F381640
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 277 | 190 | 264 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100380894|Ga0068867_1003808942 |
| Length | 170 |
| Sequence | LFTGKKCLQHYLTNMENILINILIVLASFLSMEGVAWFTHKYVMHGLLWTLHKDHHKKESSAFFEHNDFFTLIFSLPGIAGLFFGMQQDSNFLFWIGLGITIYGLAYFLVHDIFIHQRFKLFRNADNNYFKAIRRAHKVHHKHLGKQDGECFGMLWVPFKYFKNLNSKKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 3 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 4 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 5 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 6 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 7 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 8 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 9 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 10 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 11 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 12 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 13 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 14 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 112 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 113 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 116 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 117 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 118 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 120 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 121 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 122 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 128 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 129 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 130 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 131 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 132 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 133 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 134 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 135 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 154 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 155 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 156 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 157 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 158 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 159 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 169 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 170 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 171 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 172 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 173 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 174 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 175 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 176 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 177 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 178 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 179 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 180 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 181 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 182 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 183 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 184 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 185 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 189 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.31 |
| Metatranscriptomes | 0 |
| Isolates | 4.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.89 |
| Nodule | 0 |
| Rhizoplane | 1.44 |
| Rhizosphere | 87.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2879104 | 2162886007 | Bacteria | 104588 |
| 2 | JGI25158J39367_1021941 | 3300002739 | Bacteria | 772 |
| 3 | JGI25164J39214_1001715 | 3300002772 | Bacteria | 4417 |
| 4 | rootH2_10130614 | 3300003320 | Unclassified | 1778 |
| 5 | rootH2_10225484 | 3300003320 | Unclassified | 1128 |
| 6 | rootH2_10327907 | 3300003320 | Bacteria | 1564 |
| 7 | rootL2_10048850 | 3300003322 | Bacteria | 41711 |
| 8 | rootL2_10174140 | 3300003322 | Bacteria | 8552 |
| 9 | rootH1_10008479 | 3300003323 | Bacteria | 21334 |
| 10 | rootH1_10138576 | 3300003323 | Bacteria | 11483 |
| 11 | rootH1_10207745 | 3300003323 | Bacteria | 3332 |
| 12 | Ga0065165_1009998 | 3300005262 | Bacteria | 4170 |
| 13 | Ga0065704_10070133 | 3300005289 | Bacteria | 1266035 |
| 14 | Ga0065704_10329107 | 3300005289 | Bacteria | 840 |
| 15 | Ga0065704_10580231 | 3300005289 | Bacteria | 618 |
| 16 | Ga0065715_10097432 | 3300005293 | Bacteria | 3705 |
| 17 | Ga0070658_10068279 | 3300005327 | Bacteria | 2906 |
| 18 | Ga0070683_100006900 | 3300005329 | Bacteria | 9542 |
| 19 | Ga0070683_100165177 | 3300005329 | Bacteria | 2100 |
| 20 | Ga0070670_100732950 | 3300005331 | Bacteria | 890 |
| 21 | Ga0070666_10168947 | 3300005335 | Unclassified | 1531 |
| 22 | Ga0070660_100386257 | 3300005339 | Bacteria | 1156 |
| 23 | Ga0070661_100005613 | 3300005344 | Bacteria | 8643 |
| 24 | Ga0070661_100429052 | 3300005344 | Bacteria | 1049 |
| 25 | Ga0070661_100566559 | 3300005344 | Bacteria | 915 |
