F381637

General Info

Members Datasets Scaffolds Average Seq Length
277 142 554 159

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10599272|Ga0070681_105992722
Length 195
Sequence MNGRAHYALATEWLIAAPVDRVFDALAQPQRWPQWWRYVKSVESIAAGDANGIGAVWRYTWSSRLPYRLAFDMTTTAAQRPERIEGIASGELTGVGRWRLSELPSAPRAPGLIRAREGPQRSWHEDDVTRVRYDWIVTTTKRWMKLLSPLLAPLFAWNHDQVMAAGARGLASHLGVPLLAYHRLRHDEDRACTTC

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
114 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
117 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
123 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
124 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
125 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
126 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
127 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
128 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
129 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
130 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
131 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
132 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
133 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
134 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
135 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
136 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.08
Rhizosphere 98.19
Stem 0
Stem Tuber 0
Unclassified 34.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10599272 3300005458 Bacteria 1016
2 JGI24751J29686_10000286 3300002459 Bacteria 19499
3 JGI25406J46586_10006591 3300003203 Bacteria 5336
4 JGI25406J46586_10061929 3300003203 Bacteria 1204
5 rootL2_10107859 3300003322 Bacteria 1254
6 rootL2_10145572 3300003322 Bacteria 7731
7 Ga0065714_10064430 3300005288 Bacteria 140636
8 Ga0065712_10001319 3300005290 Bacteria 6424
9 Ga0065712_10008206 3300005290 Unclassified 4929
10 Ga0065712_10067738 3300005290 Bacteria 92500
11 Ga0065712_10438388 3300005290 Bacteria 680
12 Ga0065715_10005134 3300005293 Bacteria 3588
13 Ga0065715_10089691 3300005293 Bacteria 8889
14 Ga0065715_10108089 3300005293 Bacteria 2737
15 Ga0065715_10186749 3300005293 Unclassified 1440
16 Ga0065715_10237262 3300005293 Bacteria 1212
17 Ga0065715_10405426 3300005293 Unclassified 876
18 Ga0065715_10750639 3300005293 Unclassified 630
19 Ga0065715_10795206 3300005293 Unclassified 612
20 Ga0065707_10182033 3300005295 Bacteria 1395
21 Ga0070690_100069156 3300005330 Unclassified 2291
22 Ga0070670_100005804 3300005331 Bacteria 10434
23 Ga0070670_100189253 3300005331 Unclassified 1787
24 Ga0070670_100792295 3300005331 Bacteria 856
25 Ga0070670_101616468 3300005331 Bacteria 596
26 Ga0068869_100409814 3300005334 Bacteria 1116
27 Ga0068869_101026581 3300005334 Unclassified 719
28 Ga0070689_100498597 3300005340 Bacteria 1043
29 Ga0070687_100373739 3300005343 Bacteria 927
30 Ga0070692_10025799 3300005345 Unclassified 2900
31 Ga0070692_10148190 3300005345 Unclassified 1334
32 Ga0070692_10177641 3300005345 Unclassified 1232
33 Ga0070692_10360503 3300005345 Bacteria 906
34 Ga0070669_100387273 3300005353 Unclassified 1141
35 Ga0070675_100519492 3300005354 Unclassified 1074
36 Ga0070673_100585165 3300005364 Unclassified 1017
37 Ga0070673_101858307 3300005364 Bacteria 571
