F381434

General Info

Members Datasets Scaffolds Average Seq Length
276 157 552 99

Family's Representative Sequence

Representative Sequence 3300050514|nmdc:mga08x19_7641_c1|nmdc:mga08x19_7641_c1_2640_2999
Length 119
Sequence MGRCRAPLGREDRLTSEEDGMAPDSMTPAGHAAQSDTFLRRILGGMSVFSMVMTVPQVWTVWASHQAGGVSALSWSAYLLSALLWLWYGVQQRDKNIYLPCIGWIGLDAGVIIGALYYG

Samples

Sample ID Description Type Environment
1 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
129 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 98.55
Stem 0
Stem Tuber 0
Unclassified 17.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08x19_7641_c1 3300050514 Bacteria 6424
2 JGI25406J46586_10107122 3300003203 Bacteria 829
3 Ga0065707_10742802 3300005295 Bacteria 621
4 Ga0070670_100173383 3300005331 Bacteria 1871
5 Ga0070670_100211378 3300005331 Bacteria 1687
6 Ga0068869_101298009 3300005334 Bacteria 642
7 Ga0070680_100089433 3300005336 Bacteria 2548
8 Ga0070680_100101105 3300005336 Unclassified 2393
9 Ga0070689_100577184 3300005340 Bacteria 972
10 Ga0070689_100867155 3300005340 Unclassified 797
11 Ga0070689_101263707 3300005340 Unclassified 664
12 Ga0070691_10751220 3300005341 Bacteria 590
13 Ga0070687_100563393 3300005343 Bacteria 777
14 Ga0070687_100572067 3300005343 Bacteria 772
15 Ga0070687_101436301 3300005343 Unclassified 517
16 Ga0070661_100112633 3300005344 Bacteria 2033
17 Ga0070692_10039547 3300005345 Bacteria 2409
18 Ga0070692_10424370 3300005345 Bacteria 845
19 Ga0070669_100002992 3300005353 Bacteria 12179
20 Ga0070674_100050550 3300005356 Bacteria 2862
21 Ga0070674_100711083 3300005356 Bacteria 860
22 Ga0070659_100935968 3300005366 Bacteria 758
23 Ga0070710_10586397 3300005437 Bacteria 774
24 Ga0070701_10172682 3300005438 Bacteria 1260
25 Ga0070701_10691653 3300005438 Unclassified 685
26 Ga0070701_10741001 3300005438 Unclassified 665
27 Ga0070705_100122018 3300005440 Bacteria 1684
28 Ga0070705_100301334 3300005440 Bacteria 1149
29 Ga0070705_100311733 3300005440 Bacteria 1132
30 Ga0070705_101116816 3300005440 Bacteria 646
31 Ga0070700_100002052 3300005441 Bacteria 10235
32 Ga0070700_100873647 3300005441 Bacteria 730
33 Ga0070700_100918762 3300005441 Bacteria 714
34 Ga0070694_100161009 3300005444 Bacteria 1647
35 Ga0070694_100368129 3300005444 Bacteria 1118
36 Ga0070694_101198405 3300005444 Bacteria 636
37 Ga0070678_100245555 3300005456 Bacteria 1499
38 Ga0070662_100239506 3300005457 Bacteria 1455
39 Ga0070662_100283528 3300005457 Bacteria 1341
40 Ga0070681_10005013 3300005458 Bacteria 12760
41 Ga0070681_10005914 3300005458 Bacteria 11838
42 Ga0068867_100013012 3300005459 Bacteria 5888
43 Ga0068867_101603448 3300005459 Bacteria 608
44 Ga0070706_100648709 3300005467 Unclassified 980
45 Ga0070706_100860736 3300005467 Unclassified 838
46 Ga0070707_100728095 3300005468 Bacteria 955
47 Ga0070707_100872879 3300005468 Unclassified 864
48 Ga0070707_101307103 3300005468 Bacteria 692
49 Ga0070698_100441855 3300005471 Unclassified 1236
50 Ga0070699_100005990 3300005518 Bacteria 10627
51 Ga0070679_100232979 3300005530 Bacteria 1801
52 Ga0070697_100392688 3300005536 Bacteria 1203
53 Ga0070697_100666348 3300005536 Bacteria 917