| 26 | Ga0070692_10415937 | 3300005345 | Bacteria | 852 |
| 27 | Ga0070671_100176134 | 3300005355 | Unclassified | 1810 |
| 28 | Ga0070671_100332428 | 3300005355 | Unclassified | 1295 |
| 29 | Ga0070671_101166914 | 3300005355 | Bacteria | 677 |
| 30 | Ga0070659_100014272 | 3300005366 | Bacteria | 5931 |
| 31 | Ga0070659_100031753 | 3300005366 | Bacteria | 4092 |
| 32 | Ga0070659_100050397 | 3300005366 | Bacteria | 3273 |
| 33 | Ga0070659_100085025 | 3300005366 | Bacteria | 2530 |
| 34 | Ga0070667_100027934 | 3300005367 | Bacteria | 4695 |
| 35 | Ga0070667_101060007 | 3300005367 | Bacteria | 757 |
| 36 | Ga0070700_100743645 | 3300005441 | Bacteria | 784 |
| 37 | Ga0070700_100852652 | 3300005441 | Bacteria | 738 |
| 38 | Ga0070678_100296188 | 3300005456 | Unclassified | 1373 |
| 39 | Ga0070678_101047737 | 3300005456 | Bacteria | 751 |
| 40 | Ga0070662_100218368 | 3300005457 | Bacteria | 1520 |
| 41 | Ga0068867_100380894 | 3300005459 | Bacteria | 1185 |
| 42 | Ga0068867_100564898 | 3300005459 | Bacteria | 987 |
| 43 | Ga0070685_10002749 | 3300005466 | Bacteria | 9013 |
| 44 | Ga0070679_100006163 | 3300005530 | Bacteria | 11160 |
| 45 | Ga0070679_100028782 | 3300005530 | Bacteria | 5480 |
| 46 | Ga0070679_100038910 | 3300005530 | Bacteria | 4729 |
| 47 | Ga0070684_100001436 | 3300005535 | Bacteria | 17157 |
| 48 | Ga0070684_100585545 | 3300005535 | Bacteria | 1037 |
| 49 | Ga0068853_100034853 | 3300005539 | Bacteria | 4273 |
| 50 | Ga0068853_100696429 | 3300005539 | Bacteria | 969 |
| 51 | Ga0070672_101235342 | 3300005543 | Bacteria | 666 |
| 52 | Ga0070665_100003784 | 3300005548 | Bacteria | 16014 |
| 53 | Ga0070665_100082991 | 3300005548 | Bacteria | 3210 |
| 54 | Ga0068855_100002609 | 3300005563 | Bacteria | 22210 |
| 55 | Ga0068855_101340372 | 3300005563 | Bacteria | 739 |
| 56 | Ga0070664_100005627 | 3300005564 | Bacteria | 10087 |
| 57 | Ga0070664_100101104 | 3300005564 | Bacteria | 2507 |
| 58 | Ga0070664_100384321 | 3300005564 | Bacteria | 1282 |
| 59 | Ga0068857_100008296 | 3300005577 | Bacteria | 8977 |
| 60 | Ga0068856_100089559 | 3300005614 | Bacteria | 3060 |
| 61 | Ga0068852_100307994 | 3300005616 | Bacteria | 1535 |
| 62 | Ga0068859_100257284 | 3300005617 | Bacteria | 1836 |
| 63 | Ga0068864_101848544 | 3300005618 | Bacteria | 609 |
| 64 | Ga0068851_10000051 | 3300005834 | Bacteria | 72304 |
| 65 | Ga0068863_100807336 | 3300005841 | Bacteria | 936 |
| 66 | Ga0068858_100210926 | 3300005842 | Bacteria | 1838 |
| 67 | Ga0070716_101235513 | 3300006173 | Bacteria | 601 |
| 68 | Ga0068871_100175778 | 3300006358 | Bacteria | 1838 |
| 69 | Ga0068871_100657510 | 3300006358 | Bacteria | 957 |
| 70 | Ga0068871_100778412 | 3300006358 | Bacteria | 881 |
| 71 | Ga0068871_101268472 | 3300006358 | Bacteria | 692 |
| 72 | Ga0075428_100094271 | 3300006844 | Unclassified | 3264 |
| 73 | Ga0075429_101699787 | 3300006880 | Unclassified | 548 |
| 74 | Ga0097620_100257295 | 3300006931 | Bacteria | 1836 |
| 75 | Ga0097620_101905863 | 3300006931 | Unclassified | 656 |
| 76 | Ga0105240_10186219 | 3300009093 | Bacteria | 2445 |
| 77 | Ga0105240_10204820 | 3300009093 | Bacteria | 2310 |
| 78 | Ga0111539_10136238 | 3300009094 | Bacteria | 2875 |
| 79 | Ga0105247_10293589 | 3300009101 | Unclassified | 1125 |
| 80 | Ga0105241_11427168 | 3300009174 | Bacteria | 664 |
| 81 | Ga0105237_10002134 | 3300009545 | Bacteria | 24902 |
| 82 | Ga0105239_10022542 | 3300010375 | Bacteria | 6943 |
| 83 | Ga0105239_10373181 | 3300010375 | Unclassified | 1612 |
| 84 | Ga0157373_10012718 | 3300013100 | Bacteria | 6185 |
| 85 | Ga0157373_10249756 | 3300013100 | Bacteria | 1255 |
| 86 | Ga0157371_10015505 | 3300013102 | Bacteria | 5716 |
| 87 | Ga0157371_10077083 | 3300013102 | Unclassified | 2360 |
| 88 | Ga0157370_10003879 | 3300013104 | Bacteria | 17425 |
| 89 | Ga0157369_10844914 | 3300013105 | Bacteria | 940 |
| 90 | Ga0157374_10094322 | 3300013296 | Bacteria | 2860 |
| 91 | Ga0163162_10116965 | 3300013306 | Bacteria | 2767 |
| 92 | Ga0163162_10300714 | 3300013306 | Bacteria | 1736 |
| 93 | Ga0163162_10747493 | 3300013306 | Bacteria | 1097 |
| 94 | Ga0163162_12795412 | 3300013306 | Bacteria | 562 |
| 95 | Ga0157372_10025332 | 3300013307 | Bacteria | 6447 |
| 96 | Ga0157372_10647996 | 3300013307 | Bacteria | 1230 |
| 97 | Ga0157372_10785644 | 3300013307 | Bacteria | 1106 |
| 98 | Ga0157375_10272072 | 3300013308 | Bacteria | 1856 |
| 99 | Ga0157375_10490844 | 3300013308 | Bacteria | 1393 |
| 100 | Ga0157375_10670965 | 3300013308 | Bacteria | 1192 |
| 101 | Ga0163163_10172367 | 3300014325 | Bacteria | 2210 |
| 102 | Ga0163163_10236081 | 3300014325 | Unclassified | 1878 |
| 103 | Ga0163163_10491212 | 3300014325 | Bacteria | 1289 |
| 104 | Ga0157380_10367811 | 3300014326 | Bacteria | 1352 |
| 105 | Ga0157380_10691608 | 3300014326 | Bacteria | 1023 |
| 106 | Ga0157380_12219089 | 3300014326 | Bacteria | 613 |
| 107 | Ga0157379_10108590 | 3300014968 | Bacteria | 2491 |
| 108 | Ga0157379_11231856 | 3300014968 | Bacteria | 721 |
| 109 | Ga0157376_10001065 | 3300014969 | Bacteria | 17971 |
| 110 | Ga0157376_10075603 | 3300014969 | Unclassified | 2875 |
