501298_033121_362_829 129
40 3300049650 Ga0501199_061443 Ga0501199_061443_16_483 129
41 3300049651 Ga0501201_008482 Ga0501201_008482_193_660 129
42 3300049652 Ga0501202_000603 Ga0501202_000603_4645_5112 129
43 3300049653 Ga0501206_001229 Ga0501206_001229_52_519 129
44 3300049661 Ga0501217_004413 Ga0501217_004413_226_693 129
45 3300049663 Ga0501223_104906 Ga0501223_104906_23_490 129
46 3300049664 Ga0501224_028163 Ga0501224_028163_147_614 129
47 3300049669 Ga0501235_008568 Ga0501235_008568_929_1396 129
48 3300049673 Ga0501240_047566 Ga0501240_047566_226_693 129
49 3300049675 Ga0501243_015456 Ga0501243_015456_533_1000 129
50 3300049682 Ga0501252_000747 Ga0501252_000747_1257_1724 129
51 3300049704 Ga0501221_009592 Ga0501221_009592_914_1381 129
52 3300049705 Ga0501225_0133551 Ga0501225_0133551_88_555 129
53 3300049708 Ga0501245_008982 Ga0501245_008982_204_671 129
54 3300049758 Ga0501241_002215 Ga0501241_002215_1182_1649 129
55 3300049760 Ga0501263_041426 Ga0501263_041426_70_537 129
56 3300005842 Ga0068858_100210926 Ga0068858_1002109262 130
57 3300013308 Ga0157375_10670965 Ga0157375_106709652 130
58 3300039437 Ga0436365_0148470 Ga0436365_0148470_313_732 130
59 3300048913 Ga0496110_1092604 Ga0496110_1092604_147_623 130
60 3300048916 Ga0496113_0545440 Ga0496113_0545440_221_697 130
61 3300005329 Ga0070683_100006900 Ga0070683_1000069004 131
62 3300005344 Ga0070661_100005613 Ga0070661_1000056133 131
63 3300005366 Ga0070659_100014272 Ga0070659_1000142723 131
64 3300005366 Ga0070659_100085025 Ga0070659_1000850253 131
65 3300005535 Ga0070684_100001436 Ga0070684_1000014366 131
66 3300005564 Ga0070664_100005627 Ga0070664_1000056272 131
67 3300009093 Ga0105240_10186219 Ga0105240_101862192 131
68 3300009174 Ga0105241_11427168 Ga0105241_114271681 131
69 3300010375 Ga0105239_10022542 Ga0105239_100225425 131
70 3300013100 Ga0157373_10012718 Ga0157373_100127184 131
71 3300013100 Ga0157373_10249756 Ga0157373_102497562 131
72 3300013306 Ga0163162_10116965 Ga0163162_101169653 131
73 3300013308 Ga0157375_10272072 Ga0157375_102720722 131
74 3300025911 Ga0207654_11229303 Ga0207654_112293031 131
75 3300025912 Ga0207707_10314113 Ga0207707_103141132 131
76 3300025921 Ga0207652_10434144 Ga0207652_104341441 131
77 3300025932 Ga0207690_10062628 Ga0207690_100626283 131
78 3300025944 Ga0207661_10167135 Ga0207661_101671351 131
79 3300025945 Ga0207679_10003836 Ga0207679_100038368 131
80 3300035725 Ga0373947_1265348 Ga0373947_1265348_33_455 131
81 3300037312 Ga0395899_0450532 Ga0395899_0450532_18_440 131
82 iso_pu_bacteria 2919509842 2919512260 131
83 3300006844 Ga0075428_100094271 Ga0075428_1000942714 133
84 iso_pu_bacteria 2643221667 2644371910 133
85 iso_pu_bacteria 2738541279 2738732737 133
86 iso_pu_bacteria 2738541285 2738765275 133
87 iso_pu_bacteria 2738543007 2739214318 133
88 iso_pu_bacteria 2816332280 2817413224 133
89 iso_pu_bacteria 2833640130 2833643013 133
90 iso_pu_bacteria 2919683626 2919687070 133
91 iso_pu_bacteria 8056440228 8056440490 133
92 iso_pu_bacteria 2965320100 2965323086 134
93 3300006173 Ga0070716_101235513 Ga0070716_1012355131 137
94 3300025909 Ga0207705_10155750 Ga0207705_101557502 137
95 3300031731 Ga0307405_10184842 Ga0307405_101848422 137
96 3300031911 Ga0307412_10266443 Ga0307412_102664432 137
97 3300032004 Ga0307414_10000011 Ga0307414_1000001138 137
98 3300032004 Ga0307414_10017531 Ga0307414_100175314 137
99 3300032004 Ga0307414_10031865 Ga0307414_100318652 137
100 3300035398 Ga0316574_0005486 Ga0316574_0005486_2517_2969 137
101 3300035398 Ga0316574_0406448 Ga0316574_0406448_323_772 137
102 3300046512 Ga0495610_0355946 Ga0495610_0355946_25_465 137
103 3300005530 Ga0070679_100038910 Ga0070679_1000389105 138
104 3300005618 Ga0068864_101848544 Ga0068864_1018485441 138
105 3300015261 Ga0182006_1002698 Ga0182006_10026984 138
106 3300025921 Ga0207652_10001770 Ga0207652_100017707 138
107 3300031911 Ga0307412_10115132 Ga0307412_101151323 139
108 iso_pu_bacteria 2939664404 2939666443 139
109 3300005456 Ga0070678_100296188 Ga0070678_1002961882 141
110 3300026121 Ga0207683_10488447 Ga0207683_104884472 141
111 3300002772 JGI25164J39214_1001715 JGI25164J39214_10017155 142
112 3300003323 rootH1_10008479 rootH1_100084793 142
113 3300005355 Ga0070671_100332428 Ga0070671_1003324282 142
114 3300005466 Ga0070685_10002749 Ga0070685_100027493 142
115 3300005564 Ga0070664_100101104 Ga0070664_1001011043 142
116 3300005841 Ga0068863_100807336 Ga0068863_1008073361 142
117 3300014326 Ga0157380_10691608 Ga0157380_106916082 142
118 3300014969 Ga0157376_10075603 Ga0157376_100756033 142
119 3300021384 Ga0213876_10076571 Ga0213876_100765712 142
120 3300025231 Ga0207427_100043 Ga0207427_10004393 142
121 3300025233 Ga0209437_100170 Ga0209437_10017027 142
122 3300025261 Ga0209233_1000349 Ga0209233_100034938 142
123 3300025945 Ga0207679_10538764 Ga0207679_105387642 142
124 3300026088 Ga0207641_10287749 Ga0207641_102877492 142
125 3300046459 Ga0495629_0841367 Ga0495629_0841367_123_578 142
126 3300005441 Ga0070700_100852652 Ga0070700_1008526521 143
127 3300005834 Ga0068851_10000051 Ga0068851_1000005126 143
128 3300025321 Ga0207656_10000487 Ga0207656_100004875 143
129 3300044842 Ga0466957_0011800 Ga0466957_0011800_2704_3165 143
130 3300048918 Ga0496115_0002302 Ga0496115_0002302_10128_10586 143
131 3300049705 Ga0501225_0001468 Ga0501225_0001468_3930_4391 143
132 3300003320 rootH2_10327907 rootH2_103279072 144
133 3300003323 rootH1_10207745 rootH1_102077453 144
134 3300005327 Ga0070658_10068279 Ga0070658_100682792 144
135 3300005329 Ga0070683_100165177 Ga0070683_1001651772 144
136 3300005331 Ga0070670_100732950 Ga0070670_1007329502 144
137 3300005344 Ga0070661_100429052 Ga0070661_1004290521 144
138 3300005345 Ga0070692_10415937 Ga0070692_104159371 144
139 3300005355 Ga0070671_101166914 Ga0070671_1011669141 144
140 3300005367 Ga0070667_101060007 Ga0070667_1010600071 144
141 3300005530 Ga0070679_100006163 Ga0070679_1000061636 144
142 3300006358 Ga0068871_100175778 Ga0068871_1001757783 144
143 3300006358 Ga0068871_100657510 Ga0068871_1006575102 144
144 3300006358 Ga0068871_100778412 Ga0068871_1007784122 144
145 3300006931 Ga0097620_101905863 Ga0097620_1019058631 144
146 3300013296 Ga0157374_10094322 Ga0157374_100943223 144
147 3300014326 Ga0157380_12219089 Ga0157380_122190891 144