54 Ga0068853_100752596 3300005539 Bacteria 931
55 Ga0068853_100961557 3300005539 Unclassified 821
56 Ga0070672_100212919 3300005543 Bacteria 1619
57 Ga0070686_100284380 3300005544 Bacteria 1221
58 Ga0070695_100078327 3300005545 Bacteria 2179
59 Ga0070695_100242645 3300005545 Bacteria 1308
60 Ga0070695_100339409 3300005545 Unclassified 1122
61 Ga0070695_100495405 3300005545 Bacteria 944
62 Ga0070695_100621661 3300005545 Unclassified 850
63 Ga0070696_100022335 3300005546 Bacteria 4297
64 Ga0070696_100057827 3300005546 Bacteria 2707
65 Ga0070696_100058811 3300005546 Bacteria 2685
66 Ga0070696_101011716 3300005546 Bacteria 695
67 Ga0070696_101359110 3300005546 Bacteria 605
68 Ga0070693_100598467 3300005547 Bacteria 796
69 Ga0070693_101027362 3300005547 Unclassified 625
70 Ga0070704_100025673 3300005549 Bacteria 3882
71 Ga0070704_100167308 3300005549 Bacteria 1745
72 Ga0070704_100589174 3300005549 Bacteria 976
73 Ga0070704_100785333 3300005549 Bacteria 850
74 Ga0070704_101492706 3300005549 Bacteria 622
75 Ga0070704_102060933 3300005549 Bacteria 530
76 Ga0070664_101031223 3300005564 Bacteria 774
77 Ga0068857_100766823 3300005577 Bacteria 919
78 Ga0068857_100876693 3300005577 Bacteria 860
79 Ga0068854_100153622 3300005578 Bacteria 1777
80 Ga0068854_100318366 3300005578 Bacteria 1263
81 Ga0068856_100604935 3300005614 Bacteria 1117
82 Ga0070702_100083707 3300005615 Unclassified 1917
83 Ga0070702_101438496 3300005615 Unclassified 565
84 Ga0068852_100075581 3300005616 Bacteria 2972
85 Ga0068852_100601899 3300005616 Bacteria 1103
86 Ga0068852_101562763 3300005616 Bacteria 682
87 Ga0068859_100002322 3300005617 Bacteria 19325
88 Ga0068859_100042615 3300005617 Bacteria 4559
89 Ga0068859_101458728 3300005617 Bacteria 755
90 Ga0068866_10470258 3300005718 Bacteria 826
91 Ga0068861_100004645 3300005719 Bacteria 9218
92 Ga0068861_100089932 3300005719 Bacteria 2421
93 Ga0068861_100936148 3300005719 Bacteria 823
94 Ga0068861_101284747 3300005719 Bacteria 711
95 Ga0068861_101408857 3300005719 Bacteria 681
96 Ga0068861_102475762 3300005719 Unclassified 522
97 Ga0068851_10913429 3300005834 Bacteria 550
98 Ga0068870_10081720 3300005840 Bacteria 1788
99 Ga0068858_101591003 3300005842 Bacteria 645
100 Ga0068862_100015570 3300005844 Bacteria 6316
101 Ga0068862_100032595 3300005844 Bacteria 4402
102 Ga0068862_101201093 3300005844 Unclassified 757
103 Ga0081539_10000178 3300005985 Bacteria 149201
104 Ga0070715_10472061 3300006163 Bacteria 713
105 Ga0097621_101036873 3300006237 Bacteria 768
106 Ga0068871_101766582 3300006358 Unclassified 587
107 Ga0068871_102061921 3300006358 Bacteria 543
108 Ga0075428_101727470 3300006844 Bacteria 652
109 Ga0075430_100113590 3300006846 Bacteria 2257
110 Ga0075431_100411507 3300006847 Bacteria 1352
111 Ga0075431_100978612 3300006847 Bacteria 813
112 Ga0075433_10123170 3300006852 Bacteria 2303
113 Ga0075433_10496188 3300006852 Bacteria 1075
114 Ga0075434_100002573 3300006871 Bacteria 16013
115 Ga0075434_100004453 3300006871 Bacteria 12628
116 Ga0075434_101029614 3300006871 Bacteria 837
117 Ga0075434_101212731 3300006871 Unclassified 766
118 Ga0075429_100135134 3300006880 Bacteria 2158