| 111 | Ga0157376_10707953 | 3300014969 | Bacteria | 1013 |
| 112 | Ga0182006_1002698 | 3300015261 | Bacteria | 9531 |
| 113 | Ga0163161_10001288 | 3300017792 | Bacteria | 18690 |
| 114 | Ga0213876_10076571 | 3300021384 | Bacteria | 1767 |
| 115 | Ga0209436_101283 | 3300025208 | Bacteria | 8990 |
| 116 | Ga0207427_100043 | 3300025231 | Bacteria | 249595 |
| 117 | Ga0209437_100170 | 3300025233 | Bacteria | 142489 |
| 118 | Ga0209026_1005989 | 3300025250 | Bacteria | 3106 |
| 119 | Ga0209233_1000349 | 3300025261 | Bacteria | 43702 |
| 120 | Ga0207426_1011778 | 3300025302 | Bacteria | 3311 |
| 121 | Ga0207656_10000487 | 3300025321 | Bacteria | 13133 |
| 122 | Ga0207680_10208104 | 3300025903 | Unclassified | 1336 |
| 123 | Ga0207647_10006111 | 3300025904 | Bacteria | 8774 |
| 124 | Ga0207705_10155750 | 3300025909 | Bacteria | 1714 |
| 125 | Ga0207654_11229303 | 3300025911 | Bacteria | 546 |
| 126 | Ga0207707_10314113 | 3300025912 | Bacteria | 1354 |
| 127 | Ga0207695_10002928 | 3300025913 | Bacteria | 24643 |
| 128 | Ga0207695_10855230 | 3300025913 | Unclassified | 789 |
| 129 | Ga0207671_10002711 | 3300025914 | Bacteria | 18546 |
| 130 | Ga0207657_10261179 | 3300025919 | Bacteria | 1378 |
| 131 | Ga0207657_10476402 | 3300025919 | Bacteria | 979 |
| 132 | Ga0207649_10013797 | 3300025920 | Bacteria | 4518 |
| 133 | Ga0207649_10558004 | 3300025920 | Bacteria | 877 |
| 134 | Ga0207652_10000168 | 3300025921 | Bacteria | 71181 |
| 135 | Ga0207652_10001770 | 3300025921 | Bacteria | 18826 |
| 136 | Ga0207652_10434144 | 3300025921 | Bacteria | 1184 |
| 137 | Ga0207650_10217351 | 3300025925 | Bacteria | 1537 |
| 138 | Ga0207644_10211386 | 3300025931 | Unclassified | 1534 |
| 139 | Ga0207690_10034479 | 3300025932 | Bacteria | 3262 |
| 140 | Ga0207690_10062628 | 3300025932 | Bacteria | 2533 |
| 141 | Ga0207690_10147860 | 3300025932 | Bacteria | 1739 |
| 142 | Ga0207706_10437698 | 3300025933 | Bacteria | 1132 |
| 143 | Ga0207661_10115544 | 3300025944 | Bacteria | 2277 |
| 144 | Ga0207661_10167135 | 3300025944 | Bacteria | 1912 |
| 145 | Ga0207679_10003836 | 3300025945 | Bacteria | 9319 |
| 146 | Ga0207679_10277520 | 3300025945 | Bacteria | 1436 |
| 147 | Ga0207679_10538764 | 3300025945 | Unclassified | 1046 |
| 148 | Ga0207667_10028249 | 3300025949 | Bacteria | 6095 |
| 149 | Ga0207667_11233212 | 3300025949 | Bacteria | 726 |
| 150 | Ga0207703_10277159 | 3300026035 | Bacteria | 1522 |
| 151 | Ga0207639_10185447 | 3300026041 | Bacteria | 1773 |
| 152 | Ga0207708_10556758 | 3300026075 | Bacteria | 967 |
| 153 | Ga0207702_10045993 | 3300026078 | Bacteria | 3673 |
| 154 | Ga0207702_11794005 | 3300026078 | Bacteria | 606 |
| 155 | Ga0207641_10287749 | 3300026088 | Bacteria | 1548 |
| 156 | Ga0207674_10001383 | 3300026116 | Bacteria | 31265 |
| 157 | Ga0207683_10488447 | 3300026121 | Unclassified | 1137 |
| 158 | Ga0207683_10902995 | 3300026121 | Bacteria | 820 |
| 159 | Ga0207698_10080378 | 3300026142 | Bacteria | 2626 |
| 160 | Ga0268266_10004125 | 3300028379 | Bacteria | 14039 |
| 161 | Ga0265327_10000614 | 3300031251 | Bacteria | 58841 |
| 162 | Ga0265327_10012297 | 3300031251 | Bacteria | 5793 |
| 163 | Ga0307408_100000366 | 3300031548 | Bacteria | 41450 |
| 164 | Ga0307405_10184842 | 3300031731 | Bacteria | 1500 |
| 165 | Ga0307412_10115132 | 3300031911 | Unclassified | 1927 |
| 166 | Ga0307412_10266443 | 3300031911 | Bacteria | 1338 |
| 167 | Ga0307414_10000011 | 3300032004 | Bacteria | 338253 |
| 168 | Ga0307414_10017531 | 3300032004 | Bacteria | 4383 |
| 169 | Ga0307414_10031865 | 3300032004 | Bacteria | 3463 |
| 170 | Ga0307414_10197300 | 3300032004 | Bacteria | 1634 |
| 171 | Ga0307414_10202865 | 3300032004 | Bacteria | 1614 |
| 172 | Ga0307414_10376765 | 3300032004 | Unclassified | 1226 |
| 173 | Ga0373934_0136271 | 3300035086 | Bacteria | 1003 |
| 174 | Ga0373934_0174068 | 3300035086 | Unclassified | 884 |
| 175 | Ga0373936_0340756 | 3300035113 | Unclassified | 681 |
| 176 | Ga0373956_0089511 | 3300035119 | Unclassified | 1419 |
| 177 | Ga0316574_0005486 | 3300035398 | Bacteria | 6763 |
| 178 | Ga0316574_0406448 | 3300035398 | Bacteria | 857 |
| 179 | Ga0373933_0071456 | 3300035724 | Unclassified | 2113 |
| 180 | Ga0373947_1265348 | 3300035725 | Unclassified | 502 |
| 181 | Ga0373937_0038233 | 3300036401 | Unclassified | 4374 |
| 182 | Ga0373937_0315496 | 3300036401 | Bacteria | 1479 |
| 183 | Ga0395899_0002260 | 3300037312 | Bacteria | 15752 |
| 184 | Ga0395899_0003693 | 3300037312 | Bacteria | 12111 |
| 185 | Ga0395899_0006417 | 3300037312 | Bacteria | 9113 |
| 186 | Ga0395899_0450532 | 3300037312 | Bacteria | 843 |
| 187 | Ga0395900_0000413 | 3300037418 | Bacteria | 61555 |
| 188 | Ga0395900_0012986 | 3300037418 | Bacteria | 8509 |
| 189 | Ga0395900_0043531 | 3300037418 | Bacteria | 4627 |
| 190 | Ga0395900_0221558 | 3300037418 | Bacteria | 1906 |
| 191 | Ga0395898_0002918 | 3300037466 | Bacteria | 19458 |
| 192 | Ga0395898_0008939 | 3300037466 | Bacteria | 10551 |
| 193 | Ga0395898_0019747 | 3300037466 | Bacteria | 6852 |
| 194 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 195 | Ga0395905_0000188 | 3300037471 | Bacteria | 98070 |