148 3300025921 Ga0207652_10000168 Ga0207652_1000016872 144
149 3300025945 Ga0207679_10277520 Ga0207679_102775202 144
150 3300037312 Ga0395899_0002260 Ga0395899_0002260_713_1177 144
151 3300037418 Ga0395900_0043531 Ga0395900_0043531_2133_2597 144
152 3300037418 Ga0395900_0221558 Ga0395900_0221558_442_906 144
153 3300037466 Ga0395898_0008939 Ga0395898_0008939_6443_6907 144
154 3300038443 Ga0395901_0023218 Ga0395901_0023218_1232_1696 144
155 3300038443 Ga0395901_1573096 Ga0395901_1573096_65_529 144
156 iso_pu_bacteria 2821136567 2821143064 144
157 iso_pu_bacteria 2904467357 2904470784 144
158 3300005289 Ga0065704_10329107 Ga0065704_103291072 145
159 3300005289 Ga0065704_10580231 Ga0065704_105802311 145
160 3300005293 Ga0065715_10097432 Ga0065715_100974324 145
161 3300005339 Ga0070660_100386257 Ga0070660_1003862572 145
162 3300005366 Ga0070659_100031753 Ga0070659_1000317534 145
163 3300005530 Ga0070679_100028782 Ga0070679_1000287824 145
164 3300005548 Ga0070665_100003784 Ga0070665_1000037848 145
165 3300005563 Ga0068855_100002609 Ga0068855_1000026098 145
166 3300006880 Ga0075429_101699787 Ga0075429_1016997871 145
167 3300009094 Ga0111539_10136238 Ga0111539_101362383 145
168 3300013104 Ga0157370_10003879 Ga0157370_1000387910 145
169 3300013105 Ga0157369_10844914 Ga0157369_108449142 145
170 3300013307 Ga0157372_10025332 Ga0157372_100253323 145
171 3300025919 Ga0207657_10261179 Ga0207657_102611792 145
172 3300025919 Ga0207657_10476402 Ga0207657_104764022 145
173 3300025932 Ga0207690_10147860 Ga0207690_101478603 145
174 3300025949 Ga0207667_10028249 Ga0207667_100282494 145
175 3300028379 Ga0268266_10004125 Ga0268266_100041257 145
176 3300032004 Ga0307414_10376765 Ga0307414_103767652 145
177 3300037312 Ga0395899_0003693 Ga0395899_0003693_148_615 145
178 3300037418 Ga0395900_0012986 Ga0395900_0012986_3126_3593 145
179 3300037466 Ga0395898_0019747 Ga0395898_0019747_1331_1798 145
180 3300038443 Ga0395901_0004792 Ga0395901_0004792_8163_8630 145
181 3300003320 rootH2_10225484 rootH2_102254841 146
182 3300005456 Ga0070678_101047737 Ga0070678_1010477372 146
183 3300005459 Ga0068867_100380894 Ga0068867_1003808942 146
184 3300005539 Ga0068853_100696429 Ga0068853_1006964292 146
185 3300005563 Ga0068855_101340372 Ga0068855_1013403722 146
186 3300009545 Ga0105237_10002134 Ga0105237_1000213414 146
187 3300013306 Ga0163162_10747493 Ga0163162_107474932 146
188 3300014325 Ga0163163_10491212 Ga0163163_104912122 146
189 3300014969 Ga0157376_10707953 Ga0157376_107079531 146
190 3300017792 Ga0163161_10001288 Ga0163161_1000128815 146
191 3300025250 Ga0209026_1005989 Ga0209026_10059892 146
192 3300025914 Ga0207671_10002711 Ga0207671_1000271111 146
193 3300025949 Ga0207667_11233212 Ga0207667_112332122 146
194 3300026121 Ga0207683_10902995 Ga0207683_109029951 146
195 3300031251 Ga0265327_10012297 Ga0265327_100122972 146
196 3300031548 Ga0307408_100000366 Ga0307408_1000003665 146
197 3300032004 Ga0307414_10197300 Ga0307414_101973003 146
198 3300035086 Ga0373934_0136271 Ga0373934_0136271_516_986 146
199 3300035086 Ga0373934_0174068 Ga0373934_0174068_124_591 146
200 3300035113 Ga0373936_0340756 Ga0373936_0340756_32_499 146
201 3300035119 Ga0373956_0089511 Ga0373956_0089511_679_1146 146
202 3300035724 Ga0373933_0071456 Ga0373933_0071456_1548_2015 146
203 3300036401 Ga0373937_0038233 Ga0373937_0038233_2463_2930 146
204 3300037312 Ga0395899_0006417 Ga0395899_0006417_2049_2516 146
205 3300037418 Ga0395900_0000413 Ga0395900_0000413_54414_54881 146
206 3300037466 Ga0395898_0002918 Ga0395898_0002918_6018_6485 146
207 3300037471 Ga0395905_0000188 Ga0395905_0000188_43190_43657 146
208 3300038443 Ga0395901_0002175 Ga0395901_0002175_6675_7142 146
209 3300041512 Ga0451853_3347682 Ga0451853_3347682_650_1117 146
210 3300046454 Ga0495592_0416181 Ga0495592_0416181_310_777 146
211 3300046462 Ga0495651_0407037 Ga0495651_0407037_300_767 146
212 3300046463 Ga0495653_0264837 Ga0495653_0264837_294_761 146
213 3300046511 Ga0495608_0110103 Ga0495608_0110103_326_793 146
214 3300046514 Ga0495618_0018669 Ga0495618_0018669_3371_3838 146
215 3300046516 Ga0495628_0026986 Ga0495628_0026986_3070_3537 146
216 3300046517 Ga0495630_0385497 Ga0495630_0385497_312_779 146
217 3300046543 Ga0495645_0319387 Ga0495645_0319387_213_680 146
218 3300046642 Ga0495634_0031046 Ga0495634_0031046_172_639 146
219 3300046675 Ga0495657_0182297 Ga0495657_0182297_578_1045 146
220 3300046678 Ga0495599_0130907 Ga0495599_0130907_121_588 146
221 3300046689 Ga0495613_0163189 Ga0495613_0163189_355_822 146
222 3300047317 Ga0495604_0102239 Ga0495604_0102239_346_813 146
223 3300047319 Ga0495674_0418637 Ga0495674_0418637_464_931 146
224 3300047322 Ga0495680_0159932 Ga0495680_0159932_536_1003 146
225 3300047471 Ga0495684_0111773 Ga0495684_0111773_855_1322 146
226 3300049850 Ga0501204_004322 Ga0501204_004322_654_1124 146
227 3300053085 Ga0495619_0264096 Ga0495619_0264096_373_840 146
228 3300002739 JGI25158J39367_1021941 JGI25158J39367_10219411 147
229 3300003320 rootH2_10130614 rootH2_101306142 147
230 3300003322 rootL2_10048850 rootL2_1004885030 147
231 3300003322 rootL2_10174140 rootL2_101741409 147
232 3300003323 rootH1_10138576 rootH1_101385767 147
233 3300005262 Ga0065165_1009998 Ga0065165_10099985 147
234 3300005535 Ga0070684_100585545 Ga0070684_1005855452 147
235 3300005543 Ga0070672_101235342 Ga0070672_1012353421 147
236 3300005564 Ga0070664_100384321 Ga0070664_1003843212 147
237 3300005614 Ga0068856_100089559 Ga0068856_1000895593 147
238 3300006358 Ga0068871_101268472 Ga0068871_1012684721 147
239 3300013102 Ga0157371_10015505 Ga0157371_100155052 147
240 3300013102 Ga0157371_10077083 Ga0157371_100770832 147
241 3300013307 Ga0157372_10647996 Ga0157372_106479962 147
242 3300013307 Ga0157372_10785644 Ga0157372_107856442 147
243 3300014326 Ga0157380_10367811 Ga0157380_103678112 147
244 3300014968 Ga0157379_11231856 Ga0157379_112318561 147
245 3300025208 Ga0209436_101283 Ga0209436_1012837 147
246 3300025302 Ga0207426_1011778 Ga0207426_10117782 147
247 3300025904 Ga0207647_10006111 Ga0207647_100061114 147
248 3300025913 Ga0207695_10002928 Ga0207695_100029286 147
249 3300025913 Ga0207695_10855230 Ga0207695_108552302 147
250 3300025925 Ga0207650_10217351 Ga0207650_102173512 147
251 3300025944 Ga0207661_10115544 Ga0207661_101155443 147
252 3300026078 Ga0207702_10045993 Ga0207702_100459932 147
253 3300037471 Ga0395905_0000003 Ga0395905_0000003_537871_538347 147
254 3300037471 Ga0395905_0063365 Ga0395905_0063365_1987_2463 147
255 3300041463 Ga0451804_0476071 Ga0451804_0476071_224_703 147
256 3300013306 Ga0163162_12795412 Ga0163162_127954121 148
257 3300013308 Ga0157375_10490844 Ga0157375_104908442 148
258 3300014325 Ga0163163_10172367 Ga0163163_101723674 148
259 3300014968 Ga0157379_10108590 Ga0157379_101085902 148
260 3300014969 Ga0157376_10001065 Ga0157376_1000106517 148
261 3300036401 Ga0373937_0315496 Ga0373937_0315496_46_540 148
262 3300049770 Ga0501273_094003 Ga0501273_094003_21_497 148
263 2162886007 SwRhRL2b_contig_2879104 SwRhRL2b_0102.00000280 149
264 3300005289 Ga0065704_10070133 Ga0065704_10070133490 149
265 3300031251 Ga0265327_10000614 Ga0265327_1000061416 149
266 3300049568 Ga0501031_0074231 Ga0501031_0074231_12_500 149
267 3300049570 Ga0501033_0000034 Ga0501033_0000034_121431_121919 149
268 3300049571 Ga0501034_0008038 Ga0501034_0008038_1556_2044 149
269 3300049572 Ga0501036_0232303 Ga0501036_0232303_12_500 149
270 3300049573 Ga0501037_0003401 Ga0501037_0003401_1283_1771 149
271 3300049574 Ga0501038_0024914 Ga0501038_0024914_1543_2031 149
272 3300049575 Ga0501039_0213700 Ga0501039_0213700_602_1090 149
273 3300049579 Ga0501043_0000923 Ga0501043_0000923_12259_12747 149
274 3300049581 Ga0501047_0108840 Ga0501047_0108840_487_975 149
275 3300049822 Ga0501035_0002384 Ga0501035_0002384_8072_8560 149
276 3300049823 Ga0501044_0012839 Ga0501044_0012839_7464_7952 149
277 3300049824 Ga0501045_0000118 Ga0501045_0000118_15546_16034 149

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vq2-assembly1.cif.gz_A structure of apo-hstrpm2 channel tm domain 0.2174 6 124
7vq2-assembly1.cif.gz_A structure of apo-hstrpm2 channel tm domain 0.1866 6 124
6puo-assembly1.cif.gz_A human trpm2 in the apo state 0.1683 4 148
6puo-assembly1.cif.gz_A human trpm2 in the apo state 0.1647 4 148
ID Description Score Start End Superfamily
af_Q18544_272_478_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5214 6 91 1.20.1250.20
af_Q23514_267_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4038 5 142 1.20.1250.20
af_Q23514_267_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3814 5 142 1.20.1250.20
af_Q9M8M1_345_541_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3758 8 142 1.20.1250.20
af_Q8K0H7_13_222_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3701 5 132 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1M5DSU9-F1-model_v4 Beta-carotene 3-hydroxylase 0.8642 4 148 GO:0010291
GO:0016020
GO:0016119
GO:0016123
AF-A0A2T6AEJ7-F1-model_v4 Beta-carotene 3-hydroxylase 0.8624 1 140 GO:0005506
GO:0010291
GO:0016020
GO:0016119
GO:0016123
AF-A0A162R2G4-F1-model_v4 Beta-carotene hydroxylase 0.8575 1 148 GO:0010291
GO:0016020
GO:0016119
GO:0016123
AF-A0A3P3WFV4-F1-model_v4 Beta-carotene hydroxylase 0.8565 5 148 GO:0010291
GO:0016020
GO:0016119
GO:0016123
AF-A0A1M3GGT2-F1-model_v4 deleted 0.8545 1 147

Feature Viewer

pLDDT pTM Quality
80.73 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map