F381076

General Info

Members Datasets Scaffolds Average Seq Length
276 165 276 384

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10083143|Ga0114129_100831432
Length 451
Sequence MRPRRIDGCNGYALRRSRHLRCSFIMRAPPSAGMSAPGRRQREKAMSGATSHLVKGHVSPGFDAVRKAFADNFARRHELGGACCAYSDGDTVVDLWGGIRNTETGEAWEQDTMVIVYSATKGLAAMTLAIAHSRGWLDYDERVSAYWPEFAQHGKERITVRQLLAHQAGLFALDEPVDRTLVGDLDRLAIVLARQKPAWEPGTRQAYHGITLGYYESELLRRIDPGHRSVGQFFQDEIASPLGVDVYIRLPEDIPSSRLATIARPRTIDMLLGFPLRLTLEAMNPRSKIVRALRGSELPHDPERIYARNFEVPAGGAVGTARGIARAYSVFATGGHELGLRQQTLDLLAAPAIPPTRGFRDECLHGEVQFSLGFMKPSPLWPFGSASSFGSPGAGGXXXXADPDAGVGYAYVTSQMGTRVTGDPRDVALRKALYSALARQKPHAAPERMAS

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
116 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
150 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
151 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.9
Nodule 0
Rhizoplane 0.36
Rhizosphere 96.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006103 3300003203 Bacteria 5565
2 Ga0065714_10084788 3300005288 Bacteria 2180
3 Ga0065704_10007371 3300005289 Bacteria 3995
4 Ga0065712_10089944 3300005290 Bacteria 2445
5 Ga0065707_10000944 3300005295 Bacteria 10277
6 Ga0065707_10013868 3300005295 Bacteria 1785
7 Ga0070683_100074275 3300005329 Bacteria 3175
8 Ga0070690_100159731 3300005330 Bacteria 1543
9 Ga0070670_100004261 3300005331 Bacteria 11965
10 Ga0070670_100005621 3300005331 Bacteria 10577
11 Ga0070677_10020281 3300005333 Bacteria 2419
12 Ga0068869_100093879 3300005334 Bacteria 2261
13 Ga0070680_100010012 3300005336 Bacteria 7304
14 Ga0070689_100000426 3300005340 Bacteria 24842
15 Ga0070661_100069594 3300005344 Bacteria 2588
16 Ga0070669_100000434 3300005353 Bacteria 31964
17 Ga0070675_100002465 3300005354 Bacteria 13839
18 Ga0070675_100006241 3300005354 Bacteria 9146
19 Ga0070675_100022512 3300005354 Bacteria 5036
20 Ga0070675_100054748 3300005354 Bacteria 3283
21 Ga0070675_100133510 3300005354 Unclassified 2117
22 Ga0070671_100039235 3300005355 Bacteria 3931
23 Ga0070673_100012006 3300005364 Bacteria 5932
24 Ga0070673_100031209 3300005364 Bacteria 3997
25 Ga0070673_100064910 3300005364 Bacteria 2910
26 Ga0070667_100334736 3300005367 Bacteria 1368
27 Ga0070713_100020144 3300005436 Bacteria 5108
28 Ga0070701_10002284 3300005438 Bacteria 7345
29 Ga0070700_100039320 3300005441 Bacteria 2889
30 Ga0070700_100124260 3300005441 Bacteria 1733
31 Ga0070700_100170670 3300005441 Unclassified 1506
32 Ga0070694_100004232 3300005444 Bacteria 8632
33 Ga0070678_100022073 3300005456 Unclassified 4208
34 Ga0070678_100034754 3300005456 Bacteria 3513
35 Ga0070662_100029668 3300005457 Bacteria 3819
36 Ga0070681_10025784 3300005458 Bacteria 5911
37 Ga0068867_100020825 3300005459 Bacteria 4676
38 Ga0070698_100270764 3300005471 Bacteria 1630
39 Ga0070699_100013117 3300005518 Bacteria 7143
40 Ga0070679_100011744 3300005530 Bacteria 8347
41 Ga0070684_100030279 3300005535 Bacteria 4597
42 Ga0068853_100045227 3300005539 Bacteria 3770
43 Ga0070672_100015077 3300005543 Bacteria 5494
44 Ga0070672_100042967 3300005543 Bacteria 3482
45 Ga0070672_100057438 3300005543 Bacteria 3055
46 Ga0070686_100003720 3300005544 Bacteria 8384
47 Ga0070704_100001168 3300005549 Bacteria 13704
48 Ga0070704_100012743 3300005549 Bacteria 5201
49 Ga0070704_100067869 3300005549 Bacteria 2577
50 Ga0070664_100013432 3300005564 Bacteria 6670
51 Ga0070664_100014624 3300005564 Bacteria 6405
52 Ga0070664_100033429 3300005564 Bacteria 4307
53 Ga0070664_100040350 3300005564 Bacteria 3934
54 Ga0068857_100003547 3300005577 Bacteria 13045
55 Ga0068857_100006921 3300005577 Bacteria 9759
56 Ga0068859_100000544 3300005617 Bacteria 37370
57 Ga0068859_100015103 3300005617 Bacteria 7752
58 Ga0068859_100016779 3300005617 Bacteria 7353
59 Ga0068864_100000610 3300005618 Bacteria 30198
60 Ga0068864_100005249 3300005618 Bacteria 10618
61 Ga0068861_100002011 3300005719 Bacteria 13159
62 Ga0068861_100018493 3300005719 Bacteria 4965
63 Ga0068861_100122116 3300005719 Bacteria 2103
64 Ga0068861_100172284 3300005719 Unclassified 1795
65 Ga0068870_10000082 3300005840 Bacteria 30914
66 Ga0068870_10006569 3300005840 Bacteria 5134
67 Ga0068870_10123684 3300005840 Bacteria 1493
68 Ga0068863_100202894 3300005841 Bacteria 1908
69 Ga0068858_100129739 3300005842 Bacteria 2363
70 Ga0068860_100005772 3300005843 Bacteria 12473
71 Ga0068862_100000322 3300005844 Bacteria 52031
72 Ga0068862_100051658 3300005844 Bacteria 3516
73 Ga0081539_10001029 3300005985 Bacteria 51437
74 Ga0070717_10019812 3300006028 Bacteria 5281
75 Ga0075365_10026460 3300006038 Bacteria 3684
76 Ga0075364_10037596 3300006051 Bacteria 3135
77 Ga0075367_10045365 3300006178 Unclassified 2579
78 Ga0075366_10005604 3300006195 Bacteria 6811
79 Ga0097621_100045915 3300006237 Unclassified 3531
80 Ga0068871_100004422 3300006358 Bacteria 9773
81 Ga0068871_100292990 3300006358 Bacteria 1426
82 Ga0075428_100000693 3300006844 Bacteria 34771
83 Ga0075428_100010847 3300006844 Bacteria 10128
84 Ga0075428_100026209 3300006844 Bacteria 6455
85 Ga0075428_100062062 3300006844 Bacteria 4092
86 Ga0075428_100238079 3300006844 Bacteria 1964
87 Ga0075431_100004067 3300006847 Bacteria 14262
88 Ga0075433_10005015 3300006852 Bacteria 10370
89 Ga0075433_10017448 3300006852 Bacteria 5945
90 Ga0075434_100007278 3300006871 Bacteria 10238
91 Ga0075434_100012709 3300006871 Bacteria 7987
92 Ga0075429_100113482 3300006880 Bacteria 2368
93 Ga0075429_100171222 3300006880 Bacteria 1902
94 Ga0097620_100000544 3300006931 Bacteria 37370
95 Ga0097620_100015103 3300006931 Bacteria 7752
96 Ga0097620_100016779 3300006931 Bacteria 7353
97 Ga0075435_100088575 3300007076 Bacteria 2552
98 Ga0111539_10000522 3300009094 Bacteria 48538
99 Ga0111539_10002910 3300009094 Bacteria 22714
100 Ga0111539_10010978 3300009094 Bacteria 11402
101 Ga0111539_10012272 3300009094 Bacteria 10743
102 Ga0111539_10483615 3300009094 Unclassified 1442
103 Ga0105245_10265392 3300009098 Unclassified 1672
104 Ga0114129_10004230 3300009147 Bacteria 20287
105 Ga0114129_10051176 3300009147 Bacteria 5800
106 Ga0114129_10083143 3300009147 Bacteria 4448
107 Ga0114129_10160804 3300009147 Unclassified 3068
108 Ga0105248_10052176 3300009177 Unclassified 4589
109 Ga0105248_10060123 3300009177 Bacteria 4266
110 Ga0105248_10089529 3300009177 Bacteria 3464
111 Ga0105237_10049065 3300009545 Bacteria 4244
112 Ga0105238_10132206 3300009551 Bacteria 2474
113 Ga0105249_10011514 3300009553 Bacteria 7772
114 Ga0105249_10026335 3300009553 Bacteria 5239
115 Ga0105249_10298584 3300009553 Bacteria 1615
116 Ga0157369_10018670 3300013105 Bacteria 7774
117 Ga0163162_10069774 3300013306 Bacteria 3566
118 Ga0157372_10021498 3300013307 Bacteria 6971
119 Ga0157375_10001795 3300013308 Bacteria 18406
120 Ga0163163_10237368 3300014325 Unclassified 1873
121 Ga0157380_10004807 3300014326 Bacteria 9416
122 Ga0157380_10006570 3300014326 Bacteria 8199
123 Ga0157377_10007501 3300014745 Bacteria 5270
124 Ga0157377_10015842 3300014745 Bacteria 3865
125 Ga0157377_10029545 3300014745 Bacteria 2960
126 Ga0157376_10062306 3300014969 Unclassified 3138
127 Ga0157376_10073382 3300014969 Unclassified 2914
128 Ga0207688_10130234 3300025901 Bacteria 1474
129 Ga0207643_10000440 3300025908 Bacteria 27191
130 Ga0207643_10020219 3300025908 Unclassified 3652
131 Ga0207707_10014278 3300025912 Bacteria 6919
132 Ga0207660_10009253 3300025917 Bacteria 6377
133 Ga0207662_10004060 3300025918 Bacteria 7639
134 Ga0207662_10052230 3300025918 Bacteria 2432
135 Ga0207652_10069293 3300025921 Bacteria 3062
136 Ga0207681_10000766 3300025923 Bacteria 21118
137 Ga0207681_10071752 3300025923 Bacteria 2416
138 Ga0207650_10005884 3300025925 Bacteria 8369
139 Ga0207650_10010932 3300025925 Bacteria 6239
140 Ga0207650_10240998 3300025925 Unclassified 1461
141 Ga0207659_10003596 3300025926 Bacteria 9331
142 Ga0207659_10003763 3300025926 Bacteria 9146
143 Ga0207659_10043982 3300025926 Bacteria 3141
144 Ga0207659_10068441 3300025926 Bacteria 2582
145 Ga0207659_10128805 3300025926 Bacteria 1950
146 Ga0207700_10015114 3300025928 Bacteria 5079
147 Ga0207706_10046761 3300025933 Bacteria 3831
148 Ga0207706_10171933 3300025933 Bacteria 1904
149 Ga0207670_10002569 3300025936 Bacteria 9546
150 Ga0207669_10006349 3300025937 Bacteria 5394
151 Ga0207704_10012651 3300025938 Bacteria 4193
152 Ga0207691_10026232 3300025940 Bacteria 5468
153 Ga0207691_10048913 3300025940 Bacteria 3875
154 Ga0207691_10051938 3300025940 Bacteria 3745
155 Ga0207691_10304021 3300025940 Bacteria 1370
156 Ga0207711_10071574 3300025941 Bacteria 3009
157 Ga0207689_10036068 3300025942 Bacteria 4106
158 Ga0207661_10023373 3300025944 Bacteria 4669
159 Ga0207661_10115904 3300025944 Bacteria 2274
160 Ga0207679_10002182 3300025945 Bacteria 12111
161 Ga0207679_10012670 3300025945 Bacteria 5504
162 Ga0207679_10058812 3300025945 Bacteria 2850
163 Ga0207651_10032888 3300025960 Bacteria 3337
164 Ga0207651_10076581 3300025960 Unclassified 2392
165 Ga0207712_10012628 3300025961 Bacteria 5397
166 Ga0207712_10016187 3300025961 Bacteria 4822
167 Ga0207712_10191283 3300025961 Bacteria 1615
168 Ga0207678_10007855 3300026067 Bacteria 9413
169 Ga0207708_10060205 3300026075 Bacteria 2899
170 Ga0207708_10075427 3300026075 Bacteria 2586
171 Ga0207708_10167249 3300026075 Bacteria 1739
172 Ga0207641_10066997 3300026088 Bacteria 3075
173 Ga0207648_10031708 3300026089 Bacteria 4671
174 Ga0207648_10241265 3300026089 Bacteria 1609
175 Ga0207676_10015404 3300026095 Bacteria 5514
176 Ga0207676_10100679 3300026095 Bacteria 2395
177 Ga0207675_100004751 3300026118 Bacteria 13080
178 Ga0207675_100014195 3300026118 Bacteria 7428
179 Ga0207675_100093661 3300026118 Unclassified 2826
180 Ga0207675_100142416 3300026118 Bacteria 2278
181 Ga0207675_100185458 3300026118 Bacteria 1994
182 Ga0207683_10016763 3300026121 Bacteria 6236
183 Ga0207683_10023523 3300026121 Bacteria 5301
184 Ga0207683_10035549 3300026121 Unclassified 4334
185 Ga0207683_10328388 3300026121 Bacteria 1402
186 Ga0209974_10019212 3300027876 Bacteria 2265
187 Ga0207428_10000810 3300027907 Bacteria 35372
188 Ga0207428_10003247 3300027907 Bacteria 15845
189 Ga0207428_10046742 3300027907 Bacteria 3479
190 Ga0268265_10001611 3300028380 Bacteria 18614
191 Ga0268264_10097934 3300028381 Bacteria 2543
192 Ga0307416_100011895 3300032002 Bacteria 5837
193 Ga0307416_100064737 3300032002 Bacteria 3001
194 Ga0307416_100113288 3300032002 Bacteria 2396
195 Ga0307416_100130637 3300032002 Bacteria 2260
196 Ga0373953_0000258 3300035117 Bacteria 14391
197 Ga0373954_0001945 3300035118 Bacteria 8563
198 Ga0373956_0000359 3300035119 Bacteria 18534
199 Ga0373955_0002553 3300035172 Bacteria 7968
200 Ga0373935_0020420 3300035692 Bacteria 4048
201 Ga0373935_0193604 3300035692 Unclassified 1402
202 Ga0373933_0060398 3300035724 Bacteria 2285
203 Ga0373925_0182898 3300037068 Bacteria 1660
204 Ga0316581_0029271 3300037588 Bacteria 1654
205 Ga0450908_000845 3300042184 Bacteria 5910
206 Ga0451576_0191741 3300045051 Bacteria 2135
207 Ga0495580_0080048 3300046472 Bacteria 2278
208 Ga0495594_0112062 3300046499 Bacteria 1538
209 Ga0495608_0007600 3300046511 Bacteria 7642
210 Ga0495618_0001773 3300046514 Bacteria 14300
211 Ga0495618_0058333 3300046514 Bacteria 2445
212 Ga0495630_0081028 3300046517 Bacteria 2449
213 Ga0495640_0071102 3300046533 Bacteria 2335
214 Ga0495586_0011427 3300046535 Bacteria 4723
215 Ga0495667_0003968 3300046559 Bacteria 9932
216 Ga0495667_0006628 3300046559 Bacteria 7861
217 Ga0495659_0001087 3300046664 Bacteria 9465
218 Ga0495657_0001377 3300046675 Bacteria 21103
219 Ga0495657_0059104 3300046675 Bacteria 2544
220 Ga0495669_0004041 3300046684 Bacteria 6036
221 Ga0495669_0010825 3300046684 Bacteria 3861
222 Ga0495669_0028247 3300046684 Unclassified 2456
223 Ga0495613_0041853 3300046689 Bacteria 3391
224 Ga0495604_0078197 3300047317 Bacteria 2483
225 Ga0495636_0014150 3300047318 Bacteria 3173
226 Ga0495675_0011476 3300047444 Bacteria 5562
227 Ga0495684_0004274 3300047471 Bacteria 11145
228 Ga0496102_0305498 3300048905 Bacteria 1499
229 Ga0501034_0000065 3300049571 Bacteria 184952
230 Ga0501038_0221806 3300049574 Bacteria 1508
231 Ga0501039_0137736 3300049575 Bacteria 1917