| 196 | Ga0395905_0063365 | 3300037471 | Bacteria | 3459 |
| 197 | Ga0395901_0002175 | 3300038443 | Bacteria | 20011 |
| 198 | Ga0395901_0004792 | 3300038443 | Bacteria | 13652 |
| 199 | Ga0395901_0023218 | 3300038443 | Bacteria | 6358 |
| 200 | Ga0395901_1573096 | 3300038443 | Bacteria | 611 |
| 201 | Ga0436365_0148470 | 3300039437 | Bacteria | 907 |
| 202 | Ga0451804_0476071 | 3300041463 | Bacteria | 783 |
| 203 | Ga0451849_0438968 | 3300041505 | Bacteria | 686 |
| 204 | Ga0451853_3347682 | 3300041512 | Bacteria | 1242 |
| 205 | Ga0451577_0031143 | 3300042876 | Bacteria | 4815 |
| 206 | Ga0453684_0145458 | 3300044712 | Bacteria | 2824 |
| 207 | Ga0466957_0011800 | 3300044842 | Bacteria | 5052 |
| 208 | Ga0466957_0877428 | 3300044842 | Bacteria | 640 |
| 209 | Ga0495592_0416181 | 3300046454 | Unclassified | 848 |
| 210 | Ga0495629_0841367 | 3300046459 | Bacteria | 604 |
| 211 | Ga0495651_0407037 | 3300046462 | Unclassified | 887 |
| 212 | Ga0495653_0264837 | 3300046463 | Unclassified | 1134 |
| 213 | Ga0495608_0110103 | 3300046511 | Unclassified | 1771 |
| 214 | Ga0495610_0355946 | 3300046512 | Bacteria | 550 |
| 215 | Ga0495618_0018669 | 3300046514 | Bacteria | 4260 |
| 216 | Ga0495628_0026986 | 3300046516 | Bacteria | 4675 |
| 217 | Ga0495630_0385497 | 3300046517 | Unclassified | 1073 |
| 218 | Ga0495645_0319387 | 3300046543 | Unclassified | 1009 |
| 219 | Ga0495634_0031046 | 3300046642 | Bacteria | 3683 |
| 220 | Ga0495657_0182297 | 3300046675 | Unclassified | 1288 |
| 221 | Ga0495599_0130907 | 3300046678 | Unclassified | 1558 |
| 222 | Ga0495613_0163189 | 3300046689 | Unclassified | 1584 |
| 223 | Ga0495604_0102239 | 3300047317 | Unclassified | 2104 |
| 224 | Ga0495674_0418637 | 3300047319 | Unclassified | 1080 |
| 225 | Ga0495680_0159932 | 3300047322 | Unclassified | 1636 |
| 226 | Ga0495684_0111773 | 3300047471 | Unclassified | 2061 |
| 227 | Ga0496110_1092604 | 3300048913 | Bacteria | 706 |
| 228 | Ga0496113_0545440 | 3300048916 | Bacteria | 930 |
| 229 | Ga0496115_0002302 | 3300048918 | Bacteria | 13673 |
| 230 | Ga0501290_003805 | 3300049513 | Bacteria | 1890 |
| 231 | Ga0501297_001313 | 3300049520 | Bacteria | 2279 |
| 232 | Ga0501298_033121 | 3300049521 | Bacteria | 1022 |
| 233 | Ga0501031_0074231 | 3300049568 | Bacteria | 2214 |
| 234 | Ga0501033_0000034 | 3300049570 | Bacteria | 152329 |
| 235 | Ga0501034_0008038 | 3300049571 | Bacteria | 11191 |
| 236 | Ga0501036_0232303 | 3300049572 | Bacteria | 1547 |
| 237 | Ga0501037_0003401 | 3300049573 | Bacteria | 11573 |
| 238 | Ga0501038_0024914 | 3300049574 | Bacteria | 5332 |
| 239 | Ga0501039_0213700 | 3300049575 | Bacteria | 1516 |
| 240 | Ga0501043_0000923 | 3300049579 | Bacteria | 26062 |
| 241 | Ga0501047_0108840 | 3300049581 | Bacteria | 2654 |
| 242 | Ga0501199_061443 | 3300049650 | Bacteria | 525 |
| 243 | Ga0501201_008482 | 3300049651 | Bacteria | 994 |
| 244 | Ga0501202_000603 | 3300049652 | Bacteria | 5270 |
| 245 | Ga0501206_001229 | 3300049653 | Bacteria | 3208 |
| 246 | Ga0501217_004413 | 3300049661 | Bacteria | 2891 |
| 247 | Ga0501223_104906 | 3300049663 | Bacteria | 585 |
| 248 | Ga0501224_028163 | 3300049664 | Bacteria | 840 |
| 249 | Ga0501235_008568 | 3300049669 | Bacteria | 2232 |
| 250 | Ga0501240_047566 | 3300049673 | Bacteria | 728 |
| 251 | Ga0501243_015456 | 3300049675 | Bacteria | 1227 |
| 252 | Ga0501252_000747 | 3300049682 | Bacteria | 2693 |
| 253 | Ga0501221_009592 | 3300049704 | Bacteria | 1702 |
| 254 | Ga0501225_0001468 | 3300049705 | Bacteria | 7383 |
| 255 | Ga0501225_0133551 | 3300049705 | Bacteria | 745 |
| 256 | Ga0501245_008982 | 3300049708 | Bacteria | 1430 |
| 257 | Ga0501241_002215 | 3300049758 | Bacteria | 3802 |
| 258 | Ga0501263_041426 | 3300049760 | Bacteria | 678 |
| 259 | Ga0501273_094003 | 3300049770 | Unclassified | 513 |
| 260 | Ga0501035_0002384 | 3300049822 | Bacteria | 18456 |
| 261 | Ga0501044_0012839 | 3300049823 | Bacteria | 9069 |
| 262 | Ga0501045_0000118 | 3300049824 | Bacteria | 40712 |
| 263 | Ga0501204_004322 | 3300049850 | Bacteria | 1527 |
| 264 | Ga0495619_0264096 | 3300053085 | Unclassified | 1193 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026078 | Ga0207702_11794005 | Ga0207702_117940052 | 115 |
| 2 | 3300005539 | Ga0068853_100034853 | Ga0068853_1000348533 | 117 |
| 3 | 3300005577 | Ga0068857_100008296 | Ga0068857_1000082962 | 117 |
| 4 | 3300025920 | Ga0207649_10013797 | Ga0207649_100137972 | 117 |
| 5 | 3300026041 | Ga0207639_10185447 | Ga0207639_101854472 | 117 |
| 6 | 3300026116 | Ga0207674_10001383 | Ga0207674_1000138321 | 117 |
| 7 | 3300044842 | Ga0466957_0877428 | Ga0466957_0877428_223_606 | 118 |
| 8 | 3300009093 | Ga0105240_10204820 | Ga0105240_102048203 | 119 |
| 9 | 3300032004 | Ga0307414_10202865 | Ga0307414_102028653 | 127 |
| 10 | 3300041505 | Ga0451849_0438968 | Ga0451849_0438968_68_481 | 128 |
| 11 | 3300042876 | Ga0451577_0031143 | Ga0451577_0031143_700_1131 | 128 |
| 12 | 3300044712 | Ga0453684_0145458 | Ga0453684_0145458_166_597 | 128 |
| 13 | 3300005335 | Ga0070666_10168947 | Ga0070666_101689472 | 129 |
