F381077

General Info

Members Datasets Scaffolds Average Seq Length
276 99 550 330

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10102931|Ga0114129_101029314
Length 363
Sequence VSKGKNFCSNILRLEGGLLPPAIDKQNVAPPTMKTLLRLFAIVLTLQGYGTIADAQQPKKVPRIGYLSSVDAASEAARSEAIRLALRELGYIEGQNIAIEYRYGEGRGDRAPALAAELVRLKVDIIVVGAGVSWIRAAKNATKTIPIVMVGTGADPVEAGLVESLARPGGNVTGITNLSGELGGKRLELLKEAVPKVARIAVLYNPANTGSVREVKEVLPVAARALGLTVRSSEVRAADGFEKVFAALNKERPDGLYVPPSGPLMFANRKRIAGFALKSRLPSMYNTREAVDAGGLMYYGADLADSYRRVATYVDRILKGAKPADLPVEQPSKFELFINLKTAKQIGVTIPQSMLYRADKVIK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
60 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
76 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
77 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
78 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
79 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
80 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
81 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
82 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
83 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
84 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
85 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
86 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
93 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
94 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
95 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
96 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
97 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
98 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 15.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10102931 3300009147 Bacteria 3949
2 JGI25405J52794_10002909 3300003911 Bacteria 2981
3 JGI25405J52794_10007545 3300003911 Bacteria 2008
4 Ga0065712_10077438 3300005290 Unclassified 3496
5 Ga0065715_10001135 3300005293 Bacteria 6997
6 Ga0065715_10144597 3300005293 Bacteria 1803
7 Ga0065707_10119382 3300005295 Bacteria 2159
8 Ga0070676_10023688 3300005328 Bacteria 3452
9 Ga0070670_100000766 3300005331 Bacteria 24964
10 Ga0070660_100018902 3300005339 Bacteria 5043
11 Ga0070660_100250055 3300005339 Bacteria 1445
12 Ga0070689_100358732 3300005340 Bacteria 1224
13 Ga0070661_100248610 3300005344 Bacteria 1371
14 Ga0070669_100068293 3300005353 Bacteria 2623
15 Ga0070673_100034324 3300005364 Bacteria 3838
16 Ga0070673_100082502 3300005364 Unclassified 2610
17 Ga0070659_100247954 3300005366 Unclassified 1475
18 Ga0070667_100109761 3300005367 Bacteria 2391
19 Ga0070667_100229333 3300005367 Unclassified 1655
20 Ga0070711_100106762 3300005439 Bacteria 2048
21 Ga0070711_100139098 3300005439 Bacteria 1818
22 Ga0070663_100245974 3300005455 Bacteria 1414
23 Ga0070681_10002977 3300005458 Bacteria 15719
24 Ga0070681_10027664 3300005458 Bacteria 5700
25 Ga0070679_100038796 3300005530 Bacteria 4736
26 Ga0070679_100052331 3300005530 Unclassified 4068
27 Ga0070697_100197089 3300005536 Bacteria 1711
28 Ga0070672_100094052 3300005543 Bacteria 2422
29 Ga0070664_100001722 3300005564 Bacteria 17531
30 Ga0070664_100032482 3300005564 Bacteria 4367
31 Ga0081455_10000084 3300005937 Bacteria 101753
32 Ga0081455_10007948 3300005937 Bacteria 11096
33 Ga0081455_10043839 3300005937 Bacteria 3910
34 Ga0081455_10112358 3300005937 Bacteria 2162
35 Ga0081538_10015110 3300005981 Bacteria 5997
36 Ga0081538_10099591 3300005981 Bacteria 1468
37 Ga0075432_10027838 3300006058 Bacteria 1948
38 Ga0070716_100173183 3300006173 Bacteria 1410
39 Ga0070712_100198375 3300006175 Bacteria 1575
40 Ga0075428_100019928 3300006844 Bacteria 7428
41 Ga0075428_100032681 3300006844 Bacteria 5746
42 Ga0075428_100069736 3300006844 Bacteria 3843
43 Ga0075428_100167475 3300006844 Bacteria 2383
44 Ga0075428_100256237 3300006844 Bacteria 1885
45 Ga0075428_100308357 3300006844 Bacteria 1701
46 Ga0075428_100323025 3300006844 Bacteria 1658
47 Ga0075428_100398905 3300006844 Bacteria 1474
48 Ga0075430_100135877 3300006846 Bacteria 2049
49 Ga0075430_100139117 3300006846 Bacteria 2022
50 Ga0075430_100382161 3300006846 Bacteria 1162
51 Ga0075431_100097398 3300006847 Bacteria 3037
52 Ga0075431_100115934 3300006847 Bacteria 2765
53 Ga0075431_100184737 3300006847 Bacteria 2138
54 Ga0075431_100224143 3300006847 Bacteria 1917
55 Ga0075431_100272074 3300006847 Bacteria 1716
56 Ga0075431_100402617 3300006847 Bacteria 1369
57 Ga0075431_100493260 3300006847 Bacteria 1216
58 Ga0075433_10022992 3300006852 Bacteria 5242
59 Ga0075433_10030069 3300006852 Unclassified 4632
60 Ga0075433_10035969 3300006852 Bacteria 4262
61 Ga0075433_10085267 3300006852 Unclassified 2788
62 Ga0075433_10111984 3300006852 Unclassified 2421
63 Ga0075433_10124426 3300006852 Bacteria 2290
64 Ga0075433_10182285 3300006852 Bacteria 1868
65 Ga0075433_10206962 3300006852 Bacteria 1744
66 Ga0075433_10220249 3300006852 Bacteria 1686
67 Ga0075433_10240692 3300006852 Bacteria 1606
68 Ga0075433_10249365 3300006852 Bacteria 1575
69 Ga0075433_10261714 3300006852 Bacteria 1533
70 Ga0075434_100020971 3300006871 Bacteria 6347
71 Ga0075434_100037868 3300006871 Bacteria 4775
72 Ga0075434_100056721 3300006871 Bacteria 3893
73 Ga0075434_100113110 3300006871 Unclassified 2726
74 Ga0075434_100129546 3300006871 Bacteria 2541
75 Ga0075434_100193329 3300006871 Bacteria 2055
76 Ga0075434_100228881 3300006871 Bacteria 1878
77 Ga0075434_100269685 3300006871 Bacteria 1721
78 Ga0075434_100370740 3300006871 Bacteria 1453
79 Ga0075434_100390038 3300006871 Bacteria 1413
80 Ga0075429_100051271 3300006880 Bacteria 3591
81 Ga0075429_100065782 3300006880 Unclassified 3156
82 Ga0075429_100076497 3300006880 Unclassified 2915
83 Ga0075429_100117404 3300006880 Bacteria 2325
84 Ga0075429_100149566 3300006880 Bacteria 2044
85 Ga0075436_100062386 3300006914 Unclassified 2575