38 Ga0070703_10177762 3300005406 Bacteria 820
39 Ga0070701_10165990 3300005438 Unclassified 1282
40 Ga0070705_100041998 3300005440 Bacteria 2611
41 Ga0070705_100129380 3300005440 Bacteria 1644
42 Ga0070700_100028751 3300005441 Bacteria 3310
43 Ga0070700_101405746 3300005441 Unclassified 590
44 Ga0070694_100031235 3300005444 Bacteria 3491
45 Ga0070694_100261308 3300005444 Bacteria 1313
46 Ga0070694_100277369 3300005444 Bacteria 1277
47 Ga0070681_10000739 3300005458 Bacteria 27068
48 Ga0070685_10132673 3300005466 Bacteria 1559
49 Ga0070706_100000030 3300005467 Bacteria 153754
50 Ga0070698_100232717 3300005471 Unclassified 1776
51 Ga0070679_100511878 3300005530 Bacteria 1144
52 Ga0070679_100884527 3300005530 Bacteria 837
53 Ga0070672_100254087 3300005543 Bacteria 1481
54 Ga0070695_100087853 3300005545 Bacteria 2069
55 Ga0070695_100100556 3300005545 Bacteria 1946
56 Ga0070695_100177833 3300005545 Bacteria 1505
57 Ga0070695_100579971 3300005545 Bacteria 878
58 Ga0070695_101233667 3300005545 Unclassified 616
59 Ga0070696_101541137 3300005546 Bacteria 570
60 Ga0070693_100006434 3300005547 Bacteria 5695
61 Ga0070693_100055145 3300005547 Bacteria 2289
62 Ga0070693_100172108 3300005547 Bacteria 1388
63 Ga0070693_100228101 3300005547 Unclassified 1224
64 Ga0070693_100261859 3300005547 Unclassified 1150
65 Ga0070693_100268835 3300005547 Unclassified 1137
66 Ga0070664_100321064 3300005564 Bacteria 1403
67 Ga0070664_101187176 3300005564 Unclassified 720
68 Ga0068857_100055453 3300005577 Bacteria 3518
69 Ga0068857_100699218 3300005577 Unclassified 963
70 Ga0068857_100789949 3300005577 Bacteria 906
71 Ga0068854_100029078 3300005578 Bacteria 3823
72 Ga0068854_100533525 3300005578 Unclassified 993
73 Ga0068854_101132861 3300005578 Unclassified 698
74 Ga0070702_100040398 3300005615 Bacteria 2610
75 Ga0070702_100071868 3300005615 Unclassified 2046
76 Ga0068859_100042831 3300005617 Unclassified 4548
77 Ga0068859_100202745 3300005617 Unclassified 2069
78 Ga0068859_100211104 3300005617 Unclassified 2028
79 Ga0068859_100241267 3300005617 Bacteria 1896
80 Ga0068859_100360087 3300005617 Bacteria 1550
81 Ga0068859_100373092 3300005617 Bacteria 1522
82 Ga0068859_100503599 3300005617 Unclassified 1306
83 Ga0068859_100963867 3300005617 Bacteria 936
84 Ga0068864_100041204 3300005618 Unclassified 3950
85 Ga0068864_100043282 3300005618 Bacteria 3855
86 Ga0068864_100111259 3300005618 Unclassified 2440
87 Ga0068864_100664474 3300005618 Bacteria 1016
88 Ga0068861_100147911 3300005719 Unclassified 1924
89 Ga0068861_101008505 3300005719 Bacteria 795
90 Ga0068863_100357593 3300005841 Unclassified 1423
91 Ga0068863_100394093 3300005841 Bacteria 1353
92 Ga0068863_100432459 3300005841 Bacteria 1290
93 Ga0068863_100735814 3300005841 Unclassified 981
94 Ga0068863_101034244 3300005841 Bacteria 825
95 Ga0068858_100227742 3300005842 Bacteria 1767
96 Ga0068858_100291511 3300005842 Bacteria 1555
97 Ga0068858_100382290 3300005842 Bacteria 1351
98 Ga0068858_100542089 3300005842 Bacteria 1126
99 Ga0068860_100098672 3300005843 Bacteria 2785
100 Ga0068860_100111949 3300005843 Bacteria 2610
101 Ga0068860_100723390 3300005843 Bacteria 1006
102 Ga0068860_101977424 3300005843 Unclassified 605
103 Ga0068862_100296199 3300005844 Unclassified 1487
104 Ga0068862_100358444 3300005844 Unclassified 1355