| 14 | 3300005344 | Ga0070661_100566559 | Ga0070661_1005665592 | 129 |
| 15 | 3300005355 | Ga0070671_100176134 | Ga0070671_1001761342 | 129 |
| 16 | 3300005366 | Ga0070659_100050397 | Ga0070659_1000503971 | 129 |
| 17 | 3300005367 | Ga0070667_100027934 | Ga0070667_1000279346 | 129 |
| 18 | 3300005441 | Ga0070700_100743645 | Ga0070700_1007436451 | 129 |
| 19 | 3300005457 | Ga0070662_100218368 | Ga0070662_1002183682 | 129 |
| 20 | 3300005459 | Ga0068867_100564898 | Ga0068867_1005648982 | 129 |
| 21 | 3300005548 | Ga0070665_100082991 | Ga0070665_1000829912 | 129 |
| 22 | 3300005616 | Ga0068852_100307994 | Ga0068852_1003079943 | 129 |
| 23 | 3300005617 | Ga0068859_100257284 | Ga0068859_1002572842 | 129 |
| 24 | 3300006931 | Ga0097620_100257295 | Ga0097620_1002572953 | 129 |
| 25 | 3300009101 | Ga0105247_10293589 | Ga0105247_102935892 | 129 |
| 26 | 3300010375 | Ga0105239_10373181 | Ga0105239_103731812 | 129 |
| 27 | 3300013306 | Ga0163162_10300714 | Ga0163162_103007142 | 129 |
| 28 | 3300014325 | Ga0163163_10236081 | Ga0163163_102360812 | 129 |
| 29 | 3300025903 | Ga0207680_10208104 | Ga0207680_102081042 | 129 |
| 30 | 3300025920 | Ga0207649_10558004 | Ga0207649_105580042 | 129 |
| 31 | 3300025931 | Ga0207644_10211386 | Ga0207644_102113862 | 129 |
| 32 | 3300025932 | Ga0207690_10034479 | Ga0207690_100344791 | 129 |
| 33 | 3300025933 | Ga0207706_10437698 | Ga0207706_104376982 | 129 |
| 34 | 3300026035 | Ga0207703_10277159 | Ga0207703_102771592 | 129 |
| 35 | 3300026075 | Ga0207708_10556758 | Ga0207708_105567582 | 129 |
| 36 | 3300026142 | Ga0207698_10080378 | Ga0207698_100803783 | 129 |
| 37 | 3300049513 | Ga0501290_003805 | Ga0501290_003805_111_578 | 129 |
| 38 | 3300049520 | Ga0501297_001313 | Ga0501297_001313_886_1353 | 129 |
| 39 | 3300049521 | Ga0501298_033121 | Ga0501298_033121_362_829 | 129 |
| 40 | 3300049650 | Ga0501199_061443 | Ga0501199_061443_16_483 | 129 |
| 41 | 3300049651 | Ga0501201_008482 | Ga0501201_008482_193_660 | 129 |
| 42 | 3300049652 | Ga0501202_000603 | Ga0501202_000603_4645_5112 | 129 |
| 43 | 3300049653 | Ga0501206_001229 | Ga0501206_001229_52_519 | 129 |
| 44 | 3300049661 | Ga0501217_004413 | Ga0501217_004413_226_693 | 129 |
| 45 | 3300049663 | Ga0501223_104906 | Ga0501223_104906_23_490 | 129 |
| 46 | 3300049664 | Ga0501224_028163 | Ga0501224_028163_147_614 | 129 |
| 47 | 3300049669 | Ga0501235_008568 | Ga0501235_008568_929_1396 | 129 |
| 48 | 3300049673 | Ga0501240_047566 | Ga0501240_047566_226_693 | 129 |
| 49 | 3300049675 | Ga0501243_015456 | Ga0501243_015456_533_1000 | 129 |
| 50 | 3300049682 | Ga0501252_000747 | Ga0501252_000747_1257_1724 | 129 |
| 51 | 3300049704 | Ga0501221_009592 | Ga0501221_009592_914_1381 | 129 |
| 52 | 3300049705 | Ga0501225_0133551 | Ga0501225_0133551_88_555 | 129 |
| 53 | 3300049708 | Ga0501245_008982 | Ga0501245_008982_204_671 | 129 |
| 54 | 3300049758 | Ga0501241_002215 | Ga0501241_002215_1182_1649 | 129 |
| 55 | 3300049760 | Ga0501263_041426 | Ga0501263_041426_70_537 | 129 |
| 56 | 3300005842 | Ga0068858_100210926 | Ga0068858_1002109262 | 130 |
| 57 | 3300013308 | Ga0157375_10670965 | Ga0157375_106709652 | 130 |
| 58 | 3300039437 | Ga0436365_0148470 | Ga0436365_0148470_313_732 | 130 |
| 59 | 3300048913 | Ga0496110_1092604 | Ga0496110_1092604_147_623 | 130 |
| 60 | 3300048916 | Ga0496113_0545440 | Ga0496113_0545440_221_697 | 130 |
| 61 | 3300005329 | Ga0070683_100006900 | Ga0070683_1000069004 | 131 |
| 62 | 3300005344 | Ga0070661_100005613 | Ga0070661_1000056133 | 131 |
| 63 | 3300005366 | Ga0070659_100014272 | Ga0070659_1000142723 | 131 |
| 64 | 3300005366 | Ga0070659_100085025 | Ga0070659_1000850253 | 131 |
| 65 | 3300005535 | Ga0070684_100001436 | Ga0070684_1000014366 | 131 |
| 66 | 3300005564 | Ga0070664_100005627 | Ga0070664_1000056272 | 131 |
| 67 | 3300009093 | Ga0105240_10186219 | Ga0105240_101862192 | 131 |
| 68 | 3300009174 | Ga0105241_11427168 | Ga0105241_114271681 | 131 |
| 69 | 3300010375 | Ga0105239_10022542 | Ga0105239_100225425 | 131 |
| 70 | 3300013100 | Ga0157373_10012718 | Ga0157373_100127184 | 131 |
| 71 | 3300013100 | Ga0157373_10249756 | Ga0157373_102497562 | 131 |
| 72 | 3300013306 | Ga0163162_10116965 | Ga0163162_101169653 | 131 |
| 73 | 3300013308 | Ga0157375_10272072 | Ga0157375_102720722 | 131 |
| 74 | 3300025911 | Ga0207654_11229303 | Ga0207654_112293031 | 131 |
| 75 | 3300025912 | Ga0207707_10314113 | Ga0207707_103141132 | 131 |
| 76 | 3300025921 | Ga0207652_10434144 | Ga0207652_104341441 | 131 |
| 77 | 3300025932 | Ga0207690_10062628 | Ga0207690_100626283 | 131 |
| 78 | 3300025944 | Ga0207661_10167135 | Ga0207661_101671351 | 131 |
| 79 | 3300025945 | Ga0207679_10003836 | Ga0207679_100038368 | 131 |
| 80 | 3300035725 | Ga0373947_1265348 | Ga0373947_1265348_33_455 | 131 |
| 81 | 3300037312 | Ga0395899_0450532 | Ga0395899_0450532_18_440 | 131 |
| 82 | iso_pu_bacteria | 2919509842 | 2919512260 | 131 |
| 83 | 3300006844 | Ga0075428_100094271 | Ga0075428_1000942714 | 133 |
| 84 | iso_pu_bacteria | 2643221667 | 2644371910 | 133 |
| 85 | iso_pu_bacteria | 2738541279 | 2738732737 | 133 |
| 86 | iso_pu_bacteria | 2738541285 | 2738765275 | 133 |
