F381447

General Info

Members Datasets Scaffolds Average Seq Length
276 197 552 237

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0009345|Ga0500622_0009345_1842_2654
Length 270
Sequence MIIITFPNAIHHAVQPSNLILSLKHSISIMPEVKSEIKFLQGPQSRWEEFKFTVKVLFEFVKGFRALHFVGPCVTFFGSARFKESDEYYALTRKAAGEIAKLGFTIMTGGGSGLMEAANRGAKDVGGRSVGCNIVLPREQTPNIYLDKFVNIRYFFVRKTLLIKYSFAFIVVPGGFGTLDEFFEALTLTQTKKILQFPIILLGKAYHKELLEHIDLMQRKHTISPQDLNLILVTDSIEEAVQFIKDQSIARYGLVSGTKRTPLKWLFERK

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
134 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
135 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
151 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
152 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
193 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
194 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
195 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
196 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
197 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 0
Isolates 2.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 2.54
Rhizosphere 87.32
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0009345 3300053156 Bacteria 5428
2 rootH1_10003227 3300003316 Bacteria 26383
3 rootH1_10012329 3300003316 Bacteria 44821
4 rootH1_10144629 3300003316 Unclassified 2336
5 rootH2_10004072 3300003320 Bacteria 38215
6 rootL2_10004391 3300003322 Bacteria 17032
7 rootL2_10004810 3300003322 Bacteria 5097
8 rootL2_10013153 3300003322 Bacteria 31542
9 rootL2_10277208 3300003322 Unclassified 2594
10 rootL2_10303949 3300003322 Bacteria 5129
11 rootL2_10352973 3300003322 Bacteria 1089
12 rootH1_10011789 3300003323 Bacteria 124621
13 rootH1_10046869 3300003323 Bacteria 16688
14 rootH1_10063720 3300003323 Bacteria 8307
15 rootH1_10122373 3300003323 Bacteria 8482
16 rootH1_10136743 3300003323 Bacteria 2367
17 rootH1_10271782 3300003323 Bacteria 1663
18 Ga0055531_10000033 3300003794 Bacteria 152935
19 Ga0065714_10096866 3300005288 Bacteria 1750
20 Ga0065715_10414520 3300005293 Bacteria 865
21 Ga0070676_10000761 3300005328 Bacteria 15847
22 Ga0070676_10259198 3300005328 Unclassified 1164
23 Ga0070683_100053447 3300005329 Bacteria 3743
24 Ga0070690_100052987 3300005330 Bacteria 2594
25 Ga0070670_100001509 3300005331 Bacteria 18750
26 Ga0070670_100085097 3300005331 Bacteria 2717
27 Ga0068869_100001124 3300005334 Bacteria 15606
28 Ga0070666_10086967 3300005335 Bacteria 2142
29 Ga0070666_10200118 3300005335 Bacteria 1405
30 Ga0070680_100000121 3300005336 Bacteria 45965
31 Ga0070682_100000248 3300005337 Bacteria 39129
32 Ga0070660_100000324 3300005339 Bacteria 31411
33 Ga0070689_100020810 3300005340 Bacteria 4874
34 Ga0070689_100322817 3300005340 Bacteria 1290
35 Ga0070691_10002283 3300005341 Bacteria 8490
36 Ga0070687_100039154 3300005343 Bacteria 2380
37 Ga0070661_100001184 3300005344 Bacteria 18418
38 Ga0070692_10002173 3300005345 Bacteria 7511
39 Ga0070675_100137163 3300005354 Bacteria 2088
40 Ga0070671_100022530 3300005355 Bacteria 5144
41 Ga0070659_100002124 3300005366 Bacteria 14123
42 Ga0070667_100045215 3300005367 Bacteria 3701
43 Ga0070667_100338544 3300005367 Bacteria 1360
44 Ga0070703_10033856 3300005406 Bacteria 1557
45 Ga0070705_100000243 3300005440 Bacteria 32441
46 Ga0070705_100149661 3300005440 Bacteria 1547
47 Ga0070700_100012733 3300005441 Bacteria 4706
48 Ga0070694_100000693 3300005444 Bacteria 18764
49 Ga0070708_100239014 3300005445 Bacteria 1705