119 Ga0075429_100443244 3300006880 Bacteria 1138
120 Ga0068865_100005356 3300006881 Bacteria 7772
121 Ga0068865_102163440 3300006881 Unclassified 506
122 Ga0075436_100000124 3300006914 Bacteria 45658
123 Ga0075436_100105724 3300006914 Bacteria 1963
124 Ga0075436_100300055 3300006914 Bacteria 1151
125 Ga0075436_100492861 3300006914 Bacteria 896
126 Ga0097620_100002322 3300006931 Bacteria 19325
127 Ga0097620_100042614 3300006931 Bacteria 4559
128 Ga0097620_101458840 3300006931 Bacteria 755
129 Ga0075435_100004109 3300007076 Bacteria 9977
130 Ga0075435_100031466 3300007076 Bacteria 4180
131 Ga0075435_100410718 3300007076 Bacteria 1165
132 Ga0075435_100469907 3300007076 Bacteria 1086
133 Ga0075435_100636946 3300007076 Bacteria 925
134 Ga0111539_10076924 3300009094 Bacteria 3929
135 Ga0111539_10125765 3300009094 Bacteria 3004
136 Ga0111539_10542061 3300009094 Unclassified 1355
137 Ga0111539_11372629 3300009094 Bacteria 820
138 Ga0105245_10204437 3300009098 Bacteria 1898
139 Ga0105247_10573860 3300009101 Bacteria 833
140 Ga0114129_10664134 3300009147 Bacteria 1344
141 Ga0114129_11797785 3300009147 Bacteria 745
142 Ga0105242_10091360 3300009176 Bacteria 2563
143 Ga0105242_10977417 3300009176 Bacteria 853
144 Ga0105249_10064454 3300009553 Bacteria 3369
145 Ga0157373_10448797 3300013100 Bacteria 928
146 Ga0157371_10318319 3300013102 Bacteria 1129
147 Ga0163162_12077066 3300013306 Bacteria 652
148 Ga0157377_10813495 3300014745 Bacteria 690
149 Ga0157379_11699885 3300014968 Unclassified 618
150 Ga0157376_10259582 3300014969 Bacteria 1627
151 Ga0207656_10626229 3300025321 Bacteria 550
152 Ga0207642_10493063 3300025899 Bacteria 749
153 Ga0207685_10448915 3300025905 Unclassified 670
154 Ga0207645_10894443 3300025907 Bacteria 603
155 Ga0207643_10158939 3300025908 Bacteria 1359
156 Ga0207707_10001391 3300025912 Bacteria 22484
157 Ga0207707_10024501 3300025912 Bacteria 5280
158 Ga0207660_10044821 3300025917 Bacteria 3113
159 Ga0207660_10060410 3300025917 Bacteria 2725
160 Ga0207662_10013682 3300025918 Bacteria 4541
161 Ga0207662_10252667 3300025918 Bacteria 1158
162 Ga0207662_10550015 3300025918 Unclassified 799
163 Ga0207652_10033886 3300025921 Bacteria 4302
164 Ga0207681_10004719 3300025923 Bacteria 8385
165 Ga0207690_10693820 3300025932 Bacteria 837
166 Ga0207706_10029316 3300025933 Bacteria 4913
167 Ga0207706_10324430 3300025933 Bacteria 1340
168 Ga0207686_10468514 3300025934 Unclassified 972
169 Ga0207686_10491457 3300025934 Unclassified 951
170 Ga0207686_11498580 3300025934 Unclassified 556
171 Ga0207709_10004042 3300025935 Bacteria 8544
172 Ga0207709_11222658 3300025935 Bacteria 619
173 Ga0207670_11235025 3300025936 Unclassified 633
174 Ga0207669_10025905 3300025937 Bacteria 3180
175 Ga0207669_10471248 3300025937 Bacteria 999
176 Ga0207669_11225701 3300025937 Bacteria 636
177 Ga0207704_10007116 3300025938 Bacteria 5264
178 Ga0207704_10950747 3300025938 Bacteria 725
179 Ga0207691_10507367 3300025940 Bacteria 1024
180 Ga0207689_10704233 3300025942 Bacteria 852
181 Ga0207651_11599351 3300025960 Unclassified 587
182 Ga0207712_10037104 3300025961 Bacteria 3323
183 Ga0207712_10702771 3300025961 Bacteria 883
184 Ga0207640_10940069 3300025981 Bacteria 757
185 Ga0207639_10727231 3300026041 Bacteria 922
186 Ga0207639_10862083 3300026041 Bacteria 846
187 Ga0207708_10001982 3300026075 Bacteria 15088
188 Ga0207708_10952696 3300026075 Bacteria 744
189 Ga0207708_11260053 3300026075 Bacteria 647
190 Ga0207702_10543256 3300026078 Bacteria 1136
191 Ga0207702_10557096 3300026078 Bacteria 1122
192 Ga0207648_10011511 3300026089 Bacteria 8329
193 Ga0207674_10789570 3300026116 Bacteria 916
194 Ga0207675_100008419 3300026118 Bacteria 9723
195 Ga0207675_100153709 3300026118 Bacteria 2192
196 Ga0207675_100164309 3300026118 Bacteria 2119
197 Ga0207675_100721964 3300026118 Bacteria 1006
198 Ga0207683_10200936 3300026121 Bacteria 1812
199 Ga0207698_10832477 3300026142 Bacteria 927
200 Ga0207698_11234336 3300026142 Bacteria 762
201 Ga0209969_1049751 3300027360 Bacteria 657
202 Ga0209996_1052753 3300027395 Unclassified 617
203 Ga0209999_1023324 3300027543 Bacteria 1140
204 Ga0209999_1094850 3300027543 Unclassified 579
205 Ga0209974_10030756 3300027876 Bacteria 1778
206 Ga0207428_10041319 3300027907 Bacteria 3734
207 Ga0207428_10756859 3300027907 Unclassified 692
208 Ga0268265_10001540 3300028380 Bacteria 19164
209 Ga0268265_12546174 3300028380 Unclassified 517
210 Ga0307515_10219985 3300028794 Bacteria 1720
211 Ga0307408_100909092 3300031548 Unclassified 806
212 Ga0307406_11951123 3300031901 Unclassified 524
213 Ga0307416_100606339 3300032002 Unclassified 1175
214 Ga0373932_0210743 3300035112 Unclassified 694
215 Ga0373941_0442450 3300035115 Bacteria 544
216 Ga0373953_0299200 3300035117 Bacteria 702
217 Ga0373954_0000051 3300035118 Bacteria 41728
218 Ga0373954_0036686 3300035118 Bacteria 2276
219 Ga0373955_0725908 3300035172 Bacteria 610
220 Ga0373924_0046683 3300035410 Bacteria 1785
221 Ga0373935_0326593 3300035692 Bacteria 1090
222 Ga0373937_0000342 3300036401 Bacteria 44059
223 Ga0373937_0156801 3300036401 Bacteria 2134
224 Ga0373937_1449250 3300036401 Unclassified 634
225 Ga0439461_0205697 3300041410 Bacteria 531
226 Ga0451804_0108484 3300041463 Bacteria 763
227 Ga0451807_2737184 3300041486 Bacteria 1080
228 Ga0451853_3224524 3300041512 Bacteria 972
229 Ga0439434_0332678 3300042435 Unclassified 528
230 Ga0439459_0133402 3300042438 Bacteria 636
231 Ga0451577_0243764 3300042876 Bacteria 1626
232 Ga0451577_0268864 3300042876 Bacteria 1544
233 Ga0451577_1909339 3300042876 Bacteria 520
234 Ga0453684_0584865 3300044712 Bacteria 1226
235 Ga0451576_0100071 3300045051 Bacteria 3015
236 Ga0451576_1005901 3300045051 Bacteria 874
237 Ga0495592_0057436 3300046454 Bacteria 2873
238 Ga0495608_0276989 3300046511 Bacteria 1042
239 Ga0495628_0163593 3300046516 Bacteria 1690
240 Ga0495630_0170256 3300046517 Bacteria 1659
241 Ga0495621_0072392 3300046539 Bacteria 1272
242 Ga0495621_0157211 3300046539 Bacteria 897
243 Ga0495657_0054939 3300046675 Bacteria 2658
244 Ga0495599_0036481 3300046678 Bacteria 3088
245 Ga0495600_0386279 3300046809 Bacteria 873
246 Ga0495604_0455952 3300047317 Unclassified 835
247 Ga0495684_0780861 3300047471 Unclassified 626
248 Ga0501291_143772 3300049514 Bacteria 534
249 Ga0501041_0188123 3300049577 Bacteria 1293
250 Ga0501043_1261445 3300049579 Unclassified 517
251 Ga0501071_0174478 3300049587 Bacteria 1610
252 Ga0501072_0438622 3300049588 Bacteria 1035
253 Ga0501079_0608367 3300049741 Bacteria 860
254 Ga0501079_1127047 3300049741 Bacteria 618
255 nmdc:mga05p37_1935511_c1 3300050507 Unclassified 561
256 nmdc:mga05p37_308924_c1 3300050507 Bacteria 1875
257 nmdc:mga09592_334274_c1 3300050508 Bacteria 1312
258 nmdc:mga0qj67_32458_c1 3300050509 Bacteria 4072
259 nmdc:mga08y16_1089219_c1 3300050511 Bacteria 774
260 nmdc:mga08y16_1277527_c1 3300050511 Unclassified 702
261 nmdc:mga08y16_218904_c1 3300050511 Bacteria 1971
262 nmdc:mga0n895_2084235_c1 3300050512 Unclassified 524
263 nmdc:mga0n895_35497_c1 3300050512 Bacteria 4808
264 nmdc:mga0n895_452857_c1 3300050512 Bacteria 1296
265 nmdc:mga0rr50_1274_c1 3300050513 Bacteria 13722
266 nmdc:mga0rr50_16653_c1 3300050513 Bacteria 4889
267 nmdc:mga0rr50_180600_c1 3300050513 Bacteria 1086
268 nmdc:mga08x19_282579_c1 3300050514 Bacteria 1150
269 nmdc:mga08x19_332354_c1 3300050514 Bacteria 1059
270 nmdc:mga08x19_375185_c1 3300050514 Bacteria 996
271 nmdc:mga08x19_821784_c1 3300050514 Bacteria 660
272 nmdc:mga08x19_927380_c1 3300050514 Bacteria 619
273 nmdc:mga0a205_139139_c1 3300050515 Bacteria 2328
274 nmdc:mga0a205_727019_c1 3300050515 Unclassified 842
275 Ga0495601_0060117 3300053077 Bacteria 2411
276 Ga0495612_0330592 3300053078 Bacteria 686
277 nmdc:mga08x19_7641_c1
278 JGI25406J46586_10107122
279 Ga0065707_10742802
280 Ga0070670_100173383
281 Ga0070670_100211378
282 Ga0068869_101298009
283 Ga0070680_100089433
284 Ga0070680_100101105
285 Ga0070689_100577184
286 Ga0070689_100867155
287 Ga0070689_101263707
288 Ga0070691_10751220
289 Ga0070687_100563393
290 Ga0070687_100572067
291 Ga0070687_101436301
292 Ga0070661_100112633
293 Ga0070692_10039547
294 Ga0070692_10424370
295 Ga0070669_100002992
296 Ga0070674_100050550
297 Ga0070674_100711083
298 Ga0070659_100935968
299 Ga0070710_10586397
300 Ga0070701_10172682
301 Ga0070701_10691653
302 Ga0070701_10741001
303 Ga0070705_100122018
304 Ga0070705_100301334
305 Ga0070705_100311733
306 Ga0070705_101116816
307 Ga0070700_100002052
308 Ga0070700_100873647
309 Ga0070700_100918762
310 Ga0070694_100161009
311 Ga0070694_100368129
312 Ga0070694_101198405
313 Ga0070678_100245555
314 Ga0070662_100239506
315 Ga0070662_100283528
316 Ga0070681_10005013
317 Ga0070681_10005914
318 Ga0068867_100013012
319 Ga0068867_101603448
320 Ga0070706_100648709
321 Ga0070706_100860736
322 Ga0070707_100728095
323 Ga0070707_100872879
324 Ga0070707_101307103
325 Ga0070698_100441855
326 Ga0070699_100005990
327 Ga0070679_100232979
328 Ga0070697_100392688
329 Ga0070697_100666348
330 Ga0068853_100752596
331 Ga0068853_100961557
332 Ga0070672_100212919
333 Ga0070686_100284380
334 Ga0070695_100078327
335 Ga0070695_100242645
336 Ga0070695_100339409
337 Ga0070695_100495405
338 Ga0070695_100621661
339 Ga0070696_100022335
340 Ga0070696_100057827
341 Ga0070696_100058811
342 Ga0070696_101011716
343 Ga0070696_101359110
344 Ga0070693_100598467
345 Ga0070693_101027362
346 Ga0070704_100025673
347 Ga0070704_100167308
348 Ga0070704_100589174