| 87 | iso_pu_bacteria | 2738543007 | 2739214318 | 133 |
| 88 | iso_pu_bacteria | 2816332280 | 2817413224 | 133 |
| 89 | iso_pu_bacteria | 2833640130 | 2833643013 | 133 |
| 90 | iso_pu_bacteria | 2919683626 | 2919687070 | 133 |
| 91 | iso_pu_bacteria | 8056440228 | 8056440490 | 133 |
| 92 | iso_pu_bacteria | 2965320100 | 2965323086 | 134 |
| 93 | 3300006173 | Ga0070716_101235513 | Ga0070716_1012355131 | 137 |
| 94 | 3300025909 | Ga0207705_10155750 | Ga0207705_101557502 | 137 |
| 95 | 3300031731 | Ga0307405_10184842 | Ga0307405_101848422 | 137 |
| 96 | 3300031911 | Ga0307412_10266443 | Ga0307412_102664432 | 137 |
| 97 | 3300032004 | Ga0307414_10000011 | Ga0307414_1000001138 | 137 |
| 98 | 3300032004 | Ga0307414_10017531 | Ga0307414_100175314 | 137 |
| 99 | 3300032004 | Ga0307414_10031865 | Ga0307414_100318652 | 137 |
| 100 | 3300035398 | Ga0316574_0005486 | Ga0316574_0005486_2517_2969 | 137 |
| 101 | 3300035398 | Ga0316574_0406448 | Ga0316574_0406448_323_772 | 137 |
| 102 | 3300046512 | Ga0495610_0355946 | Ga0495610_0355946_25_465 | 137 |
| 103 | 3300005530 | Ga0070679_100038910 | Ga0070679_1000389105 | 138 |
| 104 | 3300005618 | Ga0068864_101848544 | Ga0068864_1018485441 | 138 |
| 105 | 3300015261 | Ga0182006_1002698 | Ga0182006_10026984 | 138 |
| 106 | 3300025921 | Ga0207652_10001770 | Ga0207652_100017707 | 138 |
| 107 | 3300031911 | Ga0307412_10115132 | Ga0307412_101151323 | 139 |
| 108 | iso_pu_bacteria | 2939664404 | 2939666443 | 139 |
| 109 | 3300005456 | Ga0070678_100296188 | Ga0070678_1002961882 | 141 |
| 110 | 3300026121 | Ga0207683_10488447 | Ga0207683_104884472 | 141 |
| 111 | 3300002772 | JGI25164J39214_1001715 | JGI25164J39214_10017155 | 142 |
| 112 | 3300003323 | rootH1_10008479 | rootH1_100084793 | 142 |
| 113 | 3300005355 | Ga0070671_100332428 | Ga0070671_1003324282 | 142 |
| 114 | 3300005466 | Ga0070685_10002749 | Ga0070685_100027493 | 142 |
| 115 | 3300005564 | Ga0070664_100101104 | Ga0070664_1001011043 | 142 |
| 116 | 3300005841 | Ga0068863_100807336 | Ga0068863_1008073361 | 142 |
| 117 | 3300014326 | Ga0157380_10691608 | Ga0157380_106916082 | 142 |
| 118 | 3300014969 | Ga0157376_10075603 | Ga0157376_100756033 | 142 |
| 119 | 3300021384 | Ga0213876_10076571 | Ga0213876_100765712 | 142 |
| 120 | 3300025231 | Ga0207427_100043 | Ga0207427_10004393 | 142 |
| 121 | 3300025233 | Ga0209437_100170 | Ga0209437_10017027 | 142 |
| 122 | 3300025261 | Ga0209233_1000349 | Ga0209233_100034938 | 142 |
| 123 | 3300025945 | Ga0207679_10538764 | Ga0207679_105387642 | 142 |
| 124 | 3300026088 | Ga0207641_10287749 | Ga0207641_102877492 | 142 |
| 125 | 3300046459 | Ga0495629_0841367 | Ga0495629_0841367_123_578 | 142 |
| 126 | 3300005441 | Ga0070700_100852652 | Ga0070700_1008526521 | 143 |
| 127 | 3300005834 | Ga0068851_10000051 | Ga0068851_1000005126 | 143 |
| 128 | 3300025321 | Ga0207656_10000487 | Ga0207656_100004875 | 143 |
| 129 | 3300044842 | Ga0466957_0011800 | Ga0466957_0011800_2704_3165 | 143 |
| 130 | 3300048918 | Ga0496115_0002302 | Ga0496115_0002302_10128_10586 | 143 |
| 131 | 3300049705 | Ga0501225_0001468 | Ga0501225_0001468_3930_4391 | 143 |
| 132 | 3300003320 | rootH2_10327907 | rootH2_103279072 | 144 |
| 133 | 3300003323 | rootH1_10207745 | rootH1_102077453 | 144 |
| 134 | 3300005327 | Ga0070658_10068279 | Ga0070658_100682792 | 144 |
| 135 | 3300005329 | Ga0070683_100165177 | Ga0070683_1001651772 | 144 |
| 136 | 3300005331 | Ga0070670_100732950 | Ga0070670_1007329502 | 144 |
| 137 | 3300005344 | Ga0070661_100429052 | Ga0070661_1004290521 | 144 |
| 138 | 3300005345 | Ga0070692_10415937 | Ga0070692_104159371 | 144 |
| 139 | 3300005355 | Ga0070671_101166914 | Ga0070671_1011669141 | 144 |
| 140 | 3300005367 | Ga0070667_101060007 | Ga0070667_1010600071 | 144 |
| 141 | 3300005530 | Ga0070679_100006163 | Ga0070679_1000061636 | 144 |
| 142 | 3300006358 | Ga0068871_100175778 | Ga0068871_1001757783 | 144 |
| 143 | 3300006358 | Ga0068871_100657510 | Ga0068871_1006575102 | 144 |
| 144 | 3300006358 | Ga0068871_100778412 | Ga0068871_1007784122 | 144 |
| 145 | 3300006931 | Ga0097620_101905863 | Ga0097620_1019058631 | 144 |
| 146 | 3300013296 | Ga0157374_10094322 | Ga0157374_100943223 | 144 |
| 147 | 3300014326 | Ga0157380_12219089 | Ga0157380_122190891 | 144 |
| 148 | 3300025921 | Ga0207652_10000168 | Ga0207652_1000016872 | 144 |
| 149 | 3300025945 | Ga0207679_10277520 | Ga0207679_102775202 | 144 |
| 150 | 3300037312 | Ga0395899_0002260 | Ga0395899_0002260_713_1177 | 144 |
| 151 | 3300037418 | Ga0395900_0043531 | Ga0395900_0043531_2133_2597 | 144 |
| 152 | 3300037418 | Ga0395900_0221558 | Ga0395900_0221558_442_906 | 144 |
| 153 | 3300037466 | Ga0395898_0008939 | Ga0395898_0008939_6443_6907 | 144 |
| 154 | 3300038443 | Ga0395901_0023218 | Ga0395901_0023218_1232_1696 | 144 |
| 155 | 3300038443 | Ga0395901_1573096 | Ga0395901_1573096_65_529 | 144 |
| 156 | iso_pu_bacteria | 2821136567 | 2821143064 | 144 |
| 157 | iso_pu_bacteria | 2904467357 | 2904470784 | 144 |
| 158 | 3300005289 | Ga0065704_10329107 | Ga0065704_103291072 | 145 |
| 159 | 3300005289 | Ga0065704_10580231 | Ga0065704_105802311 | 145 |