86 Ga0075435_100014355 3300007076 Bacteria 5917
87 Ga0075435_100029575 3300007076 Bacteria 4300
88 Ga0075435_100053943 3300007076 Bacteria 3243
89 Ga0075435_100099733 3300007076 Bacteria 2405
90 Ga0075435_100299765 3300007076 Bacteria 1374
91 Ga0111539_10043540 3300009094 Bacteria 5381
92 Ga0111539_10688001 3300009094 Bacteria 1190
93 Ga0114129_10009187 3300009147 Bacteria 14093
94 Ga0114129_10030409 3300009147 Bacteria 7641
95 Ga0114129_10062122 3300009147 Bacteria 5219
96 Ga0114129_10093467 3300009147 Bacteria 4166
97 Ga0114129_10107157 3300009147 Unclassified 3860
98 Ga0114129_10147463 3300009147 Bacteria 3222
99 Ga0114129_10160571 3300009147 Bacteria 3070
100 Ga0114129_10172709 3300009147 Unclassified 2945
101 Ga0114129_10180527 3300009147 Bacteria 2872
102 Ga0114129_10342325 3300009147 Unclassified 1983
103 Ga0114129_10382338 3300009147 Bacteria 1859
104 Ga0114129_10418958 3300009147 Bacteria 1762
105 Ga0114129_10480219 3300009147 Bacteria 1626
106 Ga0114129_10486881 3300009147 Bacteria 1613
107 Ga0114129_10529036 3300009147 Bacteria 1536
108 Ga0114129_10554278 3300009147 Bacteria 1494
109 Ga0114129_10590709 3300009147 Bacteria 1440
110 Ga0114129_10685627 3300009147 Bacteria 1318
111 Ga0114129_10710150 3300009147 Bacteria 1291
112 Ga0114129_10866081 3300009147 Bacteria 1147
113 Ga0114129_10915861 3300009147 Bacteria 1110
114 Ga0105241_10076809 3300009174 Unclassified 2605
115 Ga0105246_10006553 3300011119 Bacteria 7108
116 Ga0157378_10117443 3300013297 Bacteria 2447
117 Ga0157378_10198095 3300013297 Bacteria 1898
118 Ga0157378_10359574 3300013297 Bacteria 1424
119 Ga0157378_10691426 3300013297 Unclassified 1039
120 Ga0163162_10718489 3300013306 Bacteria 1120
121 Ga0207645_10082176 3300025907 Bacteria 2065
122 Ga0207654_10120346 3300025911 Unclassified 1647
123 Ga0207707_10004013 3300025912 Bacteria 13065
124 Ga0207707_10011244 3300025912 Bacteria 7789
125 Ga0207707_10071177 3300025912 Unclassified 3030
126 Ga0207663_10088548 3300025916 Bacteria 2048
127 Ga0207657_10189400 3300025919 Unclassified 1660
128 Ga0207652_10013761 3300025921 Bacteria 6542
129 Ga0207652_10294364 3300025921 Unclassified 1465
130 Ga0207681_10134216 3300025923 Bacteria 1834
131 Ga0207650_10003347 3300025925 Bacteria 11029
132 Ga0207659_10254540 3300025926 Unclassified 1426
133 Ga0207690_10022237 3300025932 Bacteria 3942
134 Ga0207690_10115831 3300025932 Unclassified 1937
135 Ga0207706_10034913 3300025933 Bacteria 4473
136 Ga0207670_10429131 3300025936 Bacteria 1062
137 Ga0207691_10244846 3300025940 Bacteria 1549
138 Ga0207679_10009472 3300025945 Bacteria 6241
139 Ga0207679_10261054 3300025945 Bacteria 1477
140 Ga0207651_10111501 3300025960 Unclassified 2054
141 Ga0207678_10230916 3300026067 Bacteria 1584
142 Ga0209983_1009078 3300027665 Bacteria 2032
143 Ga0209974_10006848 3300027876 Bacteria 3955
144 Ga0207428_10275423 3300027907 Bacteria 1250
145 Ga0373960_0044744 3300035121 Bacteria 1294
146 Ga0373942_0051108 3300035207 Bacteria 1159
147 Ga0373931_0006370 3300035691 Bacteria 5511
148 Ga0373931_0010620 3300035691 Bacteria 4428
149 Ga0373931_0031119 3300035691 Bacteria 2752
150 Ga0373931_0070534 3300035691 Unclassified 1907
151 Ga0373935_0194850 3300035692 Bacteria 1397
152 Ga0373927_0089337 3300035695 Bacteria 2001
153 Ga0453684_0108291 3300044712 Bacteria 3382
154 Ga0453684_0147073 3300044712 Bacteria 2805
155 Ga0453684_0417998 3300044712 Bacteria 1498
156 Ga0451576_0085994 3300045051 Bacteria 3271
157 Ga0451576_0118412 3300045051 Bacteria 2757
158 Ga0451576_0225456 3300045051 Bacteria 1957
159 Ga0451576_0248059 3300045051 Bacteria 1861
160 Ga0495580_0011153 3300046472 Bacteria 6962
161 Ga0495613_0181784 3300046689 Bacteria 1489
162 Ga0501033_0079664 3300049570 Bacteria 2403
163 Ga0501037_0106805 3300049573 Unclassified 2017
164 Ga0501039_0351380 3300049575 Bacteria 1158
165 Ga0501040_0005464 3300049576 Bacteria 8221
166 Ga0501040_0059464 3300049576 Bacteria 2625
167 Ga0501042_0004671 3300049578 Bacteria 8738
168 Ga0501046_0030341 3300049580 Bacteria 4388
169 Ga0501048_0017741 3300049582 Bacteria 5238
170 Ga0501048_0179584 3300049582 Bacteria 1500
171 Ga0501068_0202355 3300049584 Bacteria 1259
172 Ga0501070_0036219 3300049586 Bacteria 4121
173 Ga0501071_0031330 3300049587 Unclassified 3768
174 Ga0501072_0064090 3300049588 Bacteria 2898
175 Ga0501072_0261637 3300049588 Bacteria 1377
176 Ga0501075_0041036 3300049591 Unclassified 3467
177 Ga0501075_0274279 3300049591 Bacteria 1285
178 Ga0501076_0014240 3300049592 Bacteria 5986
179 Ga0501076_0032650 3300049592 Bacteria 4063
180 Ga0501076_0197758 3300049592 Bacteria 1641
181 Ga0501076_0272817 3300049592 Bacteria 1385
182 Ga0501076_0292513 3300049592 Bacteria 1335
183 Ga0501077_0015115 3300049593 Unclassified 4854
184 Ga0501077_0022461 3300049593 Bacteria 3996
185 Ga0501079_0048510 3300049741 Bacteria 3277
186 Ga0501079_0070415 3300049741 Bacteria 2701
187 Ga0501079_0266136 3300049741 Bacteria 1340
188 Ga0501080_0119648 3300049742 Bacteria 2441
189 Ga0501081_0000591 3300049743 Bacteria 20649
190 Ga0501081_0024318 3300049743 Unclassified 4067
191 Ga0501081_0052809 3300049743 Bacteria 2805
192 Ga0501083_0061489 3300049744 Bacteria 2507
193 Ga0501035_0296092 3300049822 Bacteria 1364
194 Ga0501044_0207142 3300049823 Bacteria 1917
195 Ga0501045_0034537 3300049824 Bacteria 3670
196 nmdc:mga05p37_102086_c1 3300050507 Bacteria 3532
197 nmdc:mga05p37_110290_c1 3300050507 Unclassified 3385
198 nmdc:mga05p37_122066_c1 3300050507 Bacteria 3200
199 nmdc:mga05p37_126967_c1 3300050507 Bacteria 3132
200 nmdc:mga05p37_139573_c1 3300050507 Bacteria 2970
201 nmdc:mga05p37_142241_c1 3300050507 Unclassified 2939
202 nmdc:mga05p37_169583_c1 3300050507 Bacteria 2663
203 nmdc:mga05p37_181905_c1 3300050507 Bacteria 2557
204 nmdc:mga05p37_243242_c1 3300050507 Unclassified 2162
205 nmdc:mga05p37_244055_c1 3300050507 Bacteria 2158
206 nmdc:mga05p37_25823_c2 3300050507 Bacteria 5794
207 nmdc:mga05p37_28770_c1 3300050507 Bacteria 6780
208 nmdc:mga05p37_295244_c1 3300050507 Bacteria 1928
209 nmdc:mga05p37_379961_c1 3300050507 Bacteria 1656
210 nmdc:mga05p37_40323_c1 3300050507 Bacteria 5733
211 nmdc:mga05p37_4175_c1 3300050507 Bacteria 16874
212 nmdc:mga05p37_459984_c1 3300050507 Bacteria 1471
213 nmdc:mga05p37_462977_c1 3300050507 Bacteria 1465
214 nmdc:mga05p37_501588_c1 3300050507 Bacteria 1393
215 nmdc:mga05p37_511437_c1 3300050507 Bacteria 1376
216 nmdc:mga05p37_513168_c1 3300050507 Unclassified 1373
217 nmdc:mga05p37_565722_c1 3300050507 Unclassified 1291
218 nmdc:mga05p37_588425_c1 3300050507 Bacteria 1259
219 nmdc:mga05p37_65738_c1 3300050507 Bacteria 4462
220 nmdc:mga05p37_92164_c1 3300050507 Unclassified 3734
221 nmdc:mga09592_17926_c1 3300050508 Bacteria 5801
222 nmdc:mga09592_21814_c1 3300050508 Bacteria 5281
223 nmdc:mga09592_31338_c1 3300050508 Bacteria 3718
224 nmdc:mga09592_317402_c1 3300050508 Bacteria 1350
225 nmdc:mga09592_378384_c1 3300050508 Bacteria 1224
226 nmdc:mga09592_6321_c1 3300050508 Bacteria 9654
227 nmdc:mga09592_68874_c1 3300050508 Bacteria 3002
228 nmdc:mga0qj67_27622_c1 3300050509 Unclassified 4400
229 nmdc:mga0qj67_83234_c1 3300050509 Unclassified 2565
230 nmdc:mga06r32_104730_c1 3300050510 Bacteria 2779
231 nmdc:mga06r32_135486_c1 3300050510 Bacteria 2437
232 nmdc:mga06r32_157226_c1 3300050510 Bacteria 2255
233 nmdc:mga06r32_223374_c1 3300050510 Bacteria 1872
234 nmdc:mga06r32_255295_c1 3300050510 Bacteria 1741
235 nmdc:mga06r32_264644_c1 3300050510 Bacteria 1707
236 nmdc:mga06r32_327671_c1 3300050510 Bacteria 1517
237 nmdc:mga06r32_462411_c1 3300050510 Bacteria 1248
238 nmdc:mga06r32_485536_c1 3300050510 Bacteria 1213
239 nmdc:mga08y16_22511_c1 3300050511 Bacteria 6653
240 nmdc:mga08y16_334643_c1 3300050511 Bacteria 1557
241 nmdc:mga08y16_367587_c1 3300050511 Bacteria 1476
242 nmdc:mga08y16_66188_c1 3300050511 Bacteria 3771
243 nmdc:mga0n895_135324_c1 3300050512 Bacteria 2491
244 nmdc:mga0n895_198399_c1 3300050512 Bacteria 2038
245 nmdc:mga0n895_287092_c1 3300050512 Bacteria 1668
246 nmdc:mga0n895_297909_c1 3300050512 Bacteria 1635
247 nmdc:mga0n895_309441_c1 3300050512 Bacteria 1601
248 nmdc:mga0n895_312034_c1 3300050512 Bacteria 1594
249 nmdc:mga0n895_389521_c1 3300050512 Bacteria 1410
250 nmdc:mga0n895_40645_c1 3300050512 Bacteria 4518
251 nmdc:mga0n895_436675_c1 3300050512 Bacteria 1323
252 nmdc:mga0n895_470617_c1 3300050512 Bacteria 1268
253 nmdc:mga0n895_67702_c1 3300050512 Bacteria 3537
254 nmdc:mga0rr50_135545_c1 3300050513 Bacteria 1976
255 nmdc:mga0rr50_309988_c1 3300050513 Bacteria 1322
256 nmdc:mga08x19_109531_c1 3300050514 Unclassified 1841
257 nmdc:mga0a205_104823_c1 3300050515 Unclassified 2727
258 nmdc:mga0a205_109278_c1 3300050515 Bacteria 2664
259 nmdc:mga0a205_11223_c1 3300050515 Bacteria 8244
