F381181

General Info

Members Datasets Scaffolds Average Seq Length
276 175 552 64

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10826966|Ga0207676_108269662
Length 73
Sequence MLGFVRGDLMDDADFEGTLVLEQLAAIGKVEDFFDAIDADDTQRATSLMKEADVDAATIATVIKKMEASDGEH

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
142 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
169 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
170 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.26
Rhizosphere 96.38
Stem 0
Stem Tuber 0
Unclassified 23.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10826966 3300026095 Bacteria 905
2 2214697181 2209111006 Unclassified 511
3 Ga0070683_100033336 3300005329 Unclassified 4696
4 Ga0070683_100174623 3300005329 Bacteria 2040
5 Ga0070683_101584311 3300005329 Bacteria 630
6 Ga0070690_100009010 3300005330 Bacteria 5769
7 Ga0070690_100021856 3300005330 Unclassified 3911
8 Ga0070690_101080735 3300005330 Unclassified 635
9 Ga0070670_100108150 3300005331 Unclassified 2396
10 Ga0070677_10133398 3300005333 Bacteria 1136
11 Ga0068869_100743221 3300005334 Bacteria 839
12 Ga0070666_10151664 3300005335 Bacteria 1617
13 Ga0070682_101744925 3300005337 Unclassified 542
14 Ga0068868_100228530 3300005338 Unclassified 1560
15 Ga0070660_100195871 3300005339 Bacteria 1638
16 Ga0070689_100054089 3300005340 Bacteria 3107
17 Ga0070689_100587186 3300005340 Bacteria 964
18 Ga0070691_10010592 3300005341 Bacteria 4210
19 Ga0070687_100704813 3300005343 Bacteria 705
20 Ga0070692_10019130 3300005345 Bacteria 3303
21 Ga0070669_100008707 3300005353 Bacteria 7239
22 Ga0070675_100294477 3300005354 Bacteria 1429
23 Ga0070675_102010951 3300005354 Bacteria 533
24 Ga0070671_101410387 3300005355 Unclassified 615
25 Ga0070674_100006075 3300005356 Bacteria 7021
26 Ga0070673_100140758 3300005364 Bacteria 2035
27 Ga0070673_100193610 3300005364 Bacteria 1748
28 Ga0070673_100202151 3300005364 Bacteria 1711
29 Ga0070673_101080113 3300005364 Unclassified 749
30 Ga0070688_100004552 3300005365 Bacteria 7231
31 Ga0070688_100718889 3300005365 Bacteria 775
32 Ga0070688_101248929 3300005365 Bacteria 598
33 Ga0070688_101689901 3300005365 Unclassified 518
34 Ga0070659_100614105 3300005366 Bacteria 935
35 Ga0070667_100137070 3300005367 Bacteria 2140
36 Ga0070667_100185514 3300005367 Bacteria 1841
37 Ga0070667_100248781 3300005367 Bacteria 1589
38 Ga0070667_100932921 3300005367 Bacteria 809
39 Ga0070667_101040753 3300005367 Bacteria 764
40 Ga0070713_100820699 3300005436 Bacteria 892
41 Ga0070701_10097845 3300005438 Bacteria 1620
42 Ga0070705_100221647 3300005440 Bacteria 1310
43 Ga0070700_100010869 3300005441 Bacteria 5033
44 Ga0070694_100316582 3300005444 Bacteria 1200
45 Ga0070678_100224738 3300005456 Bacteria 1562
46 Ga0070678_101619671 3300005456 Bacteria 608
47 Ga0070678_102115298 3300005456 Bacteria 533
48 Ga0070662_100078252 3300005457 Bacteria 2456
49 Ga0070681_10626146 3300005458 Bacteria 991
50 Ga0068867_100065623 3300005459 Bacteria 2701
51 Ga0070685_10033787 3300005466 Bacteria 2877
52 Ga0070685_10040632 3300005466 Bacteria 2647
53 Ga0070685_10539755 3300005466 Bacteria 831