| 160 | 3300005293 | Ga0065715_10097432 | Ga0065715_100974324 | 145 |
| 161 | 3300005339 | Ga0070660_100386257 | Ga0070660_1003862572 | 145 |
| 162 | 3300005366 | Ga0070659_100031753 | Ga0070659_1000317534 | 145 |
| 163 | 3300005530 | Ga0070679_100028782 | Ga0070679_1000287824 | 145 |
| 164 | 3300005548 | Ga0070665_100003784 | Ga0070665_1000037848 | 145 |
| 165 | 3300005563 | Ga0068855_100002609 | Ga0068855_1000026098 | 145 |
| 166 | 3300006880 | Ga0075429_101699787 | Ga0075429_1016997871 | 145 |
| 167 | 3300009094 | Ga0111539_10136238 | Ga0111539_101362383 | 145 |
| 168 | 3300013104 | Ga0157370_10003879 | Ga0157370_1000387910 | 145 |
| 169 | 3300013105 | Ga0157369_10844914 | Ga0157369_108449142 | 145 |
| 170 | 3300013307 | Ga0157372_10025332 | Ga0157372_100253323 | 145 |
| 171 | 3300025919 | Ga0207657_10261179 | Ga0207657_102611792 | 145 |
| 172 | 3300025919 | Ga0207657_10476402 | Ga0207657_104764022 | 145 |
| 173 | 3300025932 | Ga0207690_10147860 | Ga0207690_101478603 | 145 |
| 174 | 3300025949 | Ga0207667_10028249 | Ga0207667_100282494 | 145 |
| 175 | 3300028379 | Ga0268266_10004125 | Ga0268266_100041257 | 145 |
| 176 | 3300032004 | Ga0307414_10376765 | Ga0307414_103767652 | 145 |
| 177 | 3300037312 | Ga0395899_0003693 | Ga0395899_0003693_148_615 | 145 |
| 178 | 3300037418 | Ga0395900_0012986 | Ga0395900_0012986_3126_3593 | 145 |
| 179 | 3300037466 | Ga0395898_0019747 | Ga0395898_0019747_1331_1798 | 145 |
| 180 | 3300038443 | Ga0395901_0004792 | Ga0395901_0004792_8163_8630 | 145 |
| 181 | 3300003320 | rootH2_10225484 | rootH2_102254841 | 146 |
| 182 | 3300005456 | Ga0070678_101047737 | Ga0070678_1010477372 | 146 |
| 183 | 3300005459 | Ga0068867_100380894 | Ga0068867_1003808942 | 146 |
| 184 | 3300005539 | Ga0068853_100696429 | Ga0068853_1006964292 | 146 |
| 185 | 3300005563 | Ga0068855_101340372 | Ga0068855_1013403722 | 146 |
| 186 | 3300009545 | Ga0105237_10002134 | Ga0105237_1000213414 | 146 |
| 187 | 3300013306 | Ga0163162_10747493 | Ga0163162_107474932 | 146 |
| 188 | 3300014325 | Ga0163163_10491212 | Ga0163163_104912122 | 146 |
| 189 | 3300014969 | Ga0157376_10707953 | Ga0157376_107079531 | 146 |
| 190 | 3300017792 | Ga0163161_10001288 | Ga0163161_1000128815 | 146 |
| 191 | 3300025250 | Ga0209026_1005989 | Ga0209026_10059892 | 146 |
| 192 | 3300025914 | Ga0207671_10002711 | Ga0207671_1000271111 | 146 |
| 193 | 3300025949 | Ga0207667_11233212 | Ga0207667_112332122 | 146 |
| 194 | 3300026121 | Ga0207683_10902995 | Ga0207683_109029951 | 146 |
| 195 | 3300031251 | Ga0265327_10012297 | Ga0265327_100122972 | 146 |
| 196 | 3300031548 | Ga0307408_100000366 | Ga0307408_1000003665 | 146 |
| 197 | 3300032004 | Ga0307414_10197300 | Ga0307414_101973003 | 146 |
| 198 | 3300035086 | Ga0373934_0136271 | Ga0373934_0136271_516_986 | 146 |
| 199 | 3300035086 | Ga0373934_0174068 | Ga0373934_0174068_124_591 | 146 |
| 200 | 3300035113 | Ga0373936_0340756 | Ga0373936_0340756_32_499 | 146 |
| 201 | 3300035119 | Ga0373956_0089511 | Ga0373956_0089511_679_1146 | 146 |
| 202 | 3300035724 | Ga0373933_0071456 | Ga0373933_0071456_1548_2015 | 146 |
| 203 | 3300036401 | Ga0373937_0038233 | Ga0373937_0038233_2463_2930 | 146 |
| 204 | 3300037312 | Ga0395899_0006417 | Ga0395899_0006417_2049_2516 | 146 |
| 205 | 3300037418 | Ga0395900_0000413 | Ga0395900_0000413_54414_54881 | 146 |
| 206 | 3300037466 | Ga0395898_0002918 | Ga0395898_0002918_6018_6485 | 146 |
| 207 | 3300037471 | Ga0395905_0000188 | Ga0395905_0000188_43190_43657 | 146 |
| 208 | 3300038443 | Ga0395901_0002175 | Ga0395901_0002175_6675_7142 | 146 |
| 209 | 3300041512 | Ga0451853_3347682 | Ga0451853_3347682_650_1117 | 146 |
| 210 | 3300046454 | Ga0495592_0416181 | Ga0495592_0416181_310_777 | 146 |
| 211 | 3300046462 | Ga0495651_0407037 | Ga0495651_0407037_300_767 | 146 |
| 212 | 3300046463 | Ga0495653_0264837 | Ga0495653_0264837_294_761 | 146 |
| 213 | 3300046511 | Ga0495608_0110103 | Ga0495608_0110103_326_793 | 146 |
| 214 | 3300046514 | Ga0495618_0018669 | Ga0495618_0018669_3371_3838 | 146 |
| 215 | 3300046516 | Ga0495628_0026986 | Ga0495628_0026986_3070_3537 | 146 |
| 216 | 3300046517 | Ga0495630_0385497 | Ga0495630_0385497_312_779 | 146 |
| 217 | 3300046543 | Ga0495645_0319387 | Ga0495645_0319387_213_680 | 146 |
| 218 | 3300046642 | Ga0495634_0031046 | Ga0495634_0031046_172_639 | 146 |
| 219 | 3300046675 | Ga0495657_0182297 | Ga0495657_0182297_578_1045 | 146 |
| 220 | 3300046678 | Ga0495599_0130907 | Ga0495599_0130907_121_588 | 146 |
| 221 | 3300046689 | Ga0495613_0163189 | Ga0495613_0163189_355_822 | 146 |
| 222 | 3300047317 | Ga0495604_0102239 | Ga0495604_0102239_346_813 | 146 |
| 223 | 3300047319 | Ga0495674_0418637 | Ga0495674_0418637_464_931 | 146 |
| 224 | 3300047322 | Ga0495680_0159932 | Ga0495680_0159932_536_1003 | 146 |
| 225 | 3300047471 | Ga0495684_0111773 | Ga0495684_0111773_855_1322 | 146 |
| 226 | 3300049850 | Ga0501204_004322 | Ga0501204_004322_654_1124 | 146 |
| 227 | 3300053085 | Ga0495619_0264096 | Ga0495619_0264096_373_840 | 146 |
| 228 | 3300002739 | JGI25158J39367_1021941 | JGI25158J39367_10219411 | 147 |
| 229 | 3300003320 | rootH2_10130614 | rootH2_101306142 | 147 |