50 Ga0070708_100739768 3300005445 Bacteria 925
51 Ga0070663_100106364 3300005455 Bacteria 2101
52 Ga0070662_100001659 3300005457 Bacteria 13691
53 Ga0070681_10006200 3300005458 Bacteria 11621
54 Ga0068867_100002765 3300005459 Bacteria 12355
55 Ga0068867_100430083 3300005459 Bacteria 1120
56 Ga0070706_100006098 3300005467 Bacteria 11397
57 Ga0070707_100009232 3300005468 Bacteria 9151
58 Ga0070707_100101263 3300005468 Bacteria 2791
59 Ga0070698_100053599 3300005471 Bacteria 4098
60 Ga0070698_100175522 3300005471 Bacteria 2082
61 Ga0070699_100001989 3300005518 Bacteria 18435
62 Ga0070699_100039658 3300005518 Bacteria 4077
63 Ga0070679_100000556 3300005530 Bacteria 31645
64 Ga0070684_100019836 3300005535 Bacteria 5570
65 Ga0070697_100030418 3300005536 Bacteria 4337
66 Ga0070697_100049153 3300005536 Bacteria 3422
67 Ga0070697_100282901 3300005536 Bacteria 1423
68 Ga0068853_100001255 3300005539 Bacteria 18126
69 Ga0068853_100093831 3300005539 Bacteria 2643
70 Ga0070672_100195910 3300005543 Bacteria 1688
71 Ga0070695_100130047 3300005545 Bacteria 1734
72 Ga0070696_100002779 3300005546 Bacteria 11621
73 Ga0070696_100289159 3300005546 Bacteria 1252
74 Ga0070693_100000252 3300005547 Bacteria 24938
75 Ga0070704_100001442 3300005549 Bacteria 12716
76 Ga0068855_100000113 3300005563 Bacteria 100669
77 Ga0070664_100002225 3300005564 Bacteria 15603
78 Ga0068857_100158145 3300005577 Bacteria 2055
79 Ga0068854_100000382 3300005578 Bacteria 28093
80 Ga0068856_100002739 3300005614 Bacteria 18046
81 Ga0068856_100009835 3300005614 Bacteria 9288
82 Ga0068856_100056293 3300005614 Bacteria 3880
83 Ga0068859_100003662 3300005617 Bacteria 15662
84 Ga0068859_100669928 3300005617 Bacteria 1129
85 Ga0068864_100008032 3300005618 Bacteria 8705
86 Ga0068864_100242923 3300005618 Unclassified 1669
87 Ga0068866_10019986 3300005718 Bacteria 3060
88 Ga0068861_100004676 3300005719 Bacteria 9196
89 Ga0068870_10000158 3300005840 Bacteria 23830
90 Ga0068863_100012945 3300005841 Bacteria 8046
91 Ga0068863_100043228 3300005841 Unclassified 4278
92 Ga0068860_100013267 3300005843 Bacteria 8086
93 Ga0068862_100003595 3300005844 Bacteria 13269
94 Ga0068862_100363082 3300005844 Bacteria 1346
95 Ga0081455_10018844 3300005937 Bacteria 6547
96 Ga0075432_10021483 3300006058 Bacteria 2207
97 Ga0070716_100023619 3300006173 Bacteria 3262
98 Ga0097621_100000465 3300006237 Bacteria 28387
99 Ga0097621_100002214 3300006237 Bacteria 13318
100 Ga0068871_100001321 3300006358 Bacteria 16577
101 Ga0075428_100201986 3300006844 Bacteria 2148
102 Ga0075431_100250643 3300006847 Bacteria 1799
103 Ga0075433_10009028 3300006852 Bacteria 7963
104 Ga0075433_10122342 3300006852 Bacteria 2311
105 Ga0075434_100019247 3300006871 Bacteria 6604
106 Ga0075434_100123229 3300006871 Bacteria 2608
107 Ga0075436_100039830 3300006914 Bacteria 3243
108 Ga0075436_100040623 3300006914 Bacteria 3209
109 Ga0097620_100003662 3300006931 Bacteria 15662
110 Ga0097620_100669759 3300006931 Bacteria 1129
111 Ga0075435_100054423 3300007076 Bacteria 3229
112 Ga0075435_100101573 3300007076 Bacteria 2383
113 Ga0111539_10072882 3300009094 Bacteria 4050
114 Ga0114129_10184549 3300009147 Bacteria 2836
115 Ga0114129_10572889 3300009147 Bacteria 1466
116 Ga0114129_10660438 3300009147 Bacteria 1348
117 Ga0105243_10478211 3300009148 Bacteria 1175
118 Ga0105241_10000922 3300009174 Bacteria 22252
119 Ga0105241_10399992 3300009174 Bacteria 1204
120 Ga0105248_10406873 3300009177 Bacteria 1532
121 Ga0157373_10000610 3300013100 Bacteria 27903
122 Ga0157371_10044575 3300013102 Bacteria 3157
123 Ga0157370_10384517 3300013104 Bacteria 1293
124 Ga0157369_10034501 3300013105 Bacteria 5552
125 Ga0157374_10805911 3300013296 Bacteria 955
126 Ga0157378_10002686 3300013297 Bacteria 15836
127 Ga0157378_10009390 3300013297 Bacteria 8523
128 Ga0163162_10000782 3300013306 Bacteria 29601
129 Ga0163162_10012947 3300013306 Bacteria 8143
130 Ga0163162_10199579 3300013306 Bacteria 2129
131 Ga0163162_10245158 3300013306 Bacteria 1923
132 Ga0157372_10012089 3300013307 Bacteria 9196
133 Ga0157375_10000911 3300013308 Bacteria 25700
134 Ga0157375_10159464 3300013308 Bacteria 2397
135 Ga0157375_10191319 3300013308 Bacteria 2201
136 Ga0157375_10197090 3300013308 Bacteria 2169
137 Ga0157375_10204422 3300013308 Bacteria 2131
138 Ga0157375_10270951 3300013308 Bacteria 1860
139 Ga0163163_10065697 3300014325 Bacteria 3602
140 Ga0163163_10877599 3300014325 Bacteria 960
141 Ga0157379_10021730 3300014968 Bacteria 5683
142 Ga0157379_10033463 3300014968 Bacteria 4583
143 Ga0157379_10052201 3300014968 Bacteria 3651
144 Ga0157376_10000958 3300014969 Bacteria 18796
145 Ga0157376_10072826 3300014969 Bacteria 2924
146 Ga0157376_10638530 3300014969 Bacteria 1064
147 Ga0182006_1000365 3300015261 Bacteria 37791
148 Ga0182007_10032019 3300015262 Bacteria 1788
149 Ga0163161_10001561 3300017792 Bacteria 16906
150 Ga0209050_1002040 3300025298 Bacteria 18646
151 Ga0209257_1000023 3300025304 Bacteria 753019
152 Ga0207642_10077388 3300025899 Bacteria 1604
153 Ga0207645_10001184 3300025907 Bacteria 21539
154 Ga0207643_10000289 3300025908 Bacteria 35030
155 Ga0207684_10005418 3300025910 Bacteria 11771
156 Ga0207684_10077679 3300025910 Bacteria 2823
157 Ga0207684_10159290 3300025910 Bacteria 1943
158 Ga0207654_10006648 3300025911 Bacteria 5818
159 Ga0207707_10000740 3300025912 Bacteria 32307
160 Ga0207660_10002444 3300025917 Bacteria 12199
161 Ga0207662_10013414 3300025918 Bacteria 4584
162 Ga0207657_10000208 3300025919 Bacteria 60691
163 Ga0207649_10001664 3300025920 Bacteria 12854
164 Ga0207652_10000463 3300025921 Bacteria 41582
165 Ga0207646_10017526 3300025922 Bacteria 6700
166 Ga0207646_10067901 3300025922 Bacteria 3183
167 Ga0207650_10007331 3300025925 Bacteria 7511
168 Ga0207659_10061928 3300025926 Bacteria 2699
169 Ga0207644_10083195 3300025931 Bacteria 2369
170 Ga0207644_10581182 3300025931 Bacteria 929
171 Ga0207690_10001254 3300025932 Bacteria 16060
172 Ga0207706_10002799 3300025933 Bacteria 16951
173 Ga0207709_10029728 3300025935 Bacteria 3172
174 Ga0207670_10010674 3300025936 Bacteria 5300
175 Ga0207665_10007100 3300025939 Bacteria 7414
176 Ga0207691_10143182 3300025940 Bacteria 2105
177 Ga0207689_10002156 3300025942 Bacteria 18513
178 Ga0207661_10143189 3300025944 Bacteria 2059
179 Ga0207679_10001910 3300025945 Bacteria 12930
180 Ga0207667_10002886 3300025949 Bacteria 21342
181 Ga0207640_10001541 3300025981 Bacteria 12430
182 Ga0207639_10000992 3300026041 Bacteria 19332
183 Ga0207639_10193202 3300026041 Unclassified 1740
184 Ga0207678_10062084 3300026067 Bacteria 3213
185 Ga0207708_10022436 3300026075 Bacteria 4766
186 Ga0207702_10002921 3300026078 Bacteria 15998
187 Ga0207702_10034626 3300026078 Unclassified 4223
188 Ga0207648_10000170 3300026089 Bacteria 67608
189 Ga0207648_10045970 3300026089 Bacteria 3828
190 Ga0207648_10072057 3300026089 Bacteria 3011
191 Ga0207676_10088466 3300026095 Bacteria 2535
192 Ga0207674_10005047 3300026116 Bacteria 15752
193 Ga0207675_100021961 3300026118 Bacteria 5942
194 Ga0207675_100468514 3300026118 Unclassified 1250
195 Ga0207698_10270238 3300026142 Bacteria 1567
196 Ga0268265_10007363 3300028380 Bacteria 7432
197 Ga0268264_10007022 3300028381 Bacteria 9445
198 Ga0268264_10256208 3300028381 Bacteria 1628
199 Ga0316177_1191568 3300030731 Bacteria 8038
200 Ga0316176_1083257 3300030732 Bacteria 14937
201 Ga0316181_1109246 3300030744 Bacteria 74541
202 Ga0265327_10000544 3300031251 Bacteria 64453
203 Ga0307513_10118803 3300031456 Bacteria 2617
204 Ga0307414_10001289 3300032004 Bacteria 12953
205 Ga0307414_10373858 3300032004 Bacteria 1230
206 Ga0373959_0036161 3300034820 Bacteria 1018
207 Ga0373929_0021198 3300035085 Bacteria 1316
208 Ga0373940_0094153 3300035088 Bacteria 901
209 Ga0373949_0016540 3300035090 Bacteria 1654
210 Ga0373952_0032636 3300035092 Bacteria 1164
211 Ga0373941_0097870 3300035115 Bacteria 1017
212 Ga0373960_0121121 3300035121 Bacteria 868
213 Ga0373961_0003146 3300035241 Bacteria 4125
214 Ga0373962_0068461 3300035242 Bacteria 1056
215 Ga0373931_0013419 3300035691 Bacteria 3989
216 Ga0451853_0678392 3300041512 Unclassified 831
217 Ga0439448_0005254 3300042005 Bacteria 3688
218 Ga0439455_0051818 3300042012 Bacteria 1073
219 Ga0450889_002125 3300042144 Bacteria 1989
220 Ga0439458_0002881 3300042157 Bacteria 4133
221 Ga0439459_0001300 3300042438 Bacteria 3646
222 Ga0451577_0003730 3300042876 Bacteria 16631
223 Ga0451577_0154053 3300042876 Bacteria 2068
224 Ga0453684_0029962 3300044712 Bacteria 7704
225 Ga0451576_0010476 3300045051 Bacteria 10629
226 Ga0451576_0017473 3300045051 Bacteria 7885
227 Ga0451576_0017977 3300045051 Bacteria 7758
228 Ga0495638_0000006 3300046460 Bacteria 668846
229 Ga0495607_0008201 3300046501 Bacteria 7155
230 Ga0496101_0028798 3300048904 Bacteria 3881
231 Ga0496102_0067043 3300048905 Bacteria 3291
232 Ga0496104_0655018 3300048907 Bacteria 959
233 Ga0496106_0144333 3300048909 Bacteria 1874
234 Ga0496107_0471931 3300048910 Bacteria 931
235 Ga0496110_0847659 3300048913 Bacteria 819
236 Ga0496112_0009982 3300048915 Bacteria 8593
237 Ga0496124_0273451 3300048927 Bacteria 1236
238 Ga0501032_0002213 3300049569 Bacteria 15303
239 Ga0501033_0000004 3300049570 Bacteria 441310
240 Ga0501034_0000216 3300049571 Bacteria 109908
241 Ga0501034_0023069 3300049571 Bacteria 6341
242 Ga0501034_0374987 3300049571 Bacteria 1348
243 Ga0501036_0006193 3300049572 Bacteria 9707
244 Ga0501037_0032983 3300049573 Bacteria 3826
245 Ga0501038_0005953 3300049574 Bacteria 11280
246 Ga0501039_0000987 3300049575 Bacteria 20686
247 Ga0501043_0010612 3300049579 Bacteria 7214
248 Ga0501067_0064787 3300049583 Bacteria 2023
249 Ga0501070_0462963 3300049586 Bacteria 1021
250 Ga0501077_0083034 3300049593 Bacteria 2030
251 Ga0501223_002718 3300049663 Bacteria 3891
252 Ga0501249_000001 3300049679 Bacteria 268580
253 Ga0501035_0002391 3300049822 Bacteria 18420
254 Ga0501044_0170434 3300049823 Bacteria 2148
255 Ga0501045_0001061 3300049824 Bacteria 18139
256 nmdc:mga05p37_103348_c1 3300050507 Bacteria 2756
257 nmdc:mga05p37_648580_c1 3300050507 Bacteria 1183
258 nmdc:mga05p37_96310_c1 3300050507 Bacteria 3646
259 nmdc:mga08y16_71399_c1 3300050511 Bacteria 3618
260 nmdc:mga0n895_13385_c1 3300050512 Bacteria 7398
261 nmdc:mga0n895_41723_c1 3300050512 Bacteria 4462
262 nmdc:mga0rr50_199743_c1 3300050513 Bacteria 1643
263 nmdc:mga0rr50_320344_c1 3300050513 Bacteria 1300
264 nmdc:mga0rr50_341847_c1 3300050513 Bacteria 1258
265 nmdc:mga08x19_367160_c1 3300050514 Bacteria 1007
266 nmdc:mga08x19_84619_c1 3300050514 Bacteria 2087
267 nmdc:mga0a205_33688_c1 3300050515 Bacteria 4912
268 nmdc:mga0a205_9688_c1 3300050515 Bacteria 8822
269 Ga0500559_0048926 3300053136 Bacteria 1861
270 Ga0500616_0000044 3300053153 Bacteria 339611
271 2644008793 2643221600 Bacteria 5530138
272 2644372558 2643221667 Bacteria 5627472
273 2903899461 2903895155 Bacteria 5258610
274 2904421307 2904419702 Bacteria 5166287
275 2929153400 2929150217 Bacteria 5462483
276 8054310207 8054307821 Bacteria 5212224
277 Ga0500622_0009345
278 rootH1_10003227
279 rootH1_10012329
280 rootH1_10144629
281 rootH2_10004072
282 rootL2_10004391
283 rootL2_10004810
284 rootL2_10013153
285 rootL2_10277208
286 rootL2_10303949
287 rootL2_10352973
288 rootH1_10011789
289 rootH1_10046869
290 rootH1_10063720
291 rootH1_10122373
292 rootH1_10136743
293 rootH1_10271782
294 Ga0055531_10000033
295 Ga0065714_10096866
296 Ga0065715_10414520
297 Ga0070676_10000761
298 Ga0070676_10259198
299 Ga0070683_100053447
300 Ga0070690_100052987
301 Ga0070670_100001509
302 Ga0070670_100085097
303 Ga0068869_100001124
304 Ga0070666_10086967
305 Ga0070666_10200118
306 Ga0070680_100000121
307 Ga0070682_100000248
308 Ga0070660_100000324
309 Ga0070689_100020810
310 Ga0070689_100322817
311 Ga0070691_10002283
312 Ga0070687_100039154
313 Ga0070661_100001184
314 Ga0070692_10002173
315 Ga0070675_100137163
316 Ga0070671_100022530
317 Ga0070659_100002124
318 Ga0070667_100045215
319 Ga0070667_100338544
320 Ga0070703_10033856
321 Ga0070705_100000243
322 Ga0070705_100149661
323 Ga0070700_100012733
324 Ga0070694_100000693
325 Ga0070708_100239014
326 Ga0070708_100739768
327 Ga0070663_100106364
328 Ga0070662_100001659
329 Ga0070681_10006200
330 Ga0068867_100002765
331 Ga0068867_100430083
332 Ga0070706_100006098
333 Ga0070707_100009232
334 Ga0070707_100101263
335 Ga0070698_100053599
336 Ga0070698_100175522
337 Ga0070699_100001989
338 Ga0070699_100039658
339 Ga0070679_100000556
340 Ga0070684_100019836
341 Ga0070697_100030418
342 Ga0070697_100049153
343 Ga0070697_100282901
344 Ga0068853_100001255
345 Ga0068853_100093831
346 Ga0070672_100195910
347 Ga0070695_100130047
348 Ga0070696_100002779
349 Ga0070696_100289159
350 Ga0070693_100000252
351 Ga0070704_100001442
352 Ga0068855_100000113
353 Ga0070664_100002225
354 Ga0068857_100158145
355 Ga0068854_100000382
356 Ga0068856_100002739
357 Ga0068856_100009835
358 Ga0068856_100056293
359 Ga0068859_100003662
360 Ga0068859_100669928
361 Ga0068864_100008032
362 Ga0068864_100242923
363 Ga0068866_10019986
364 Ga0068861_100004676
365 Ga0068870_10000158
366 Ga0068863_100012945
367 Ga0068863_100043228
368 Ga0068860_100013267
369 Ga0068862_100003595
370 Ga0068862_100363082
371 Ga0081455_10018844
372 Ga0075432_10021483
373 Ga0070716_100023619
374 Ga0097621_100000465
375 Ga0097621_100002214
376 Ga0068871_100001321
377 Ga0075428_100201986
378 Ga0075431_100250643
379 Ga0075433_10009028
380 Ga0075433_10122342
381 Ga0075434_100019247
382 Ga0075434_100123229
383 Ga0075436_100039830
384 Ga0075436_100040623
385 Ga0097620_100003662
386 Ga0097620_100669759
387 Ga0075435_100054423
388 Ga0075435_100101573
389 Ga0111539_10072882
390 Ga0114129_10184549
391 Ga0114129_10572889
392 Ga0114129_10660438
393 Ga0105243_10478211
394 Ga0105241_10000922
395 Ga0105241_10399992
396 Ga0105248_10406873
397 Ga0157373_10000610
398 Ga0157371_10044575
399 Ga0157370_10384517
400 Ga0157369_10034501
401 Ga0157374_10805911
402 Ga0157378_10002686
403 Ga0157378_10009390
404 Ga0163162_10000782
405 Ga0163162_10012947
406 Ga0163162_10199579
407 Ga0163162_10245158
408 Ga0157372_10012089
409 Ga0157375_10000911
410 Ga0157375_10159464
411 Ga0157375_10191319
412 Ga0157375_10197090
413 Ga0157375_10204422
414 Ga0157375_10270951
415 Ga0163163_10065697
416 Ga0163163_10877599
417 Ga0157379_10021730
418 Ga0157379_10033463
419 Ga0157379_10052201
420 Ga0157376_10000958
421 Ga0157376_10072826
422 Ga0157376_10638530
423 Ga0182006_1000365
424 Ga0182007_10032019
425 Ga0163161_10001561
426 Ga0209050_1002040
427 Ga0209257_1000023
428 Ga0207642_10077388
429 Ga0207645_10001184
430 Ga0207643_10000289
431 Ga0207684_10005418
432 Ga0207684_10077679
433 Ga0207684_10159290
434 Ga0207654_10006648
435 Ga0207707_10000740
436 Ga0207660_10002444
437 Ga0207662_10013414
438 Ga0207657_10000208
439 Ga0207649_10001664
440 Ga0207652_10000463
441 Ga0207646_10017526
442 Ga0207646_10067901
443 Ga0207650_10007331
444 Ga0207659_10061928
445 Ga0207644_10083195
446 Ga0207644_10581182
447 Ga0207690_10001254
448 Ga0207706_10002799
449 Ga0207709_10029728
450 Ga0207670_10010674
451 Ga0207665_10007100
452 Ga0207691_10143182
453 Ga0207689_10002156
454 Ga0207661_10143189
455 Ga0207679_10001910
456 Ga0207667_10002886
457 Ga0207640_10001541
458 Ga0207639_10000992
459 Ga0207639_10193202
460 Ga0207678_10062084
461 Ga0207708_10022436
462 Ga0207702_10002921
463 Ga0207702_10034626
464 Ga0207648_10000170
465 Ga0207648_10045970
466 Ga0207648_10072057
467 Ga0207676_10088466
468 Ga0207674_10005047
469 Ga0207675_100021961
470 Ga0207675_100468514
471 Ga0207698_10270238
472 Ga0268265_10007363
473 Ga0268264_10007022
474 Ga0268264_10256208
475 Ga0316177_1191568
476 Ga0316176_1083257
477 Ga0316181_1109246
478 Ga0265327_10000544
479 Ga0307513_10118803
480 Ga0307414_10001289
481 Ga0307414_10373858
482 Ga0373959_0036161
483 Ga0373929_0021198
484 Ga0373940_0094153
485 Ga0373949_0016540
486 Ga0373952_0032636
487 Ga0373941_0097870
488 Ga0373960_0121121
489 Ga0373961_0003146
490 Ga0373962_0068461
491 Ga0373931_0013419
492 Ga0451853_0678392
493 Ga0439448_0005254
494 Ga0439455_0051818
495 Ga0450889_002125
496 Ga0439458_0002881
497 Ga0439459_0001300
498 Ga0451577_0003730
499 Ga0451577_0154053
500 Ga0453684_0029962
501 Ga0451576_0010476
502 Ga0451576_0017473
503 Ga0451576_0017977
504 Ga0495638_0000006
505 Ga0495607_0008201
506 Ga0496101_0028798
507 Ga0496102_0067043
508 Ga0496104_0655018
509 Ga0496106_0144333
510 Ga0496107_0471931
511 Ga0496110_0847659
512 Ga0496112_0009982
513 Ga0496124_0273451
514 Ga0501032_0002213
515 Ga0501033_0000004
516 Ga0501034_0000216
517 Ga0501034_0023069
518 Ga0501034_0374987
519 Ga0501036_0006193
520 Ga0501037_0032983
521 Ga0501038_0005953
522 Ga0501039_0000987
523 Ga0501043_0010612
524 Ga0501067_0064787
525 Ga0501070_0462963
526 Ga0501077_0083034
527 Ga0501223_002718
528 Ga0501249_000001
529 Ga0501035_0002391
530 Ga0501044_0170434
531 Ga0501045_0001061
532 nmdc:mga05p37_103348_c1
533 nmdc:mga05p37_648580_c1
534 nmdc:mga05p37_96310_c1
535 nmdc:mga08y16_71399_c1
536 nmdc:mga0n895_13385_c1
537 nmdc:mga0n895_41723_c1
538 nmdc:mga0rr50_199743_c1
539 nmdc:mga0rr50_320344_c1
540 nmdc:mga0rr50_341847_c1
541 nmdc:mga08x19_367160_c1
542 nmdc:mga08x19_84619_c1
543 nmdc:mga0a205_33688_c1
544 nmdc:mga0a205_9688_c1
545 Ga0500559_0048926
546 Ga0500616_0000044
547 2644008793
548 2644372558
549 2903899461
550 2904421307
551 2929153400
552 8054310207

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

115

244

0.97

PF18306

LDcluster4

SLOG cluster4 family

72

231

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wek-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9437 18 213
5zi9-assembly1.cif.gz_B crystal structure of type-ii log from streptomyces coelicolor a3 0.9237 11 216
5wq3-assembly1.cif.gz_B-2 crystal structure of type-ii log from corynebacterium glutamicum 0.922 14 222
5zi9-assembly1.cif.gz_A crystal structure of type-ii log from streptomyces coelicolor a3 0.9193 14 216
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9183 15 215
ID Description Score Start End Superfamily
af_Q8I1V0_170_336_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9452 76 214 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.936 22 222 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.927 22 222 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9164 18 214 3.40.50.450
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9026 18 214 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A5B8YFQ9-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9755 13 228 GO:0005829
GO:0009691
GO:0016787
AF-A0A382VQN4-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase 0.9717 48 167 GO:0005829
GO:0009691
GO:0016787
AF-A0A1V1RI15-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.97 13 216 GO:0005829
GO:0009691
GO:0102682
AF-A0A256BX77-F1-model_v4 deleted 0.9698 25 214
AF-A0A7Y2KIS5-F1-model_v4 Cytokinin riboside 5'-monophosphate phosphoribohydrolase (EC 3.2.2.n1) 0.9688 30 204 GO:0005829
GO:0009691
GO:0016787

Map