54 Ga0070707_100449434 3300005468 Bacteria 1249
55 Ga0070698_101155742 3300005471 Unclassified 723
56 Ga0070679_100719128 3300005530 Bacteria 941
57 Ga0070684_100031826 3300005535 Unclassified 4493
58 Ga0070684_100739159 3300005535 Bacteria 918
59 Ga0070684_101112837 3300005535 Bacteria 742
60 Ga0070672_100015930 3300005543 Bacteria 5369
61 Ga0070672_100036796 3300005543 Bacteria 3732
62 Ga0070672_100636936 3300005543 Bacteria 930
63 Ga0070672_101715995 3300005543 Unclassified 564
64 Ga0070686_100004588 3300005544 Bacteria 7615
65 Ga0070686_100058169 3300005544 Unclassified 2486
66 Ga0070686_100132253 3300005544 Bacteria 1727
67 Ga0070686_101424436 3300005544 Bacteria 582
68 Ga0070696_101345647 3300005546 Bacteria 607
69 Ga0070665_100187343 3300005548 Bacteria 2070
70 Ga0070665_100499720 3300005548 Unclassified 1227
71 Ga0068855_101007190 3300005563 Bacteria 875
72 Ga0068855_101178352 3300005563 Bacteria 797
73 Ga0070664_100664027 3300005564 Unclassified 969
74 Ga0070664_101112927 3300005564 Bacteria 744
75 Ga0068857_100065905 3300005577 Bacteria 3222
76 Ga0068857_101077246 3300005577 Bacteria 775
77 Ga0068856_100400064 3300005614 Unclassified 1393
78 Ga0068852_100277025 3300005616 Bacteria 1616
79 Ga0068859_100327110 3300005617 Bacteria 1627
80 Ga0068859_100530412 3300005617 Bacteria 1272
81 Ga0068864_100577539 3300005618 Bacteria 1089
82 Ga0068864_101094780 3300005618 Bacteria 793
83 Ga0068864_102176831 3300005618 Bacteria 561
84 Ga0068866_10035734 3300005718 Bacteria 2429
85 Ga0068866_10236076 3300005718 Bacteria 1111
86 Ga0068863_100077615 3300005841 Unclassified 3144
87 Ga0068858_100081312 3300005842 Bacteria 3011
88 Ga0068858_101366519 3300005842 Unclassified 698
89 Ga0068858_101629825 3300005842 Bacteria 637
90 Ga0068860_100045092 3300005843 Bacteria 4203
91 Ga0068862_101171653 3300005844 Bacteria 766
92 Ga0068862_102287320 3300005844 Bacteria 552
93 Ga0081455_10077297 3300005937 Bacteria 2739
94 Ga0075432_10609605 3300006058 Bacteria 500
95 Ga0097621_100218285 3300006237 Bacteria 1661
96 Ga0097621_100644978 3300006237 Bacteria 971
97 Ga0097621_101847492 3300006237 Bacteria 576
98 Ga0075428_100400702 3300006844 Bacteria 1471
99 Ga0075428_102425501 3300006844 Bacteria 538
100 Ga0075429_101750491 3300006880 Bacteria 539
101 Ga0068865_100010098 3300006881 Bacteria 5875
102 Ga0068865_100085842 3300006881 Unclassified 2271
103 Ga0097620_100327116 3300006931 Bacteria 1627
104 Ga0097620_100530379 3300006931 Bacteria 1272
105 Ga0105240_10310287 3300009093 Unclassified 1802
106 Ga0111539_10014458 3300009094 Bacteria 9850
107 Ga0111539_10902150 3300009094 Bacteria 1028
108 Ga0105243_10039152 3300009148 Bacteria 3695
109 Ga0105242_10653271 3300009176 Unclassified 1023
110 Ga0105248_12775843 3300009177 Bacteria 559
111 Ga0105237_11100703 3300009545 Unclassified 801
112 Ga0105238_10213133 3300009551 Bacteria 1908
113 Ga0105238_10683505 3300009551 Bacteria 1038
114 Ga0105249_10038422 3300009553 Bacteria 4343
115 Ga0105239_10161767 3300010375 Bacteria 2501
116 Ga0105246_11726650 3300011119 Bacteria 596
117 Ga0157374_10492896 3300013296 Unclassified 1229
118 Ga0157378_10060774 3300013297 Bacteria 3371
119 Ga0157378_11772210 3300013297 Unclassified 665
120 Ga0163162_12663774 3300013306 Bacteria 575
121 Ga0157372_12844373 3300013307 Bacteria 555
122 Ga0163163_12655376 3300014325 Bacteria 558
123 Ga0157380_12862351 3300014326 Unclassified 549
124 Ga0154015_1313335 3300020610 Unclassified 653
125 Ga0207697_10130522 3300025315 Bacteria 1086
126 Ga0207697_10295841 3300025315 Bacteria 718
127 Ga0207682_10126093 3300025893 Bacteria 1139
128 Ga0207692_10303062 3300025898 Bacteria 973
129 Ga0207642_10028622 3300025899 Bacteria 2297
130 Ga0207642_10133497 3300025899 Bacteria 1299
131 Ga0207680_10318171 3300025903 Bacteria 1088
132 Ga0207645_10002236 3300025907 Bacteria 15416
133 Ga0207707_10341131 3300025912 Bacteria 1292
134 Ga0207707_10559608 3300025912 Bacteria 971
135 Ga0207707_11408092 3300025912 Bacteria 556
136 Ga0207695_10100302 3300025913 Bacteria 2891
137 Ga0207671_10810760 3300025914 Unclassified 742
138 Ga0207662_10035929 3300025918 Bacteria 2895
139 Ga0207657_10489412 3300025919 Bacteria 964
140 Ga0207652_10140798 3300025921 Bacteria 2157
141 Ga0207652_10441312 3300025921 Bacteria 1173
142 Ga0207652_10652575 3300025921 Bacteria 941
143 Ga0207681_10001729 3300025923 Bacteria 14025
144 Ga0207694_10002608 3300025924 Bacteria 14622
145 Ga0207650_10185822 3300025925 Unclassified 1658
146 Ga0207644_11532238 3300025931 Unclassified 559
147 Ga0207706_10171615 3300025933 Bacteria 1905
148 Ga0207709_10024195 3300025935 Bacteria 3465
149 Ga0207670_10087923 3300025936 Bacteria 2190
150 Ga0207670_10100470 3300025936 Bacteria 2065
151 Ga0207670_10176937 3300025936 Bacteria 1604
152 Ga0207670_10392629 3300025936 Bacteria 1108
153 Ga0207669_10001917 3300025937 Bacteria 8819
154 Ga0207704_10001677 3300025938 Bacteria 9915
155 Ga0207704_10965200 3300025938 Unclassified 719
156 Ga0207691_10008971 3300025940 Bacteria 9592
157 Ga0207691_10150191 3300025940 Bacteria 2049
158 Ga0207691_10198770 3300025940 Bacteria 1745
159 Ga0207711_11104425 3300025941 Unclassified 734
160 Ga0207689_10724397 3300025942 Bacteria 839
161 Ga0207661_10011461 3300025944 Bacteria 6425
162 Ga0207661_10383208 3300025944 Bacteria 1273
163 Ga0207661_12077957 3300025944 Unclassified 514
164 Ga0207679_10761682 3300025945 Bacteria 881
165 Ga0207667_10853114 3300025949 Bacteria 905
166 Ga0207651_10053982 3300025960 Bacteria 2750
167 Ga0207651_10213370 3300025960 Bacteria 1555
168 Ga0207651_10853336 3300025960 Bacteria 809
169 Ga0207651_10899821 3300025960 Unclassified 788
170 Ga0207712_10131883 3300025961 Bacteria 1905
171 Ga0207668_10177087 3300025972 Bacteria 1678
172 Ga0207658_10608575 3300025986 Bacteria 982
173 Ga0207658_10960512 3300025986 Bacteria 779
174 Ga0207677_10214554 3300026023 Unclassified 1539
175 Ga0207703_10287646 3300026035 Bacteria 1495
176 Ga0207703_11798533 3300026035 Bacteria 589
177 Ga0207708_10039830 3300026075 Bacteria 3581
178 Ga0207702_10378524 3300026078 Unclassified 1361
179 Ga0207702_11030651 3300026078 Bacteria 816
180 Ga0207702_11236511 3300026078 Unclassified 741
181 Ga0207702_11891120 3300026078 Bacteria 588
182 Ga0207641_10321993 3300026088 Unclassified 1466
183 Ga0207648_10022404 3300026089 Bacteria 5672
184 Ga0207676_10500923 3300026095 Bacteria 1153
185 Ga0207676_10550320 3300026095 Bacteria 1102
186 Ga0207674_10171657 3300026116 Bacteria 2122
187 Ga0207674_11321980 3300026116 Bacteria 690
188 Ga0207675_100001520 3300026118 Bacteria 23271
189 Ga0207683_10008528 3300026121 Bacteria 8771
190 Ga0207683_10127734 3300026121 Bacteria 2286
191 Ga0207698_10286715 3300026142 Bacteria 1526
192 Ga0207428_10004590 3300027907 Bacteria 13090
193 Ga0268266_10140658 3300028379 Bacteria 2166
194 Ga0268266_10786005 3300028379 Bacteria 919
195 Ga0268265_12211151 3300028380 Unclassified 557
196 Ga0268264_10155484 3300028381 Bacteria 2055
197 Ga0265319_1134998 3300028563 Bacteria 766
198 Ga0265318_10000772 3300028577 Bacteria 21278
199 Ga0265318_10032094 3300028577 Bacteria 2034
200 Ga0265318_10313917 3300028577 Unclassified 572
201 Ga0265330_10000141 3300031235 Bacteria 58160
202 Ga0265332_10023037 3300031238 Bacteria 2746
203 Ga0265332_10056425 3300031238 Bacteria 1683
204 Ga0265320_10065435 3300031240 Bacteria 1725
205 Ga0265320_10072136 3300031240 Bacteria 1625
206 Ga0265329_10017272 3300031242 Bacteria 2485
207 Ga0265340_10222859 3300031247 Unclassified 845
208 Ga0265339_10006870 3300031249 Bacteria 7415
209 Ga0265331_10026666 3300031250 Unclassified 2903
210 Ga0307513_10849017 3300031456 Unclassified 620
211 Ga0265313_10048809 3300031595 Bacteria 2041
212 Ga0265313_10173475 3300031595 Unclassified 909
213 Ga0265314_10015064 3300031711 Bacteria 6151
214 Ga0265314_10018457 3300031711 Bacteria 5436
215 Ga0265342_10049004 3300031712 Bacteria 2530
216 Ga0373934_0200995 3300035086 Bacteria 820
217 Ga0373953_0005845 3300035117 Unclassified 4023
218 Ga0373953_0279676 3300035117 Bacteria 727
219 Ga0373954_0006239 3300035118 Bacteria 5197
220 Ga0373956_0024100 3300035119 Bacteria 2618
221 Ga0373956_0367715 3300035119 Unclassified 686
222 Ga0373957_0021829 3300035120 Unclassified 2276
223 Ga0373946_0151054 3300035171 Bacteria 1084
224 Ga0373955_0049785 3300035172 Bacteria 2276
225 Ga0373955_0321833 3300035172 Bacteria 934
226 Ga0373961_0276280 3300035241 Bacteria 615
227 Ga0373931_0119154 3300035691 Bacteria 1507
228 Ga0373935_0598682 3300035692 Bacteria 806
229 Ga0373935_0882725 3300035692 Bacteria 662
230 Ga0373933_0000577 3300035724 Bacteria 23008
231 Ga0373933_0038636 3300035724 Bacteria 2805
232 Ga0373933_0349737 3300035724 Unclassified 960
233 Ga0373933_0429274 3300035724 Bacteria 863
234 Ga0373937_0016507 3300036401 Bacteria 6560
235 Ga0373937_0028339 3300036401 Bacteria 5066
236 Ga0373937_0028412 3300036401 Bacteria 5061
237 Ga0373937_0102285 3300036401 Bacteria 2660
238 Ga0373937_0238731 3300036401 Unclassified 1712
239 Ga0373937_0296165 3300036401 Unclassified 1529
240 Ga0373937_0456693 3300036401 Unclassified 1213
241 Ga0373925_0965655 3300037068 Bacteria 702
242 Ga0451807_0958571 3300041486 Unclassified 730
243 Ga0451807_2569375 3300041486 Bacteria 717
244 Ga0451577_0054331 3300042876 Bacteria 3575
245 Ga0453684_0356576 3300044712 Bacteria 1648
246 Ga0451576_0321895 3300045051 Unclassified 1618
247 Ga0451576_1886747 3300045051 Bacteria 617
248 Ga0495662_0153515 3300046476 Unclassified 1134
249 Ga0495652_0284604 3300046529 Unclassified 1209
250 Ga0495640_0094614 3300046533 Unclassified 1968
251 Ga0495587_0136173 3300046536 Bacteria 1403
252 Ga0495657_0503119 3300046675 Unclassified 706
253 Ga0495680_0115296 3300047322 Unclassified 1988
254 Ga0495684_0246698 3300047471 Unclassified 1300
255 Ga0496104_0032988 3300048907 Bacteria 4821
256 Ga0496104_0319264 3300048907 Bacteria 1466
257 Ga0496107_0687410 3300048910 Bacteria 753
258 Ga0496108_0492050 3300048911 Unclassified 1071
259 Ga0496109_0250813 3300048912 Bacteria 1667
260 Ga0496114_0104329 3300048917 Bacteria 2424
261 Ga0496114_0283787 3300048917 Bacteria 1460
262 Ga0501069_0539641 3300049585 Bacteria 697
263 Ga0501070_1171400 3300049586 Bacteria 591
264 Ga0501070_1499410 3300049586 Unclassified 510
265 Ga0501072_0886186 3300049588 Bacteria 697
266 Ga0501216_014966 3300049660 Bacteria 1302
267 Ga0501227_019437 3300049665 Unclassified 1549
268 Ga0501225_0009000 3300049705 Bacteria 2855
269 Ga0501080_0326570 3300049742 Bacteria 1388
270 Ga0501080_1038354 3300049742 Unclassified 710
271 nmdc:mga09592_1607004_c1 3300050508 Bacteria 526
272 nmdc:mga08y16_4107_c1 3300050511 Bacteria 15189
273 nmdc:mga08y16_941839_c1 3300050511 Bacteria 847
274 Ga0495601_0259562 3300053077 Unclassified 1134
275 Ga0495595_0046528 3300053084 Bacteria 1999
276 Ga0495595_0061788 3300053084 Unclassified 1755
277 Ga0207676_10826966
278 2214697181
279 Ga0070683_100033336
280 Ga0070683_100174623
281 Ga0070683_101584311
282 Ga0070690_100009010
283 Ga0070690_100021856
284 Ga0070690_101080735
285 Ga0070670_100108150
286 Ga0070677_10133398
287 Ga0068869_100743221
288 Ga0070666_10151664
289 Ga0070682_101744925
290 Ga0068868_100228530
291 Ga0070660_100195871
292 Ga0070689_100054089
293 Ga0070689_100587186
294 Ga0070691_10010592
295 Ga0070687_100704813
296 Ga0070692_10019130
297 Ga0070669_100008707
298 Ga0070675_100294477
299 Ga0070675_102010951
300 Ga0070671_101410387
301 Ga0070674_100006075
302 Ga0070673_100140758
303 Ga0070673_100193610
304 Ga0070673_100202151
305 Ga0070673_101080113
306 Ga0070688_100004552
307 Ga0070688_100718889
308 Ga0070688_101248929
309 Ga0070688_101689901
310 Ga0070659_100614105
311 Ga0070667_100137070
312 Ga0070667_100185514
313 Ga0070667_100248781
314 Ga0070667_100932921
315 Ga0070667_101040753
316 Ga0070713_100820699
317 Ga0070701_10097845
318 Ga0070705_100221647
319 Ga0070700_100010869
320 Ga0070694_100316582
321 Ga0070678_100224738
322 Ga0070678_101619671
323 Ga0070678_102115298
324 Ga0070662_100078252
325 Ga0070681_10626146
326 Ga0068867_100065623
327 Ga0070685_10033787
328 Ga0070685_10040632
329 Ga0070685_10539755
330 Ga0070707_100449434
331 Ga0070698_101155742
332 Ga0070679_100719128
333 Ga0070684_100031826
334 Ga0070684_100739159
335 Ga0070684_101112837
336 Ga0070672_100015930
337 Ga0070672_100036796
338 Ga0070672_100636936
339 Ga0070672_101715995
340 Ga0070686_100004588
341 Ga0070686_100058169
342 Ga0070686_100132253
343 Ga0070686_101424436
344 Ga0070696_101345647
345 Ga0070665_100187343
346 Ga0070665_100499720
347 Ga0068855_101007190
348 Ga0068855_101178352
349 Ga0070664_100664027
350 Ga0070664_101112927
351 Ga0068857_100065905
352 Ga0068857_101077246
353 Ga0068856_100400064
354 Ga0068852_100277025
355 Ga0068859_100327110
356 Ga0068859_100530412
357 Ga0068864_100577539
358 Ga0068864_101094780
359 Ga0068864_102176831
360 Ga0068866_10035734
361 Ga0068866_10236076
362 Ga0068863_100077615
363 Ga0068858_100081312
364 Ga0068858_101366519
365 Ga0068858_101629825
366 Ga0068860_100045092
367 Ga0068862_101171653
368 Ga0068862_102287320
369 Ga0081455_10077297
370 Ga0075432_10609605
371 Ga0097621_100218285
372 Ga0097621_100644978
373 Ga0097621_101847492
374 Ga0075428_100400702
375 Ga0075428_102425501
376 Ga0075429_101750491
377 Ga0068865_100010098
378 Ga0068865_100085842
379 Ga0097620_100327116
380 Ga0097620_100530379
381 Ga0105240_10310287
382 Ga0111539_10014458
383 Ga0111539_10902150
384 Ga0105243_10039152
385 Ga0105242_10653271
386 Ga0105248_12775843
387 Ga0105237_11100703
388 Ga0105238_10213133
389 Ga0105238_10683505
390 Ga0105249_10038422
391 Ga0105239_10161767
392 Ga0105246_11726650
393 Ga0157374_10492896
394 Ga0157378_10060774
395 Ga0157378_11772210
396 Ga0163162_12663774
397 Ga0157372_12844373
398 Ga0163163_12655376
399 Ga0157380_12862351
400 Ga0154015_1313335
401 Ga0207697_10130522
402 Ga0207697_10295841
403 Ga0207682_10126093
404 Ga0207692_10303062
405 Ga0207642_10028622
406 Ga0207642_10133497
407 Ga0207680_10318171
408 Ga0207645_10002236
409 Ga0207707_10341131
410 Ga0207707_10559608
411 Ga0207707_11408092
412 Ga0207695_10100302
413 Ga0207671_10810760
414 Ga0207662_10035929
415 Ga0207657_10489412
416 Ga0207652_10140798
417 Ga0207652_10441312
418 Ga0207652_10652575
419 Ga0207681_10001729
420 Ga0207694_10002608
421 Ga0207650_10185822
422 Ga0207644_11532238
423 Ga0207706_10171615
424 Ga0207709_10024195
425 Ga0207670_10087923
426 Ga0207670_10100470
427 Ga0207670_10176937
428 Ga0207670_10392629
429 Ga0207669_10001917
430 Ga0207704_10001677
431 Ga0207704_10965200
432 Ga0207691_10008971
433 Ga0207691_10150191
434 Ga0207691_10198770
435 Ga0207711_11104425
436 Ga0207689_10724397
437 Ga0207661_10011461
438 Ga0207661_10383208
439 Ga0207661_12077957
440 Ga0207679_10761682
441 Ga0207667_10853114
442 Ga0207651_10053982
443 Ga0207651_10213370
444 Ga0207651_10853336
445 Ga0207651_10899821
446 Ga0207712_10131883
447 Ga0207668_10177087
448 Ga0207658_10608575
449 Ga0207658_10960512
450 Ga0207677_10214554
451 Ga0207703_10287646
452 Ga0207703_11798533
453 Ga0207708_10039830
454 Ga0207702_10378524
455 Ga0207702_11030651
456 Ga0207702_11236511
457 Ga0207702_11891120
458 Ga0207641_10321993
459 Ga0207648_10022404
460 Ga0207676_10500923
461 Ga0207676_10550320
462 Ga0207674_10171657
463 Ga0207674_11321980
464 Ga0207675_100001520
465 Ga0207683_10008528
466 Ga0207683_10127734
467 Ga0207698_10286715
468 Ga0207428_10004590
469 Ga0268266_10140658
470 Ga0268266_10786005
471 Ga0268265_12211151
472 Ga0268264_10155484
473 Ga0265319_1134998
474 Ga0265318_10000772
475 Ga0265318_10032094
476 Ga0265318_10313917
477 Ga0265330_10000141
478 Ga0265332_10023037