| 230 | 3300003322 | rootL2_10048850 | rootL2_1004885030 | 147 |
| 231 | 3300003322 | rootL2_10174140 | rootL2_101741409 | 147 |
| 232 | 3300003323 | rootH1_10138576 | rootH1_101385767 | 147 |
| 233 | 3300005262 | Ga0065165_1009998 | Ga0065165_10099985 | 147 |
| 234 | 3300005535 | Ga0070684_100585545 | Ga0070684_1005855452 | 147 |
| 235 | 3300005543 | Ga0070672_101235342 | Ga0070672_1012353421 | 147 |
| 236 | 3300005564 | Ga0070664_100384321 | Ga0070664_1003843212 | 147 |
| 237 | 3300005614 | Ga0068856_100089559 | Ga0068856_1000895593 | 147 |
| 238 | 3300006358 | Ga0068871_101268472 | Ga0068871_1012684721 | 147 |
| 239 | 3300013102 | Ga0157371_10015505 | Ga0157371_100155052 | 147 |
| 240 | 3300013102 | Ga0157371_10077083 | Ga0157371_100770832 | 147 |
| 241 | 3300013307 | Ga0157372_10647996 | Ga0157372_106479962 | 147 |
| 242 | 3300013307 | Ga0157372_10785644 | Ga0157372_107856442 | 147 |
| 243 | 3300014326 | Ga0157380_10367811 | Ga0157380_103678112 | 147 |
| 244 | 3300014968 | Ga0157379_11231856 | Ga0157379_112318561 | 147 |
| 245 | 3300025208 | Ga0209436_101283 | Ga0209436_1012837 | 147 |
| 246 | 3300025302 | Ga0207426_1011778 | Ga0207426_10117782 | 147 |
| 247 | 3300025904 | Ga0207647_10006111 | Ga0207647_100061114 | 147 |
| 248 | 3300025913 | Ga0207695_10002928 | Ga0207695_100029286 | 147 |
| 249 | 3300025913 | Ga0207695_10855230 | Ga0207695_108552302 | 147 |
| 250 | 3300025925 | Ga0207650_10217351 | Ga0207650_102173512 | 147 |
| 251 | 3300025944 | Ga0207661_10115544 | Ga0207661_101155443 | 147 |
| 252 | 3300026078 | Ga0207702_10045993 | Ga0207702_100459932 | 147 |
| 253 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_537871_538347 | 147 |
| 254 | 3300037471 | Ga0395905_0063365 | Ga0395905_0063365_1987_2463 | 147 |
| 255 | 3300041463 | Ga0451804_0476071 | Ga0451804_0476071_224_703 | 147 |
| 256 | 3300013306 | Ga0163162_12795412 | Ga0163162_127954121 | 148 |
| 257 | 3300013308 | Ga0157375_10490844 | Ga0157375_104908442 | 148 |
| 258 | 3300014325 | Ga0163163_10172367 | Ga0163163_101723674 | 148 |
| 259 | 3300014968 | Ga0157379_10108590 | Ga0157379_101085902 | 148 |
| 260 | 3300014969 | Ga0157376_10001065 | Ga0157376_1000106517 | 148 |
| 261 | 3300036401 | Ga0373937_0315496 | Ga0373937_0315496_46_540 | 148 |
| 262 | 3300049770 | Ga0501273_094003 | Ga0501273_094003_21_497 | 148 |
| 263 | 2162886007 | SwRhRL2b_contig_2879104 | SwRhRL2b_0102.00000280 | 149 |
| 264 | 3300005289 | Ga0065704_10070133 | Ga0065704_10070133490 | 149 |
| 265 | 3300031251 | Ga0265327_10000614 | Ga0265327_1000061416 | 149 |
| 266 | 3300049568 | Ga0501031_0074231 | Ga0501031_0074231_12_500 | 149 |
| 267 | 3300049570 | Ga0501033_0000034 | Ga0501033_0000034_121431_121919 | 149 |
| 268 | 3300049571 | Ga0501034_0008038 | Ga0501034_0008038_1556_2044 | 149 |
| 269 | 3300049572 | Ga0501036_0232303 | Ga0501036_0232303_12_500 | 149 |
| 270 | 3300049573 | Ga0501037_0003401 | Ga0501037_0003401_1283_1771 | 149 |
| 271 | 3300049574 | Ga0501038_0024914 | Ga0501038_0024914_1543_2031 | 149 |
| 272 | 3300049575 | Ga0501039_0213700 | Ga0501039_0213700_602_1090 | 149 |
| 273 | 3300049579 | Ga0501043_0000923 | Ga0501043_0000923_12259_12747 | 149 |
| 274 | 3300049581 | Ga0501047_0108840 | Ga0501047_0108840_487_975 | 149 |
| 275 | 3300049822 | Ga0501035_0002384 | Ga0501035_0002384_8072_8560 | 149 |
| 276 | 3300049823 | Ga0501044_0012839 | Ga0501044_0012839_7464_7952 | 149 |
| 277 | 3300049824 | Ga0501045_0000118 | Ga0501045_0000118_15546_16034 | 149 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7vq2-assembly1.cif.gz_A | structure of apo-hstrpm2 channel tm domain | 0.2174 | 6 | 124 |
| 7vq2-assembly1.cif.gz_A | structure of apo-hstrpm2 channel tm domain | 0.1866 | 6 | 124 |
| 6puo-assembly1.cif.gz_A | human trpm2 in the apo state | 0.1683 | 4 | 148 |
| 6puo-assembly1.cif.gz_A | human trpm2 in the apo state | 0.1647 | 4 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q18544_272_478_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5214 | 6 | 91 | 1.20.1250.20 |
| af_Q23514_267_463_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4038 | 5 | 142 | 1.20.1250.20 |
| af_Q23514_267_463_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3814 | 5 | 142 | 1.20.1250.20 |
| af_Q9M8M1_345_541_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3758 | 8 | 142 | 1.20.1250.20 |
| af_Q8K0H7_13_222_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3701 | 5 | 132 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M5DSU9-F1-model_v4 | Beta-carotene 3-hydroxylase | 0.8642 | 4 | 148 |
GO:0010291
GO:0016020 GO:0016119 GO:0016123 |
| AF-A0A2T6AEJ7-F1-model_v4 | Beta-carotene 3-hydroxylase | 0.8624 | 1 | 140 |
GO:0005506
GO:0010291 GO:0016020 GO:0016119 GO:0016123 |
| AF-A0A162R2G4-F1-model_v4 | Beta-carotene hydroxylase | 0.8575 | 1 | 148 |
GO:0010291
GO:0016020 GO:0016119 GO:0016123 |
| AF-A0A3P3WFV4-F1-model_v4 | Beta-carotene hydroxylase | 0.8565 | 5 | 148 |
GO:0010291
GO:0016020 GO:0016119 GO:0016123 |
| AF-A0A1M3GGT2-F1-model_v4 | deleted | 0.8545 | 1 | 147 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar