F381354

General Info

Members Datasets Scaffolds Average Seq Length
276 221 552 223

Family's Representative Sequence

Representative Sequence 3300047447|Ga0495685_030996|Ga0495685_030996_1028_1807
Length 259
Sequence MADAPDVPAAVVVSRSPAFPPPSPVAQGRIKDVSSHETRVLIADDQDMVRAGFRLILDSQDGIEVIGEASDGAQCVELARRLRPDVCLVDIRMPRLDGLEVTRLLAGPGVAEPLKVVVITTFDQDDYLTIALRNGACGFLLKDAAPTLLIEAVRAAARGDALVSPAVTVRLLKRLEEQAPSTPDSALPLSARELDIARLVAVGRTNQEICDELFLSLSTVKTHLGSIQTKLGVRNRVETAAWAWEYGAVTRRRRHLPDR

Samples

Sample ID Description Type Environment
1 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
34 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
56 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
57 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
58 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
61 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
62 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
73 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
74 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
77 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
78 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
88 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
89 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
90 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
91 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
92 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
96 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
97 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
98 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
99 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
100 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
170 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
171 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
172 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
173 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
174 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
175 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
176 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
177 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
178 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
179 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
180 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
181 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
182 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
183 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
184 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 2501939600 Micromonospora sp. L5 Isolate Unclassified
187 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
188 2643221647 Streptomyces sp. Root369 Isolate Unclassified
189 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
190 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
191 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
192 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
193 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
194 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
195 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
196 2855683550 Micromonospora sp. RP3T Isolate Unclassified
197 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
198 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
199 2858868258 Micromonospora sp. MH33 Isolate Unclassified
200 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
201 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
202 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
203 2867475112 Streptomyces sp. TM32 Isolate Unclassified
204 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
205 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
206 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
207 2891562705 Microbispora tritici MT50 Isolate Unclassified
208 2902582711 Micromonospora sp. AP08 Isolate Unclassified
209 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
210 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
211 649633069 Micromonospora sp. L5 Isolate Unclassified
212 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
213 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
214 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
215 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
216 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
217 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
218 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
219 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
220 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
221 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.42
Metatranscriptomes 1.09
Isolates 14.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.97
Nodule 0.72
Rhizoplane 3.26
Rhizosphere 64.49
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495685_030996 3300047447 Bacteria 1838
2 JGI25160J50197_1031959 3300003354 Bacteria 1345
3 Ga0070670_100014089 3300005331 Bacteria 6859
4 Ga0068869_100037277 3300005334 Bacteria 3456
5 Ga0070682_100040817 3300005337 Bacteria 2857
6 Ga0070692_10455433 3300005345 Bacteria 820
7 Ga0070668_100006425 3300005347 Bacteria 8715
8 Ga0070714_100015827 3300005435 Bacteria 6080
9 Ga0070713_100636662 3300005436 Bacteria 1015
10 Ga0070706_100259029 3300005467 Bacteria 1624
11 Ga0068853_100096752 3300005539 Bacteria 2605
12 Ga0068853_100180306 3300005539 Bacteria 1915
13 Ga0068855_100066759 3300005563 Bacteria 4194
14 Ga0070664_100435104 3300005564 Bacteria 1203
15 Ga0068857_100343704 3300005577 Bacteria 1381
16 Ga0068854_100223357 3300005578 Bacteria 1491
17 Ga0068863_100095475 3300005841 Bacteria 2822
18 Ga0068862_100030274 3300005844 Bacteria 4561
19 Ga0081539_10008130 3300005985 Bacteria 9259
20 Ga0070717_10199014 3300006028 Bacteria 1754
21 Ga0070717_10363532 3300006028 Bacteria 1296
22 Ga0075365_10216009 3300006038 Bacteria 1345
23 Ga0075431_100110152 3300006847 Bacteria 2842
24 Ga0075429_100153406 3300006880 Bacteria 2017
25 Ga0075435_100642183 3300007076 Unclassified 921
26 Ga0111539_10754742 3300009094 Bacteria 1132
27 Ga0114129_10010105 3300009147 Bacteria 13455
28 Ga0105249_10080131 3300009553 Bacteria 3033
29 Ga0105028_113624 3300009993 Bacteria 862
30 Ga0157370_10022466 3300013104 Bacteria 6276
31 Ga0157369_10036242 3300013105 Bacteria 5405
32 Ga0157369_10108779 3300013105 Bacteria 2948
33 Ga0157380_10352348 3300014326 Bacteria 1378
34 Ga0197907_11348442 3300020069 Bacteria 1124
35 Ga0206353_11137577 3300020082 Bacteria 823
36 Ga0213873_10003560 3300021358 Bacteria 2816
37 Ga0213874_10000672 3300021377 Bacteria 6913
38 Ga0213876_10004831 3300021384 Bacteria 7476
39 Ga0213875_10076423 3300021388 Bacteria 1563
40 Ga0207426_1001637 3300025302 Bacteria 17519
41 Ga0207685_10091939 3300025905 Bacteria 1279
42 Ga0207652_10034086 3300025921 Bacteria 4289
43 Ga0207664_10067536 3300025929 Bacteria 2870
44 Ga0207690_10034583 3300025932 Bacteria 3257
45 Ga0207689_10011599 3300025942 Bacteria 7550
46 Ga0207667_10103227 3300025949 Bacteria 2941
47 Ga0207667_10655969 3300025949 Bacteria 1054
48 Ga0207712_10057224 3300025961 Bacteria 2750
49 Ga0207668_10000659 3300025972 Bacteria 21207
50 Ga0207639_10103133 3300026041 Bacteria 2310
51 Ga0207639_10141925 3300026041 Bacteria 2002
52 Ga0207702_10200943 3300026078 Bacteria 1847
53 Ga0207675_100338535 3300026118 Bacteria 1472
54 Ga0207683_10022666 3300026121 Bacteria 5393
55 Ga0207698_11316513 3300026142 Bacteria 737
56 Ga0268265_10027557 3300028380 Bacteria 4057
57 Ga0307517_10008495 3300028786 Bacteria 14733
58 Ga0307515_10104422 3300028794 Bacteria 3385
59 Ga0307515_10270033 3300028794 Bacteria 1423
60 Ga0265338_10007580 3300028800 Bacteria 13407
61 Ga0307511_10000373 3300030521 Bacteria 47702
62 Ga0307511_10146022 3300030521 Bacteria 1374
63 Ga0307512_10018642 3300030522 Bacteria 6337
64 Ga0307512_10022423 3300030522 Bacteria 5673
65 Ga0307512_10047130 3300030522 Bacteria 3506
66 Ga0316176_1059352 3300030732 Bacteria 3441
67 Ga0314311_1186744 3300030733 Bacteria 1087
68 Ga0307513_10000738 3300031456 Bacteria 46966
69 Ga0307513_10012401 3300031456 Bacteria 10523
70 Ga0307513_10058424 3300031456 Bacteria 4100
71 Ga0307509_10007647 3300031507 Bacteria 14043
72 Ga0307509_10104059 3300031507 Bacteria 2865
73 Ga0307509_10134632 3300031507 Bacteria 2419
74 Ga0307508_10002992 3300031616 Bacteria 17417
75 Ga0307508_10007389 3300031616 Bacteria 10239
76 Ga0307508_10026364 3300031616 Bacteria 5267
77 Ga0307514_10067413 3300031649 Bacteria 2701
78 Ga0316579_10296283 3300031691 Bacteria 782
79 Ga0307516_10001402 3300031730 Bacteria 33337
80 Ga0307516_10020835 3300031730 Bacteria 6766
81 Ga0307516_10151285 3300031730 Bacteria 2080
82 Ga0307405_10000523 3300031731 Bacteria 14508
83 Ga0307413_10146807 3300031824 Bacteria 1638
84 Ga0307518_10065166 3300031838 Bacteria 2643
85 Ga0307518_10096513 3300031838 Bacteria 2120
86 Ga0307518_10171938 3300031838 Bacteria 1476
87 Ga0307406_10056237 3300031901 Bacteria 2518
88 Ga0307412_10020995 3300031911 Bacteria 3983
89 Ga0307416_100003567 3300032002 Bacteria 9182
90 Ga0307415_100000911 3300032126 Bacteria 13541
91 Ga0307507_10000013 3300033179 Bacteria 242708
92 Ga0307507_10085410 3300033179 Bacteria 2745
93 Ga0307507_10134133 3300033179 Bacteria 1925
94 Ga0307510_10008777 3300033180 Bacteria 12046
95 Ga0307510_10027228 3300033180 Bacteria 6553
96 Ga0307510_10129055 3300033180 Bacteria 2208
97 Ga0307510_10216977 3300033180 Bacteria 1429
98 Ga0316214_1004650 3300033545 Bacteria 1775
99 Ga0373923_0132150 3300035111 Bacteria 1123
100 Ga0373945_0107596 3300035116 Bacteria 1097
101 Ga0373924_0101650 3300035410 Bacteria 1237
102 Ga0372808_006609 3300036459 Bacteria 1566
103 Ga0373925_0090211 3300037068 Bacteria 2343
104 Ga0395899_0027966 3300037312 Bacteria 4247
105 Ga0395905_0834842 3300037471 Bacteria 824
106 Ga0436364_0001933 3300037853 Bacteria 14376
107 Ga0395901_0216085 3300038443 Bacteria 2005
108 Ga0395901_0754602 3300038443 Bacteria 966
109 Ga0436365_0182958 3300039437 Bacteria 5095
110 Ga0436365_0637057 3300039437 Bacteria 1413
111 Ga0436363_0259316 3300039450 Bacteria 7359
112 Ga0436362_0362898 3300039453 Bacteria 844
113 Ga0436362_1181727 3300039453 Bacteria 13717
114 Ga0439436_0004861 3300041404 Bacteria 4124
115 Ga0439439_0093644 3300041406 Bacteria 822
116 Ga0451787_439900 3300041441 Bacteria 1032
117 Ga0451791_0197600 3300041451 Bacteria 771
118 Ga0451795_0877986 3300041456 Bacteria 2307
119 Ga0451841_0649316 3300041498 Bacteria 1433
120 Ga0451853_0200575 3300041512 Bacteria 5052
121 Ga0451853_0213360 3300041512 Bacteria 11649
122 Ga0451853_1870546 3300041512 Bacteria 751
123 Ga0451853_2706111 3300041512 Bacteria 1180
124 Ga0439433_0025684 3300041999 Bacteria 1331
125 Ga0439443_028396 3300042003 Bacteria 913
126 Ga0439449_0002549 3300042007 Bacteria 7116
127 Ga0439449_0019154 3300042007 Bacteria 2566
128 Ga0439454_021377 3300042011 Bacteria 957
129 Ga0439457_000112 3300042014 Bacteria 19538
130 Ga0450903_002170 3300042138 Bacteria 3511
131 Ga0439458_0025684 3300042157 Bacteria 1382
132 Ga0466969_0064628 3300044656 Bacteria 1771
133 Ga0466972_0001449 3300044658 Bacteria 11526
134 Ga0466965_0010474 3300044683 Bacteria 4326
135 Ga0466965_0031907 3300044683 Bacteria 2571
136 Ga0466963_0070521 3300044694 Bacteria 2351
137 Ga0466963_0130013 3300044694 Bacteria 1739
138 Ga0466963_0286637 3300044694 Bacteria 1158
139 Ga0466970_0205956 3300044765 Bacteria 1095
140 Ga0466957_0119476 3300044842 Bacteria 1679
141 Ga0466959_0002998 3300045049 Bacteria 10904
142 Ga0466959_0106723 3300045049 Bacteria 2002
143 Ga0466958_0041953 3300045836 Bacteria 2754
144 Ga0466967_0070072 3300045976 Bacteria 3136
145 Ga0495592_0085539 3300046454 Bacteria 2273
146 Ga0495603_0082183 3300046455 Bacteria 1887
147 Ga0495603_0097657 3300046455 Bacteria 1715
148 Ga0495629_0066461 3300046459 Bacteria 2517
149 Ga0495638_0039749 3300046460 Bacteria 2985
150 Ga0495641_0021880 3300046461 Bacteria 3209
151 Ga0495651_0012872 3300046462 Bacteria 6463
152 Ga0495653_0027584 3300046463 Bacteria 4544
153 Ga0495585_0132478 3300046492 Bacteria 1311
154 Ga0495594_0002958 3300046499 Bacteria 8808
155 Ga0495594_0035446 3300046499 Bacteria 2718
156 Ga0495594_0117161 3300046499 Bacteria 1504
157 Ga0495608_0007537 3300046511 Bacteria 7680
158 Ga0495628_0060235 3300046516 Bacteria 2979
159 Ga0495632_0172744 3300046519 Bacteria 992
160 Ga0495643_0004050 3300046522 Bacteria 10448
161 Ga0495642_0079985 3300046528 Bacteria 1375
162 Ga0495652_0237332 3300046529 Bacteria 1359
163 Ga0495640_0028763 3300046533 Bacteria 3998
164 Ga0495645_0094226 3300046543 Bacteria 2136
165 Ga0495622_0050168 3300046557 Bacteria 1937
166 Ga0495622_0099240 3300046557 Bacteria 1335
167 Ga0495633_0018507 3300046558 Bacteria 3538
168 Ga0495667_0003518 3300046559 Bacteria 10512
169 Ga0495635_0082042 3300046663 Bacteria 2206
170 Ga0495588_0018752 3300046674 Bacteria 3378
171 Ga0495588_0072906 3300046674 Bacteria 1787
172 Ga0495657_0034111 3300046675 Bacteria 3537
173 Ga0495646_0036312 3300046680 Bacteria 3053
174 Ga0495646_0160554 3300046680 Bacteria 1245
175 Ga0495658_0035713 3300046683 Bacteria 2737
176 Ga0495613_0319344 3300046689 Bacteria 1072
177 Ga0495624_0181668 3300046690 Bacteria 1281
178 Ga0495670_0233931 3300046691 Bacteria 977
179 Ga0495649_0033957 3300046694 Bacteria 2808
180 Ga0495649_0092655 3300046694 Bacteria 1609
181 Ga0495589_0054612 3300046794 Bacteria 1970
182 Ga0495660_0082593 3300046810 Bacteria 1682
183 Ga0495604_0009108 3300047317 Bacteria 7855
184 Ga0495674_0000296 3300047319 Bacteria 43131
185 Ga0495674_0182979 3300047319 Bacteria 1744
186 Ga0495680_0049258 3300047322 Bacteria 3300
187 Ga0495683_0202363 3300047323 Bacteria 895
188 Ga0495687_067313 3300047443 Bacteria 1450
189 Ga0495687_085870 3300047443 Bacteria 1218
190 Ga0495675_0185619 3300047444 Bacteria 1271
191 Ga0495602_0132952 3300048088 Bacteria 1981
192 Ga0496109_1352975 3300048912 Bacteria 648
193 Ga0496110_0120074 3300048913 Bacteria 2368
194 Ga0496110_0425394 3300048913 Bacteria 1211
195 Ga0496110_0628912 3300048913 Bacteria 972
196 Ga0496113_0272257 3300048916 Bacteria 1353
197 Ga0496126_0533689 3300048929 Bacteria 933
198 Ga0501034_0346793 3300049571 Bacteria 1414
199 Ga0501036_0221855 3300049572 Bacteria 1587
200 Ga0501036_0622447 3300049572 Bacteria 895
201 Ga0501037_0070608 3300049573 Bacteria 2541
202 Ga0501038_0015530 3300049574 Bacteria 6922
203 Ga0501039_0063254 3300049575 Bacteria 2867
204 Ga0501046_0013801 3300049580 Bacteria 6829
205 Ga0501047_0023727 3300049581 Bacteria 5889
206 Ga0501047_0089643 3300049581 Bacteria 2953
207 Ga0501047_0241739 3300049581 Bacteria 1656
208 Ga0501072_0009086 3300049588 Bacteria 7546
209 Ga0501074_0190103 3300049590 Bacteria 1464
210 Ga0501044_0400748 3300049823 Bacteria 1284
211 nmdc:mga0yw44_58473_c1 3300050492 Bacteria 2355
212 nmdc:mga05p37_118950_c1 3300050507 Bacteria 3246
213 nmdc:mga09592_159790_c1 3300050508 Bacteria 1946
214 nmdc:mga08y16_307668_c1 3300050511 Bacteria 1632
215 nmdc:mga0rr50_811688_c1 3300050513 Unclassified 798
216 Ga0495601_0055876 3300053077 Bacteria 2500
217 Ga0495595_0054638 3300053084 Bacteria 1857
218 Ga0500578_0085662 3300053086 Bacteria 2001
219 Ga0500641_0144387 3300053096 Bacteria 1028
220 Ga0500641_0172864 3300053096 Bacteria 929
221 Ga0500660_053322 3300053100 Bacteria 1988
222 Ga0500560_001968 3300053107 Bacteria 3777
223 Ga0500560_062024 3300053107 Bacteria 1220
224 Ga0500569_006331 3300053109 Bacteria 2596
225 Ga0500580_071711 3300053113 Bacteria 1424
226 Ga0500594_0021476 3300053118 Bacteria 1619
227 Ga0500628_001835 3300053129 Bacteria 3586
228 Ga0500652_001025 3300053131 Bacteria 9120
229 Ga0500561_0000712 3300053137 Bacteria 5273
230 Ga0500579_050462 3300053143 Bacteria 2548
231 Ga0500600_0110733 3300053149 Bacteria 1432
232 Ga0500616_0031947 3300053153 Bacteria 2879
233 Ga0500630_129693 3300053159 Bacteria 1104
234 Ga0500633_0002203 3300053160 Bacteria 3948
235 Ga0500634_0019504 3300053161 Bacteria 3654
236 Ga0466962_0017287 3300061719 Bacteria 3474
237 2501940678 2501939600 Bacteria 6907073
238 2515851713 2515154155 Bacteria 7985436
239 2644268660 2643221647 Bacteria 10741251
240 2676494986 2675903060 Bacteria 10051191
241 2753075031 2751185734 Bacteria 8863695
242 2753263099 2751185782 Bacteria 11227053
243 2785341510 2784746763 Bacteria 9783172
244 2793979031 2791355406 Bacteria 11364898
245 2795798006 2795385472 Bacteria 6627535
246 2812358309 2811994879 Bacteria 9313447
247 2855686669 2855683550 Bacteria 7134265
248 2856747375 2856741275 Bacteria 8096094
249 2856862768 2856858025 Bacteria 7255264
250 2858869277 2858868258 Bacteria 7683772
251 2858908111 2858902515 Bacteria 7086037
252 2862183068 2862178590 Bacteria 8583590
253 2862387436 2862382967 Bacteria 10317375
254 2867476169 2867475112 Bacteria 6909112
255 2867481265 2867475112 Bacteria 6909112
256 2875394921 2875391855 Bacteria 7600475
257 2891399210 2891395885 Bacteria 9251614
258 2891400207 2891395885 Bacteria 9251614
259 2891560967 2891554331 Bacteria 8812224
260 2891565480 2891562705 Bacteria 8039471
261 2902582938 2902582711 Bacteria 6187705
262 2912719054 2912715099 Bacteria 9460473
263 2912719279 2912715099 Bacteria 9460473
264 2935391173 2935390628 Bacteria 7043367
265 2935395555 2935390628 Bacteria 7043367
266 649815459 649633069 Bacteria 6962533
267 8008560433 8008558824 Bacteria 10610750
268 8025479881 8025478263 Bacteria 8209203
269 8025532290 8025530807 Bacteria 8495698
270 8047902549 8047893842 Bacteria 11723082
271 8048136046 8048127548 Bacteria 11053136
272 8048370346 8048369669 Bacteria 11666822
273 8048389076 8048379754 Bacteria 11877923
274 8055176899 8055172936 Bacteria 9305943
275 8056210860 8056207758 Bacteria 8639239
276 8056667856 8056667051 Bacteria 6953971
277 Ga0495685_030996
278 JGI25160J50197_1031959
279 Ga0070670_100014089
280 Ga0068869_100037277
281 Ga0070682_100040817
282 Ga0070692_10455433
283 Ga0070668_100006425
284 Ga0070714_100015827
285 Ga0070713_100636662
286 Ga0070706_100259029
287 Ga0068853_100096752
288 Ga0068853_100180306
289 Ga0068855_100066759
290 Ga0070664_100435104
291 Ga0068857_100343704
292 Ga0068854_100223357
293 Ga0068863_100095475
294 Ga0068862_100030274
295 Ga0081539_10008130
296 Ga0070717_10199014
297 Ga0070717_10363532
298 Ga0075365_10216009
299 Ga0075431_100110152
300 Ga0075429_100153406
301 Ga0075435_100642183
302 Ga0111539_10754742
303 Ga0114129_10010105
304 Ga0105249_10080131
305 Ga0105028_113624
306 Ga0157370_10022466
307 Ga0157369_10036242
308 Ga0157369_10108779
309 Ga0157380_10352348
310 Ga0197907_11348442
311 Ga0206353_11137577
312 Ga0213873_10003560
313 Ga0213874_10000672
314 Ga0213876_10004831
315 Ga0213875_10076423
316 Ga0207426_1001637
317 Ga0207685_10091939
318 Ga0207652_10034086
319 Ga0207664_10067536
320 Ga0207690_10034583
321 Ga0207689_10011599
322 Ga0207667_10103227
323 Ga0207667_10655969
324 Ga0207712_10057224
325 Ga0207668_10000659
326 Ga0207639_10103133
327 Ga0207639_10141925
328 Ga0207702_10200943
329 Ga0207675_100338535
330 Ga0207683_10022666
331 Ga0207698_11316513
332 Ga0268265_10027557
333 Ga0307517_10008495
334 Ga0307515_10104422
335 Ga0307515_10270033
336 Ga0265338_10007580
337 Ga0307511_10000373
338 Ga0307511_10146022
339 Ga0307512_10018642
340 Ga0307512_10022423
341 Ga0307512_10047130
342 Ga0316176_1059352
343 Ga0314311_1186744
344 Ga0307513_10000738
345 Ga0307513_10012401
346 Ga0307513_10058424
347 Ga0307509_10007647
348 Ga0307509_10104059
349 Ga0307509_10134632
350 Ga0307508_10002992
351 Ga0307508_10007389
352 Ga0307508_10026364
353 Ga0307514_10067413
354 Ga0316579_10296283
355 Ga0307516_10001402
356 Ga0307516_10020835
357 Ga0307516_10151285
358 Ga0307405_10000523
359 Ga0307413_10146807
360 Ga0307518_10065166
361 Ga0307518_10096513
362 Ga0307518_10171938
363 Ga0307406_10056237
364 Ga0307412_10020995
365 Ga0307416_100003567
366 Ga0307415_100000911
367 Ga0307507_10000013
368 Ga0307507_10085410
369 Ga0307507_10134133
370 Ga0307510_10008777
371 Ga0307510_10027228
372 Ga0307510_10129055
373 Ga0307510_10216977
374 Ga0316214_1004650
375 Ga0373923_0132150
376 Ga0373945_0107596
377 Ga0373924_0101650
378 Ga0372808_006609
379 Ga0373925_0090211
380 Ga0395899_0027966
381 Ga0395905_0834842
382 Ga0436364_0001933
383 Ga0395901_0216085
384 Ga0395901_0754602
385 Ga0436365_0182958
386 Ga0436365_0637057
387 Ga0436363_0259316
388 Ga0436362_0362898
389 Ga0436362_1181727
390 Ga0439436_0004861
391 Ga0439439_0093644
392 Ga0451787_439900
393 Ga0451791_0197600
394 Ga0451795_0877986
395 Ga0451841_0649316
396 Ga0451853_0200575
397 Ga0451853_0213360
398 Ga0451853_1870546
399 Ga0451853_2706111
400 Ga0439433_0025684
401 Ga0439443_028396
402 Ga0439449_0002549
403 Ga0439449_0019154
404 Ga0439454_021377
405 Ga0439457_000112
406 Ga0450903_002170
407 Ga0439458_0025684
408 Ga0466969_0064628
409 Ga0466972_0001449
410 Ga0466965_0010474
411 Ga0466965_0031907
412 Ga0466963_0070521
413 Ga0466963_0130013
414 Ga0466963_0286637
415 Ga0466970_0205956
416 Ga0466957_0119476
417 Ga0466959_0002998
418 Ga0466959_0106723
419 Ga0466958_0041953
420 Ga0466967_0070072
421 Ga0495592_0085539
422 Ga0495603_0082183
423 Ga0495603_0097657
424 Ga0495629_0066461
425 Ga0495638_0039749
426 Ga0495641_0021880
427 Ga0495651_0012872
428 Ga0495653_0027584
429 Ga0495585_0132478
430 Ga0495594_0002958
431 Ga0495594_0035446
432 Ga0495594_0117161
433 Ga0495608_0007537
434 Ga0495628_0060235
435 Ga0495632_0172744
436 Ga0495643_0004050
437 Ga0495642_0079985
438 Ga0495652_0237332
439 Ga0495640_0028763
440 Ga0495645_0094226
441 Ga0495622_0050168
442 Ga0495622_0099240
443 Ga0495633_0018507
444 Ga0495667_0003518
445 Ga0495635_0082042
446 Ga0495588_0018752
447 Ga0495588_0072906
448 Ga0495657_0034111
449 Ga0495646_0036312
450 Ga0495646_0160554
451 Ga0495658_0035713
452 Ga0495613_0319344
453 Ga0495624_0181668
454 Ga0495670_0233931
455 Ga0495649_0033957
456 Ga0495649_0092655
457 Ga0495589_0054612
458 Ga0495660_0082593
459 Ga0495604_0009108
460 Ga0495674_0000296
461 Ga0495674_0182979
462 Ga0495680_0049258
463 Ga0495683_0202363
464 Ga0495687_067313
465 Ga0495687_085870
466 Ga0495675_0185619
467 Ga0495602_0132952
468 Ga0496109_1352975
469 Ga0496110_0120074
470 Ga0496110_0425394
471 Ga0496110_0628912
472 Ga0496113_0272257
473 Ga0496126_0533689
474 Ga0501034_0346793
475 Ga0501036_0221855
476 Ga0501036_0622447
477 Ga0501037_0070608
478 Ga0501038_0015530
479 Ga0501039_0063254
480 Ga0501046_0013801
481 Ga0501047_0023727
482 Ga0501047_0089643
483 Ga0501047_0241739
484 Ga0501072_0009086
485 Ga0501074_0190103
486 Ga0501044_0400748
487 nmdc:mga0yw44_58473_c1
488 nmdc:mga05p37_118950_c1
489 nmdc:mga09592_159790_c1
490 nmdc:mga08y16_307668_c1
491 nmdc:mga0rr50_811688_c1
492 Ga0495601_0055876
493 Ga0495595_0054638
494 Ga0500578_0085662
495 Ga0500641_0144387
496 Ga0500641_0172864
497 Ga0500660_053322
498 Ga0500560_001968
499 Ga0500560_062024
500 Ga0500569_006331
501 Ga0500580_071711
502 Ga0500594_0021476
503 Ga0500628_001835
504 Ga0500652_001025
505 Ga0500561_0000712
506 Ga0500579_050462
507 Ga0500600_0110733
508 Ga0500616_0031947
509 Ga0500630_129693
510 Ga0500633_0002203
511 Ga0500634_0019504
512 Ga0466962_0017287
513 2501940678
514 2515851713
515 2644268660
516 2676494986
517 2753075031
518 2753263099
519 2785341510
520 2793979031
521 2795798006
522 2812358309
523 2855686669
524 2856747375
525 2856862768
526 2858869277
527 2858908111
528 2862183068
529 2862387436
530 2867476169
531 2867481265
532 2875394921
533 2891399210
534 2891400207
535 2891560967
536 2891565480
537 2902582938
538 2912719054
539 2912719279
540 2935391173
541 2935395555
542 649815459
543 8008560433
544 8025479881
545 8025532290
546 8047902549
547 8048136046
548 8048370346
549 8048389076
550 8055176899
551 8056210860
552 8056667856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

40

154

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

187

243

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9741 162 221
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9703 162 221
3p7n-assembly2.cif.gz_B crystal structure of light activated transcription factor el222 from erythrobacter litoralis 0.9672 162 220
1qmp-assembly4.cif.gz_D phosphorylated aspartate in the crystal structure of the sporulation response regulator, spo0a 0.9647 3 127
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9631 162 221
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9687 161 219 1.10.10.10
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9672 162 220 1.10.10.10
1qmpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9626 3 128 3.40.50.2300
4le0B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9585 3 142 3.40.50.2300
3kloB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9533 162 218 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A366IML7-F1-model_v4 LuxR family two component transcriptional regulator 0.9523 3 221 GO:0000160
GO:0003677
GO:0006355
AF-A0A372ZJJ1-F1-model_v4 DNA-binding response regulator 0.928 2 226 GO:0000160
GO:0003677
GO:0006355
AF-G2GIK0-F1-model_v4 Two component system response regulator 0.9244 3 222 GO:0000160
GO:0003677
GO:0006355
AF-G6F218-F1-model_v4 Nitrate/nitrite response regulator protein narL 0.9222 2 222 GO:0000160
GO:0003677
GO:0006355
AF-A0A1U7LJ03-F1-model_v4 Response regulator mcs4 isoform A 0.9153 2 128 GO:0000160

Map