349 Ga0070704_100785333
350 Ga0070704_101492706
351 Ga0070704_102060933
352 Ga0070664_101031223
353 Ga0068857_100766823
354 Ga0068857_100876693
355 Ga0068854_100153622
356 Ga0068854_100318366
357 Ga0068856_100604935
358 Ga0070702_100083707
359 Ga0070702_101438496
360 Ga0068852_100075581
361 Ga0068852_100601899
362 Ga0068852_101562763
363 Ga0068859_100002322
364 Ga0068859_100042615
365 Ga0068859_101458728
366 Ga0068866_10470258
367 Ga0068861_100004645
368 Ga0068861_100089932
369 Ga0068861_100936148
370 Ga0068861_101284747
371 Ga0068861_101408857
372 Ga0068861_102475762
373 Ga0068851_10913429
374 Ga0068870_10081720
375 Ga0068858_101591003
376 Ga0068862_100015570
377 Ga0068862_100032595
378 Ga0068862_101201093
379 Ga0081539_10000178
380 Ga0070715_10472061
381 Ga0097621_101036873
382 Ga0068871_101766582
383 Ga0068871_102061921
384 Ga0075428_101727470
385 Ga0075430_100113590
386 Ga0075431_100411507
387 Ga0075431_100978612
388 Ga0075433_10123170
389 Ga0075433_10496188
390 Ga0075434_100002573
391 Ga0075434_100004453
392 Ga0075434_101029614
393 Ga0075434_101212731
394 Ga0075429_100135134
395 Ga0075429_100443244
396 Ga0068865_100005356
397 Ga0068865_102163440
398 Ga0075436_100000124
399 Ga0075436_100105724
400 Ga0075436_100300055
401 Ga0075436_100492861
402 Ga0097620_100002322
403 Ga0097620_100042614
404 Ga0097620_101458840
405 Ga0075435_100004109
406 Ga0075435_100031466
407 Ga0075435_100410718
408 Ga0075435_100469907
409 Ga0075435_100636946
410 Ga0111539_10076924
411 Ga0111539_10125765
412 Ga0111539_10542061
413 Ga0111539_11372629
414 Ga0105245_10204437
415 Ga0105247_10573860
416 Ga0114129_10664134
417 Ga0114129_11797785
418 Ga0105242_10091360
419 Ga0105242_10977417
420 Ga0105249_10064454
421 Ga0157373_10448797
422 Ga0157371_10318319
423 Ga0163162_12077066
424 Ga0157377_10813495
425 Ga0157379_11699885
426 Ga0157376_10259582
427 Ga0207656_10626229
428 Ga0207642_10493063
429 Ga0207685_10448915
430 Ga0207645_10894443
431 Ga0207643_10158939
432 Ga0207707_10001391
433 Ga0207707_10024501
434 Ga0207660_10044821
435 Ga0207660_10060410
436 Ga0207662_10013682
437 Ga0207662_10252667
438 Ga0207662_10550015
439 Ga0207652_10033886
440 Ga0207681_10004719
441 Ga0207690_10693820
442 Ga0207706_10029316
443 Ga0207706_10324430
444 Ga0207686_10468514
445 Ga0207686_10491457
446 Ga0207686_11498580
447 Ga0207709_10004042
448 Ga0207709_11222658
449 Ga0207670_11235025
450 Ga0207669_10025905
451 Ga0207669_10471248
452 Ga0207669_11225701
453 Ga0207704_10007116
454 Ga0207704_10950747
455 Ga0207691_10507367
456 Ga0207689_10704233
457 Ga0207651_11599351
458 Ga0207712_10037104
459 Ga0207712_10702771
460 Ga0207640_10940069
461 Ga0207639_10727231
462 Ga0207639_10862083
463 Ga0207708_10001982
464 Ga0207708_10952696
465 Ga0207708_11260053
466 Ga0207702_10543256
467 Ga0207702_10557096
468 Ga0207648_10011511
469 Ga0207674_10789570
470 Ga0207675_100008419
471 Ga0207675_100153709
472 Ga0207675_100164309
473 Ga0207675_100721964
474 Ga0207683_10200936
475 Ga0207698_10832477
476 Ga0207698_11234336
477 Ga0209969_1049751
478 Ga0209996_1052753
479 Ga0209999_1023324
480 Ga0209999_1094850
481 Ga0209974_10030756
482 Ga0207428_10041319