105 Ga0081539_10000701 3300005985 Bacteria 67220
106 Ga0081539_10001129 3300005985 Bacteria 48420
107 Ga0097621_100194840 3300006237 Bacteria 1756
108 Ga0068871_100027422 3300006358 Unclassified 4454
109 Ga0075430_100002457 3300006846 Bacteria 15424
110 Ga0075430_100535876 3300006846 Unclassified 966
111 Ga0075431_100080351 3300006847 Unclassified 3366
112 Ga0075433_10086656 3300006852 Bacteria 2765
113 Ga0075433_10086915 3300006852 Unclassified 2761
114 Ga0075433_10154530 3300006852 Unclassified 2041
115 Ga0075433_10389785 3300006852 Bacteria 1229
116 Ga0075433_10454812 3300006852 Bacteria 1128
117 Ga0075433_10599384 3300006852 Unclassified 967
118 Ga0075434_100185396 3300006871 Unclassified 2101
119 Ga0075434_100625852 3300006871 Unclassified 1095
120 Ga0075434_101008438 3300006871 Unclassified 846
121 Ga0075429_100098896 3300006880 Unclassified 2546
122 Ga0097620_100042833 3300006931 Unclassified 4548
123 Ga0097620_100202750 3300006931 Unclassified 2069
124 Ga0097620_100211102 3300006931 Unclassified 2028
125 Ga0097620_100241259 3300006931 Bacteria 1896
126 Ga0097620_100360072 3300006931 Bacteria 1550
127 Ga0097620_100373109 3300006931 Bacteria 1522
128 Ga0097620_100503545 3300006931 Unclassified 1306
129 Ga0097620_100964089 3300006931 Bacteria 936
130 Ga0075435_100023109 3300007076 Bacteria 4802
131 Ga0105240_10769834 3300009093 Bacteria 1045
132 Ga0111539_10043759 3300009094 Bacteria 5367
133 Ga0111539_10619781 3300009094 Unclassified 1260
134 Ga0105247_10000291 3300009101 Bacteria 45576
135 Ga0105247_10244488 3300009101 Bacteria 1224
136 Ga0105247_10651280 3300009101 Bacteria 787
137 Ga0105247_10871749 3300009101 Unclassified 693
138 Ga0114129_10015005 3300009147 Bacteria 11031
139 Ga0114129_10462990 3300009147 Bacteria 1661
140 Ga0105243_10364202 3300009148 Bacteria 1332
141 Ga0105241_10260016 3300009174 Bacteria 1475
142 Ga0105241_10517927 3300009174 Unclassified 1066
143 Ga0105241_10529871 3300009174 Unclassified 1054
144 Ga0105241_11055083 3300009174 Bacteria 763
145 Ga0105241_11869907 3300009174 Bacteria 588
146 Ga0105248_10171657 3300009177 Bacteria 2444
147 Ga0105248_10225044 3300009177 Unclassified 2112
148 Ga0105248_10424858 3300009177 Bacteria 1497
149 Ga0105248_10781189 3300009177 Bacteria 1078
150 Ga0105248_12996013 3300009177 Unclassified 538
151 Ga0105237_10026841 3300009545 Bacteria 5885
152 Ga0105237_10162405 3300009545 Unclassified 2233
153 Ga0105237_11514167 3300009545 Unclassified 677
154 Ga0105238_10343545 3300009551 Bacteria 1481
155 Ga0105238_10483575 3300009551 Bacteria 1238
156 Ga0105238_11684035 3300009551 Bacteria 665
157 Ga0105249_10408414 3300009553 Bacteria 1389
158 Ga0105239_11341071 3300010375 Bacteria 825
159 Ga0105246_10006992 3300011119 Bacteria 6902
160 Ga0105246_10024794 3300011119 Bacteria 3902
161 Ga0105246_11244989 3300011119 Unclassified 687
162 Ga0157373_10033433 3300013100 Bacteria 3699
163 Ga0157371_10483032 3300013102 Unclassified 913
164 Ga0157370_10017855 3300013104 Bacteria 7150
165 Ga0157374_10577556 3300013296 Bacteria 1133
166 Ga0157378_11363822 3300013297 Unclassified 751
167 Ga0163162_10122682 3300013306 Bacteria 2703
168 Ga0163162_10195896 3300013306 Bacteria 2149
169 Ga0163162_11962980 3300013306 Unclassified 670
170 Ga0157372_10147363 3300013307 Bacteria 2714