479 Ga0265332_10056425
480 Ga0265320_10065435
481 Ga0265320_10072136
482 Ga0265329_10017272
483 Ga0265340_10222859
484 Ga0265339_10006870
485 Ga0265331_10026666
486 Ga0307513_10849017
487 Ga0265313_10048809
488 Ga0265313_10173475
489 Ga0265314_10015064
490 Ga0265314_10018457
491 Ga0265342_10049004
492 Ga0373934_0200995
493 Ga0373953_0005845
494 Ga0373953_0279676
495 Ga0373954_0006239
496 Ga0373956_0024100
497 Ga0373956_0367715
498 Ga0373957_0021829
499 Ga0373946_0151054
500 Ga0373955_0049785
501 Ga0373955_0321833
502 Ga0373961_0276280
503 Ga0373931_0119154
504 Ga0373935_0598682
505 Ga0373935_0882725
506 Ga0373933_0000577
507 Ga0373933_0038636
508 Ga0373933_0349737
509 Ga0373933_0429274
510 Ga0373937_0016507
511 Ga0373937_0028339
512 Ga0373937_0028412
513 Ga0373937_0102285
514 Ga0373937_0238731
515 Ga0373937_0296165
516 Ga0373937_0456693
517 Ga0373925_0965655
518 Ga0451807_0958571
519 Ga0451807_2569375
520 Ga0451577_0054331
521 Ga0453684_0356576
522 Ga0451576_0321895
523 Ga0451576_1886747
524 Ga0495662_0153515
525 Ga0495652_0284604
526 Ga0495640_0094614
527 Ga0495587_0136173
528 Ga0495657_0503119
529 Ga0495680_0115296
530 Ga0495684_0246698
531 Ga0496104_0032988
532 Ga0496104_0319264
533 Ga0496107_0687410
534 Ga0496108_0492050
535 Ga0496109_0250813
536 Ga0496114_0104329
537 Ga0496114_0283787
538 Ga0501069_0539641
539 Ga0501070_1171400
540 Ga0501070_1499410
541 Ga0501072_0886186
542 Ga0501216_014966
543 Ga0501227_019437
544 Ga0501225_0009000
545 Ga0501080_0326570
546 Ga0501080_1038354
547 nmdc:mga09592_1607004_c1
548 nmdc:mga08y16_4107_c1
549 nmdc:mga08y16_941839_c1
550 Ga0495601_0259562
551 Ga0495595_0046528
552 Ga0495595_0061788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3frh-assembly1.cif.gz_A structure of the 16s rrna methylase rmtb, p21 0.6176 13 44
3ax2-assembly3.cif.gz_E crystal structure of rat tom20-aldh presequence complex: a disulfide-tethered complex with a non-optimized, long linker 0.5138 3 43
6vfi-assembly1.cif.gz_A de novo designed octahedral nanoparticle o43_dn18 0.4984 32 63
2pmr-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function from methanobacterium thermoautotrophicum 0.4942 1 53
4d3d-assembly1.cif.gz_B structure of imine reductase bcsired from bacillus cereus bag3x2 0.4897 24 60
ID Description Score Start End Superfamily
af_Q9H270_63_408_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7397 23 53 2.130.10.10
1zkrB00 Mainly Alpha;Up-down Bundle;Histone Acetyltransferase; Chain A; 0.6515 1 64 1.20.920.50
1zkrB00 Mainly Alpha;Up-down Bundle;Histone Acetyltransferase; Chain A; 0.6439 1 64 1.20.920.50
af_Q0J981_219_275_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6239 4 60 1.10.10.10
af_A0A367GL20_423_520_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6038 24 55 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A838EWD3-F1-model_v4 Uncharacterized protein 0.9509 1 60
AF-A0A562PYM2-F1-model_v4 Uncharacterized protein 0.9415 11 57
AF-A0A495TXH7-F1-model_v4 deleted 0.9355 11 56
AF-A0A2G6M033-F1-model_v4 Uncharacterized protein 0.9256 11 57
AF-A0A0A2EVH4-F1-model_v4 Uncharacterized protein 0.9217 11 58

Map