260 nmdc:mga0a205_122140_c1 3300050515 Unclassified 2504
261 nmdc:mga0a205_168951_c1 3300050515 Bacteria 2083
262 nmdc:mga0a205_173580_c1 3300050515 Bacteria 2052
263 nmdc:mga0a205_19214_c1 3300050515 Bacteria 6440
264 nmdc:mga0a205_24409_c1 3300050515 Bacteria 5749
265 nmdc:mga0a205_27573_c1 3300050515 Bacteria 5425
266 nmdc:mga0a205_63692_c1 3300050515 Bacteria 3562
267 nmdc:mga0a205_70689_c1 3300050515 Bacteria 3370
268 nmdc:mga0a205_89195_c1 3300050515 Bacteria 2981
269 Ga0501084_0168496 3300054114 Unclassified 1849
270 Ga0501084_0424291 3300054114 Bacteria 1124
271 Ga0530510_0002804 3300061734 Bacteria 11983
272 Ga0530510_0048416 3300061734 Bacteria 3072
273 Ga0530510_0158463 3300061734 Bacteria 1674
274 Ga0530510_0166225 3300061734 Unclassified 1633
275 Ga0530510_0166342 3300061734 Bacteria 1632
276 Ga0114129_10102931
277 JGI25405J52794_10002909
278 JGI25405J52794_10007545
279 Ga0065712_10077438
280 Ga0065715_10001135
281 Ga0065715_10144597
282 Ga0065707_10119382
283 Ga0070676_10023688
284 Ga0070670_100000766
285 Ga0070660_100018902
286 Ga0070660_100250055
287 Ga0070689_100358732
288 Ga0070661_100248610
289 Ga0070669_100068293
290 Ga0070673_100034324
291 Ga0070673_100082502
292 Ga0070659_100247954
293 Ga0070667_100109761
294 Ga0070667_100229333
295 Ga0070711_100106762
296 Ga0070711_100139098
297 Ga0070663_100245974
298 Ga0070681_10002977
299 Ga0070681_10027664
300 Ga0070679_100038796
301 Ga0070679_100052331
302 Ga0070697_100197089
303 Ga0070672_100094052
304 Ga0070664_100001722
305 Ga0070664_100032482
306 Ga0081455_10000084
307 Ga0081455_10007948
308 Ga0081455_10043839
309 Ga0081455_10112358
310 Ga0081538_10015110
311 Ga0081538_10099591
312 Ga0075432_10027838
313 Ga0070716_100173183
314 Ga0070712_100198375
315 Ga0075428_100019928
316 Ga0075428_100032681
317 Ga0075428_100069736
318 Ga0075428_100167475
319 Ga0075428_100256237
320 Ga0075428_100308357
321 Ga0075428_100323025
322 Ga0075428_100398905
323 Ga0075430_100135877
324 Ga0075430_100139117
325 Ga0075430_100382161
326 Ga0075431_100097398
327 Ga0075431_100115934
328 Ga0075431_100184737
329 Ga0075431_100224143
330 Ga0075431_100272074
331 Ga0075431_100402617
332 Ga0075431_100493260
333 Ga0075433_10022992
334 Ga0075433_10030069
335 Ga0075433_10035969
336 Ga0075433_10085267
337 Ga0075433_10111984
338 Ga0075433_10124426
339 Ga0075433_10182285
340 Ga0075433_10206962
341 Ga0075433_10220249
342 Ga0075433_10240692
343 Ga0075433_10249365
344 Ga0075433_10261714
345 Ga0075434_100020971
346 Ga0075434_100037868
347 Ga0075434_100056721
348 Ga0075434_100113110
349 Ga0075434_100129546
350 Ga0075434_100193329
351 Ga0075434_100228881
352 Ga0075434_100269685
353 Ga0075434_100370740
354 Ga0075434_100390038
355 Ga0075429_100051271
356 Ga0075429_100065782
357 Ga0075429_100076497
358 Ga0075429_100117404
359 Ga0075429_100149566
360 Ga0075436_100062386
361 Ga0075435_100014355
362 Ga0075435_100029575
363 Ga0075435_100053943
364 Ga0075435_100099733
365 Ga0075435_100299765
366 Ga0111539_10043540
367 Ga0111539_10688001
368 Ga0114129_10009187
369 Ga0114129_10030409
370 Ga0114129_10062122
371 Ga0114129_10093467
372 Ga0114129_10107157
373 Ga0114129_10147463
374 Ga0114129_10160571
375 Ga0114129_10172709
376 Ga0114129_10180527
377 Ga0114129_10342325
378 Ga0114129_10382338
379 Ga0114129_10418958
380 Ga0114129_10480219
381 Ga0114129_10486881
382 Ga0114129_10529036
383 Ga0114129_10554278
384 Ga0114129_10590709
385 Ga0114129_10685627
386 Ga0114129_10710150
387 Ga0114129_10866081
388 Ga0114129_10915861
389 Ga0105241_10076809
390 Ga0105246_10006553
391 Ga0157378_10117443
392 Ga0157378_10198095
393 Ga0157378_10359574
394 Ga0157378_10691426
395 Ga0163162_10718489
396 Ga0207645_10082176
397 Ga0207654_10120346
398 Ga0207707_10004013
399 Ga0207707_10011244
400 Ga0207707_10071177
401 Ga0207663_10088548
402 Ga0207657_10189400
403 Ga0207652_10013761
404 Ga0207652_10294364
405 Ga0207681_10134216
406 Ga0207650_10003347
407 Ga0207659_10254540
408 Ga0207690_10022237
409 Ga0207690_10115831
410 Ga0207706_10034913
411 Ga0207670_10429131
412 Ga0207691_10244846
413 Ga0207679_10009472
414 Ga0207679_10261054
415 Ga0207651_10111501
416 Ga0207678_10230916
417 Ga0209983_1009078
418 Ga0209974_10006848
419 Ga0207428_10275423
420 Ga0373960_0044744
421 Ga0373942_0051108
422 Ga0373931_0006370
423 Ga0373931_0010620
424 Ga0373931_0031119
425 Ga0373931_0070534
426 Ga0373935_0194850
427 Ga0373927_0089337
428 Ga0453684_0108291
429 Ga0453684_0147073
430 Ga0453684_0417998
431 Ga0451576_0085994
432 Ga0451576_0118412
433 Ga0451576_0225456
434 Ga0451576_0248059
435 Ga0495580_0011153
436 Ga0495613_0181784
437 Ga0501033_0079664
438 Ga0501037_0106805
439 Ga0501039_0351380
440 Ga0501040_0005464
441 Ga0501040_0059464
442 Ga0501042_0004671
443 Ga0501046_0030341
444 Ga0501048_0017741
445 Ga0501048_0179584
446 Ga0501068_0202355
447 Ga0501070_0036219
448 Ga0501071_0031330
449 Ga0501072_0064090
450 Ga0501072_0261637
451 Ga0501075_0041036
452 Ga0501075_0274279
453 Ga0501076_0014240
454 Ga0501076_0032650
455 Ga0501076_0197758
456 Ga0501076_0272817
457 Ga0501076_0292513
458 Ga0501077_0015115
459 Ga0501077_0022461
460 Ga0501079_0048510
461 Ga0501079_0070415
462 Ga0501079_0266136
463 Ga0501080_0119648
464 Ga0501081_0000591
465 Ga0501081_0024318
466 Ga0501081_0052809
467 Ga0501083_0061489
468 Ga0501035_0296092
469 Ga0501044_0207142
470 Ga0501045_0034537
471 nmdc:mga05p37_102086_c1
472 nmdc:mga05p37_110290_c1
473 nmdc:mga05p37_122066_c1
474 nmdc:mga05p37_126967_c1
475 nmdc:mga05p37_139573_c1
476 nmdc:mga05p37_142241_c1
477 nmdc:mga05p37_169583_c1
478 nmdc:mga05p37_181905_c1
479 nmdc:mga05p37_243242_c1
480 nmdc:mga05p37_244055_c1
481 nmdc:mga05p37_25823_c2
482 nmdc:mga05p37_28770_c1
483 nmdc:mga05p37_295244_c1
484 nmdc:mga05p37_379961_c1
485 nmdc:mga05p37_40323_c1
486 nmdc:mga05p37_4175_c1
487 nmdc:mga05p37_459984_c1
488 nmdc:mga05p37_462977_c1
489 nmdc:mga05p37_501588_c1
490 nmdc:mga05p37_511437_c1
491 nmdc:mga05p37_513168_c1
492 nmdc:mga05p37_565722_c1
493 nmdc:mga05p37_588425_c1
494 nmdc:mga05p37_65738_c1
495 nmdc:mga05p37_92164_c1
496 nmdc:mga09592_17926_c1
497 nmdc:mga09592_21814_c1
498 nmdc:mga09592_31338_c1
499 nmdc:mga09592_317402_c1
500 nmdc:mga09592_378384_c1
501 nmdc:mga09592_6321_c1
502 nmdc:mga09592_68874_c1
503 nmdc:mga0qj67_27622_c1
504 nmdc:mga0qj67_83234_c1
505 nmdc:mga06r32_104730_c1
506 nmdc:mga06r32_135486_c1
507 nmdc:mga06r32_157226_c1
508 nmdc:mga06r32_223374_c1
509 nmdc:mga06r32_255295_c1
510 nmdc:mga06r32_264644_c1
511 nmdc:mga06r32_327671_c1
512 nmdc:mga06r32_462411_c1
513 nmdc:mga06r32_485536_c1
514 nmdc:mga08y16_22511_c1
515 nmdc:mga08y16_334643_c1
516 nmdc:mga08y16_367587_c1
517 nmdc:mga08y16_66188_c1
518 nmdc:mga0n895_135324_c1
519 nmdc:mga0n895_198399_c1
520 nmdc:mga0n895_287092_c1
521 nmdc:mga0n895_297909_c1
522 nmdc:mga0n895_309441_c1
523 nmdc:mga0n895_312034_c1
524 nmdc:mga0n895_389521_c1
525 nmdc:mga0n895_40645_c1
526 nmdc:mga0n895_436675_c1
527 nmdc:mga0n895_470617_c1
528 nmdc:mga0n895_67702_c1
529 nmdc:mga0rr50_135545_c1
530 nmdc:mga0rr50_309988_c1
531 nmdc:mga08x19_109531_c1
532 nmdc:mga0a205_104823_c1
533 nmdc:mga0a205_109278_c1
534 nmdc:mga0a205_11223_c1
535 nmdc:mga0a205_122140_c1
536 nmdc:mga0a205_168951_c1
537 nmdc:mga0a205_173580_c1
538 nmdc:mga0a205_19214_c1
539 nmdc:mga0a205_24409_c1
540 nmdc:mga0a205_27573_c1
541 nmdc:mga0a205_63692_c1
542 nmdc:mga0a205_70689_c1
543 nmdc:mga0a205_89195_c1
544 Ga0501084_0168496
545 Ga0501084_0424291
546 Ga0530510_0002804
547 Ga0530510_0048416
548 Ga0530510_0158463
549 Ga0530510_0166225
550 Ga0530510_0166342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

63

362

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9242 28 320
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9198 30 320
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9093 28 320
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8989 30 320
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8919 32 320
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9001 148 320 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8919 148 320 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8832 32 295 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.871 32 295 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8591 148 320 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A536ZNV9-F1-model_v4 ABC transporter substrate-binding protein 0.9821 216 318
AF-A0A537P9Y2-F1-model_v4 ABC transporter substrate-binding protein 0.9732 190 320
AF-A0A536UEW6-F1-model_v4 ABC transporter substrate-binding protein 0.9722 201 301
AF-A0A1F4DFK6-F1-model_v4 ABC transporter substrate-binding protein 0.9672 23 318
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9665 211 318

Map