483 Ga0207428_10756859
484 Ga0268265_10001540
485 Ga0268265_12546174
486 Ga0307515_10219985
487 Ga0307408_100909092
488 Ga0307406_11951123
489 Ga0307416_100606339
490 Ga0373932_0210743
491 Ga0373941_0442450
492 Ga0373953_0299200
493 Ga0373954_0000051
494 Ga0373954_0036686
495 Ga0373955_0725908
496 Ga0373924_0046683
497 Ga0373935_0326593
498 Ga0373937_0000342
499 Ga0373937_0156801
500 Ga0373937_1449250
501 Ga0439461_0205697
502 Ga0451804_0108484
503 Ga0451807_2737184
504 Ga0451853_3224524
505 Ga0439434_0332678
506 Ga0439459_0133402
507 Ga0451577_0243764
508 Ga0451577_0268864
509 Ga0451577_1909339
510 Ga0453684_0584865
511 Ga0451576_0100071
512 Ga0451576_1005901
513 Ga0495592_0057436
514 Ga0495608_0276989
515 Ga0495628_0163593
516 Ga0495630_0170256
517 Ga0495621_0072392
518 Ga0495621_0157211
519 Ga0495657_0054939
520 Ga0495599_0036481
521 Ga0495600_0386279
522 Ga0495604_0455952
523 Ga0495684_0780861
524 Ga0501291_143772
525 Ga0501041_0188123
526 Ga0501043_1261445
527 Ga0501071_0174478
528 Ga0501072_0438622
529 Ga0501079_0608367
530 Ga0501079_1127047
531 nmdc:mga05p37_1935511_c1
532 nmdc:mga05p37_308924_c1
533 nmdc:mga09592_334274_c1
534 nmdc:mga0qj67_32458_c1
535 nmdc:mga08y16_1089219_c1
536 nmdc:mga08y16_1277527_c1
537 nmdc:mga08y16_218904_c1
538 nmdc:mga0n895_2084235_c1
539 nmdc:mga0n895_35497_c1
540 nmdc:mga0n895_452857_c1
541 nmdc:mga0rr50_1274_c1
542 nmdc:mga0rr50_16653_c1
543 nmdc:mga0rr50_180600_c1
544 nmdc:mga08x19_282579_c1
545 nmdc:mga08x19_332354_c1
546 nmdc:mga08x19_375185_c1
547 nmdc:mga08x19_821784_c1
548 nmdc:mga08x19_927380_c1
549 nmdc:mga0a205_139139_c1
550 nmdc:mga0a205_727019_c1
551 Ga0495601_0060117
552 Ga0495612_0330592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9626 51 96
7svs-assembly1.cif.gz_G crystal structure analysis of the g73a mutant of superoxide dismutase from trichoderma reesei 0.9359 52 93
3cra-assembly1.cif.gz_A crystal structure of escherichia coli mazg, the regulator of nutritional stress response 0.9085 48 89
5cth-assembly1.cif.gz_B the 3.7 a resolution structure of a eukaryotic sweet transporter 0.9025 20 98
5xpd-assembly1.cif.gz_A sugar transporter of atsweet13 in inward-facing state with a substrate analog 0.8986 19 98
ID Description Score Start End Superfamily
af_B4FGQ8_12_152_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9674 53 94 1.20.1280.290
af_D4A2T2_39_180_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9617 59 97 1.20.1280.290
af_Q54LC9_93_232_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9568 53 96 1.20.1280.290
1vmgA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9498 51 96 1.10.287.1080
af_Q18449_29_167_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9438 53 96 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A1F5SKE0-F1-model_v4 Sugar transporter SemiSWEET 0.9554 26 99 GO:0016020
AF-A0A7W6JEH4-F1-model_v4 MtN3 and saliva related transmembrane protein 0.9492 17 98 GO:0016020
AF-A0A7C4YQG4-F1-model_v4 Uncharacterized protein 0.9424 18 99 GO:0016020
AF-A0A2N3F816-F1-model_v4 Uncharacterized protein 0.9419 19 98 GO:0016020
AF-A0A7V2H9F6-F1-model_v4 Uncharacterized protein 0.9414 19 99 GO:0016020

Map