171 Ga0157372_10921211 3300013307 Bacteria 1013
172 Ga0157375_10460383 3300013308 Unclassified 1437
173 Ga0157375_12655595 3300013308 Bacteria 599
174 Ga0163163_10000277 3300014325 Bacteria 51205
175 Ga0163163_10016982 3300014325 Bacteria 6777
176 Ga0163163_10642147 3300014325 Bacteria 1125
177 Ga0163163_10985671 3300014325 Bacteria 906
178 Ga0163163_11762713 3300014325 Unclassified 680
179 Ga0163163_12235591 3300014325 Unclassified 606
180 Ga0157380_10670036 3300014326 Unclassified 1038
181 Ga0157377_10045469 3300014745 Bacteria 2453
182 Ga0157379_10003296 3300014968 Bacteria 13660
183 Ga0157379_10447665 3300014968 Bacteria 1192
184 Ga0163161_10267761 3300017792 Bacteria 1336
185 Ga0207710_10000983 3300025900 Bacteria 14983
186 Ga0207710_10043034 3300025900 Bacteria 2007
187 Ga0207699_10523022 3300025906 Bacteria 858
188 Ga0207684_10000089 3300025910 Bacteria 172593
189 Ga0207654_10089159 3300025911 Unclassified 1876
190 Ga0207654_10935771 3300025911 Bacteria 629
191 Ga0207707_10033384 3300025912 Bacteria 4504
192 Ga0207707_10335592 3300025912 Bacteria 1304
193 Ga0207695_11042832 3300025913 Bacteria 697
194 Ga0207671_10367929 3300025914 Unclassified 1141
195 Ga0207662_10276496 3300025918 Bacteria 1110
196 Ga0207681_10378193 3300025923 Unclassified 1139
197 Ga0207694_10765005 3300025924 Unclassified 815
198 Ga0207650_10000027 3300025925 Bacteria 257466
199 Ga0207691_10182095 3300025940 Unclassified 1835
200 Ga0207711_10036735 3300025941 Bacteria 4158
201 Ga0207711_10247027 3300025941 Bacteria 1637
202 Ga0207711_10297897 3300025941 Bacteria 1487
203 Ga0207689_10395645 3300025942 Bacteria 1151
204 Ga0207679_11205169 3300025945 Bacteria 695
205 Ga0207712_10383845 3300025961 Bacteria 1176
206 Ga0207640_10060202 3300025981 Bacteria 2509
207 Ga0207703_10042748 3300026035 Bacteria 3636
208 Ga0207703_10290355 3300026035 Bacteria 1488
209 Ga0207703_11801690 3300026035 Unclassified 588
210 Ga0207678_10488339 3300026067 Unclassified 1073
211 Ga0207708_10012226 3300026075 Bacteria 6402
212 Ga0207641_10038202 3300026088 Bacteria 4013
213 Ga0207641_10148322 3300026088 Unclassified 2123
214 Ga0207641_10459319 3300026088 Bacteria 1232
215 Ga0207641_10979023 3300026088 Bacteria 842
216 Ga0207641_11329765 3300026088 Unclassified 719
217 Ga0207676_10104606 3300026095 Bacteria 2355
218 Ga0207676_10187618 3300026095 Unclassified 1816
219 Ga0207674_10065045 3300026116 Bacteria 3677
220 Ga0207674_10278212 3300026116 Bacteria 1621
221 Ga0207675_100011138 3300026118 Bacteria 8421
222 Ga0207675_100395739 3300026118 Bacteria 1361
223 Ga0207675_100772720 3300026118 Bacteria 973
224 Ga0207698_10118883 3300026142 Bacteria 2233
225 Ga0207428_10459604 3300027907 Bacteria 927
226 Ga0268265_10159090 3300028380 Bacteria 1916
227 Ga0268265_10387966 3300028380 Unclassified 1287
228 Ga0268265_10727716 3300028380 Unclassified 961
229 Ga0268264_10048581 3300028381 Bacteria 3530
230 Ga0268264_10093312 3300028381 Unclassified 2600
231 Ga0307414_10082463 3300032004 Bacteria 2358
232 Ga0307411_10622438 3300032005 Bacteria 931
233 Ga0373951_0003552 3300035091 Bacteria 3766
234 Ga0373931_0264422 3300035691 Unclassified 1051
235 Ga0395900_0730589 3300037418 Unclassified 922
236 Ga0395898_0876955 3300037466 Bacteria 836
237 Ga0395905_0037506 3300037471 Bacteria 4550
238 Ga0395905_0563401 3300037471 Unclassified 1041
239 Ga0395901_0125825 3300038443 Unclassified 2694
240 Ga0395901_0190695 3300038443 Unclassified 2150
241 Ga0242420_006855 3300038996 Bacteria 1814
242 Ga0436360_0030054 3300039438 Bacteria 1041
243 Ga0439448_0014611 3300042005 Bacteria 2371
244 Ga0439455_0030229 3300042012 Bacteria 1343
245 Ga0439458_0013185 3300042157 Bacteria 1860
246 Ga0495643_0126925 3300046522 Unclassified 1284
247 Ga0496100_0730623 3300048903 Bacteria 774
248 Ga0496107_0081883 3300048910 Bacteria 2354
249 Ga0496112_0420777 3300048915 Bacteria 1275
250 Ga0501296_007378 3300049519 Bacteria 1260
251 Ga0501297_008636 3300049520 Bacteria 1127
252 Ga0501298_003603 3300049521 Bacteria 2408
253 Ga0501209_000812 3300049656 Bacteria 4029
254 Ga0501216_008417 3300049660 Bacteria 1623
255 Ga0501217_010596 3300049661 Bacteria 2022
256 Ga0501227_003155 3300049665 Bacteria 3583
257 Ga0501233_011770 3300049668 Bacteria 1746
258 Ga0501239_002276 3300049672 Unclassified 1729
259 Ga0501252_069199 3300049682 Bacteria 566
260 Ga0501257_015914 3300049686 Unclassified 1740
261 Ga0501261_060811 3300049690 Bacteria 641
262 Ga0501225_0082256 3300049705 Bacteria 925
263 Ga0501245_001236 3300049708 Bacteria 3293
264 Ga0501245_046684 3300049708 Unclassified 758
265 Ga0501204_013853 3300049850 Bacteria 984
266 nmdc:mga05p37_257336_c1 3300050507 Bacteria 2091
267 nmdc:mga05p37_57670_c1 3300050507 Unclassified 3424
268 nmdc:mga05p37_617546_c1 3300050507 Unclassified 1220
269 nmdc:mga06r32_124670_c1 3300050510 Bacteria 2543
270 nmdc:mga08y16_98895_c1 3300050511 Bacteria 3038
271 nmdc:mga0n895_1411615_c1 3300050512 Unclassified 664
272 nmdc:mga0rr50_210950_c1 3300050513 Bacteria 1600
273 nmdc:mga0a205_100252_c1 3300050515 Unclassified 2795
274 nmdc:mga0a205_445871_c1 3300050515 Bacteria 1155
275 nmdc:mga0a205_46524_c1 3300050515 Unclassified 4185
276 nmdc:mga0a205_74429_c1 3300050515 Bacteria 3282
277 nmdc:mga0a205_776326_c1 3300050515 Unclassified 806
278 Ga0070681_10599272
279 JGI24751J29686_10000286
280 JGI25406J46586_10006591
281 JGI25406J46586_10061929
282 rootL2_10107859
283 rootL2_10145572
284 Ga0065714_10064430
285 Ga0065712_10001319
286 Ga0065712_10008206
287 Ga0065712_10067738
288 Ga0065712_10438388
289 Ga0065715_10005134
290 Ga0065715_10089691
291 Ga0065715_10108089
292 Ga0065715_10186749
293 Ga0065715_10237262
294 Ga0065715_10405426
295 Ga0065715_10750639
296 Ga0065715_10795206
297 Ga0065707_10182033
298 Ga0070690_100069156
299 Ga0070670_100005804
300 Ga0070670_100189253
301 Ga0070670_100792295
302 Ga0070670_101616468
303 Ga0068869_100409814
304 Ga0068869_101026581
305 Ga0070689_100498597
306 Ga0070687_100373739
307 Ga0070692_10025799
308 Ga0070692_10148190
309 Ga0070692_10177641
310 Ga0070692_10360503
311 Ga0070669_100387273
312 Ga0070675_100519492
313 Ga0070673_100585165
314 Ga0070673_101858307
315 Ga0070703_10177762
316 Ga0070701_10165990
317 Ga0070705_100041998
318 Ga0070705_100129380
319 Ga0070700_100028751
320 Ga0070700_101405746
321 Ga0070694_100031235
322 Ga0070694_100261308
323 Ga0070694_100277369
324 Ga0070681_10000739
325 Ga0070685_10132673
326 Ga0070706_100000030
327 Ga0070698_100232717
328 Ga0070679_100511878
329 Ga0070679_100884527
330 Ga0070672_100254087
331 Ga0070695_100087853
332 Ga0070695_100100556
333 Ga0070695_100177833
334 Ga0070695_100579971
335 Ga0070695_101233667
336 Ga0070696_101541137
337 Ga0070693_100006434
338 Ga0070693_100055145
339 Ga0070693_100172108
340 Ga0070693_100228101
341 Ga0070693_100261859
342 Ga0070693_100268835
343 Ga0070664_100321064
344 Ga0070664_101187176
345 Ga0068857_100055453
346 Ga0068857_100699218
347 Ga0068857_100789949
348 Ga0068854_100029078
349 Ga0068854_100533525
350 Ga0068854_101132861
351 Ga0070702_100040398
352 Ga0070702_100071868
353 Ga0068859_100042831
354 Ga0068859_100202745
355 Ga0068859_100211104
356 Ga0068859_100241267
357 Ga0068859_100360087
358 Ga0068859_100373092
359 Ga0068859_100503599
360 Ga0068859_100963867
361 Ga0068864_100041204
362 Ga0068864_100043282
363 Ga0068864_100111259
364 Ga0068864_100664474
365 Ga0068861_100147911
366 Ga0068861_101008505
367 Ga0068863_100357593
368 Ga0068863_100394093
369 Ga0068863_100432459
370 Ga0068863_100735814
371 Ga0068863_101034244
372 Ga0068858_100227742
373 Ga0068858_100291511
374 Ga0068858_100382290
375 Ga0068858_100542089
376 Ga0068860_100098672
377 Ga0068860_100111949
378 Ga0068860_100723390
379 Ga0068860_101977424
380 Ga0068862_100296199
381 Ga0068862_100358444
382 Ga0081539_10000701
383 Ga0081539_10001129
384 Ga0097621_100194840
385 Ga0068871_100027422
386 Ga0075430_100002457
387 Ga0075430_100535876
388 Ga0075431_100080351
389 Ga0075433_10086656
390 Ga0075433_10086915
391 Ga0075433_10154530
392 Ga0075433_10389785
393 Ga0075433_10454812
394 Ga0075433_10599384
395 Ga0075434_100185396
396 Ga0075434_100625852
397 Ga0075434_101008438
398 Ga0075429_100098896
399 Ga0097620_100042833
400 Ga0097620_100202750
401 Ga0097620_100211102
402 Ga0097620_100241259
403 Ga0097620_100360072
404 Ga0097620_100373109
405 Ga0097620_100503545
406 Ga0097620_100964089
407 Ga0075435_100023109
408 Ga0105240_10769834
409 Ga0111539_10043759
410 Ga0111539_10619781
411 Ga0105247_10000291
412 Ga0105247_10244488
413 Ga0105247_10651280
414 Ga0105247_10871749
415 Ga0114129_10015005
416 Ga0114129_10462990
417 Ga0105243_10364202
418 Ga0105241_10260016
419 Ga0105241_10517927
420 Ga0105241_10529871
421 Ga0105241_11055083
422 Ga0105241_11869907
423 Ga0105248_10171657
424 Ga0105248_10225044
425 Ga0105248_10424858
426 Ga0105248_10781189
427 Ga0105248_12996013
428 Ga0105237_10026841
429 Ga0105237_10162405
430 Ga0105237_11514167
431 Ga0105238_10343545
432 Ga0105238_10483575
433 Ga0105238_11684035
434 Ga0105249_10408414
435 Ga0105239_11341071
436 Ga0105246_10006992
437 Ga0105246_10024794
438 Ga0105246_11244989
439 Ga0157373_10033433
440 Ga0157371_10483032
441 Ga0157370_10017855
442 Ga0157374_10577556
443 Ga0157378_11363822
444 Ga0163162_10122682
445 Ga0163162_10195896
446 Ga0163162_11962980
447 Ga0157372_10147363
448 Ga0157372_10921211
449 Ga0157375_10460383
450 Ga0157375_12655595
451 Ga0163163_10000277
452 Ga0163163_10016982
453 Ga0163163_10642147
454 Ga0163163_10985671
455 Ga0163163_11762713
456 Ga0163163_12235591
457 Ga0157380_10670036
458 Ga0157377_10045469
459 Ga0157379_10003296
460 Ga0157379_10447665
461 Ga0163161_10267761
462 Ga0207710_10000983
463 Ga0207710_10043034
464 Ga0207699_10523022
465 Ga0207684_10000089
466 Ga0207654_10089159
467 Ga0207654_10935771
468 Ga0207707_10033384
469 Ga0207707_10335592
470 Ga0207695_11042832
471 Ga0207671_10367929
472 Ga0207662_10276496
473 Ga0207681_10378193
474 Ga0207694_10765005
475 Ga0207650_10000027
476 Ga0207691_10182095
477 Ga0207711_10036735
478 Ga0207711_10247027
479 Ga0207711_10297897
480 Ga0207689_10395645
481 Ga0207679_11205169
482 Ga0207712_10383845
483 Ga0207640_10060202
484 Ga0207703_10042748
485 Ga0207703_10290355
486 Ga0207703_11801690
487 Ga0207678_10488339
488 Ga0207708_10012226
489 Ga0207641_10038202
490 Ga0207641_10148322
491 Ga0207641_10459319
492 Ga0207641_10979023
493 Ga0207641_11329765
494 Ga0207676_10104606
495 Ga0207676_10187618
496 Ga0207674_10065045
497 Ga0207674_10278212
498 Ga0207675_100011138
499 Ga0207675_100395739
500 Ga0207675_100772720
501 Ga0207698_10118883
502 Ga0207428_10459604
503 Ga0268265_10159090
504 Ga0268265_10387966
505 Ga0268265_10727716
506 Ga0268264_10048581
507 Ga0268264_10093312
508 Ga0307414_10082463
509 Ga0307411_10622438
510 Ga0373951_0003552
511 Ga0373931_0264422
512 Ga0395900_0730589
513 Ga0395898_0876955
514 Ga0395905_0037506
515 Ga0395905_0563401
516 Ga0395901_0125825
517 Ga0395901_0190695
518 Ga0242420_006855
519 Ga0436360_0030054
520 Ga0439448_0014611
521 Ga0439455_0030229
522 Ga0439458_0013185
523 Ga0495643_0126925
524 Ga0496100_0730623
525 Ga0496107_0081883
526 Ga0496112_0420777
527 Ga0501296_007378
528 Ga0501297_008636
529 Ga0501298_003603
530 Ga0501209_000812
531 Ga0501216_008417
532 Ga0501217_010596
533 Ga0501227_003155
534 Ga0501233_011770
535 Ga0501239_002276
536 Ga0501252_069199
537 Ga0501257_015914
538 Ga0501261_060811
539 Ga0501225_0082256
540 Ga0501245_001236
541 Ga0501245_046684
542 Ga0501204_013853
543 nmdc:mga05p37_257336_c1
544 nmdc:mga05p37_57670_c1
545 nmdc:mga05p37_617546_c1
546 nmdc:mga06r32_124670_c1
547 nmdc:mga08y16_98895_c1
548 nmdc:mga0n895_1411615_c1
549 nmdc:mga0rr50_210950_c1
550 nmdc:mga0a205_100252_c1
551 nmdc:mga0a205_445871_c1
552 nmdc:mga0a205_46524_c1
553 nmdc:mga0a205_74429_c1
554 nmdc:mga0a205_776326_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

15

165

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z8o-assembly1.cif.gz_A structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis 0.8014 23 170
4n0g-assembly1.cif.gz_C crystal structure of pyl13-pp2ca complex 0.7941 24 169
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.7865 24 162
4z3l-assembly4.cif.gz_E crystal structure of birch pollen allergen bet v 1 mutant g26l, d69i, p90l, k97i 0.769 24 139
4n0g-assembly2.cif.gz_D crystal structure of pyl13-pp2ca complex 0.7634 24 169
ID Description Score Start End Superfamily
af_I6X9Y7_1_146_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8444 24 170 3.30.530.20
af_L7N657_19_160_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.812 24 170 3.30.530.20
af_Q9M073_3_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.805 25 139 3.30.530.20
af_I6X9Y7_1_146_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.803 24 170 3.30.530.20
af_Q39132_1_151_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7961 23 139 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A847DYN0-F1-model_v4 Polyketide cyclase 0.9974 36 113
AF-A0A119XDM5-F1-model_v4 Polyketide cyclase 0.9967 23 178
AF-A0A7V6Y7W6-F1-model_v4 deleted 0.9956 25 172
AF-A0A542BT27-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9942 23 178 GO:0005840
GO:0016747
AF-A0A7H0FHV5-F1-model_v4 deleted 0.9916 23 178

Map