232 Ga0501040_0035625 3300049576 Bacteria 3376
233 Ga0501041_0070462 3300049577 Bacteria 2146
234 Ga0501042_0048115 3300049578 Bacteria 3041
235 Ga0501046_0013075 3300049580 Bacteria 7046
236 Ga0501048_0038588 3300049582 Bacteria 3427
237 Ga0501048_0165616 3300049582 Bacteria 1565
238 Ga0501069_0073545 3300049585 Bacteria 1917
239 Ga0501071_0018643 3300049587 Bacteria 4810
240 Ga0501074_0000261 3300049590 Bacteria 29899
241 Ga0501074_0100293 3300049590 Unclassified 2073
242 Ga0501076_0048256 3300049592 Bacteria 3366
243 Ga0501077_0095517 3300049593 Unclassified 1884
244 Ga0501079_0060577 3300049741 Bacteria 2919
245 Ga0501079_0179656 3300049741 Bacteria 1651
246 Ga0501283_001565 3300049779 Unclassified 2967
247 nmdc:mga03683_12739_c1 3300050489 Bacteria 3078
248 nmdc:mga0yw44_55315_c1 3300050492 Bacteria 2414
249 nmdc:mga0k408_4489_c1 3300050493 Bacteria 7405
250 nmdc:mga06z11_33961_c1 3300050494 Bacteria 2500
251 nmdc:mga05p37_1031_c1 3300050507 Bacteria 31776
252 nmdc:mga05p37_168474_c1 3300050507 Bacteria 2672
253 nmdc:mga05p37_2796_c1 3300050507 Bacteria 20287
254 nmdc:mga09592_125927_c1 3300050508 Unclassified 2202
255 nmdc:mga09592_63585_c1 3300050508 Bacteria 3124
256 nmdc:mga0qj67_113732_c1 3300050509 Bacteria 2186
257 nmdc:mga0qj67_98160_c1 3300050509 Bacteria 2360
258 nmdc:mga06r32_212906_c1 3300050510 Bacteria 1920
259 nmdc:mga08y16_126832_c1 3300050511 Bacteria 2012
260 nmdc:mga08y16_14178_c1 3300050511 Bacteria 8388
261 nmdc:mga08y16_41771_c1 3300050511 Unclassified 4803
262 nmdc:mga08y16_592_c1 3300050511 Bacteria 33756
263 nmdc:mga08y16_6132_c1 3300050511 Bacteria 12604
264 nmdc:mga08y16_8907_c1 3300050511 Bacteria 10537
265 nmdc:mga0n895_2758_c1 3300050512 Bacteria 13875
266 nmdc:mga0n895_6731_c1 3300050512 Bacteria 9801
267 nmdc:mga0rr50_126312_c1 3300050513 Bacteria 2043
268 nmdc:mga0a205_13169_c1 3300050515 Bacteria 7685
269 nmdc:mga0a205_61939_c1 3300050515 Bacteria 3615
270 Ga0495619_0020791 3300053085 Bacteria 4186
271 Ga0501084_0128267 3300054114 Unclassified 2135
272 Ga0501082_0072111 3300060353 Bacteria 2975
273 Ga0501082_0295226 3300060353 Bacteria 1411
274 Ga0530510_0011183 3300061734 Bacteria 6297
275 Ga0530510_0121102 3300061734 Bacteria 1921
276 Ga0530510_0170041 3300061734 Bacteria 1614

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014745 Ga0157377_10015842 Ga0157377_100158421 300
2 3300025933 Ga0207706_10171933 Ga0207706_101719332 339
3 3300035692 Ga0373935_0193604 Ga0373935_0193604_286_1344 340
4 3300046499 Ga0495594_0112062 Ga0495594_0112062_34_1185 355
5 3300009177 Ga0105248_10089529 Ga0105248_100895291 359
6 3300005295 Ga0065707_10013868 Ga0065707_100138682 360
7 3300050511 nmdc:mga08y16_6132_c1 nmdc:mga08y16_6132_c1_1087_2280 360
8 3300005289 Ga0065704_10007371 Ga0065704_100073713 364
9 3300005355 Ga0070671_100039235 Ga0070671_1000392354 365
10 3300005364 Ga0070673_100031209 Ga0070673_1000312092 365
11 3300005564 Ga0070664_100033429 Ga0070664_1000334292 365
12 3300025945 Ga0207679_10058812 Ga0207679_100588122 365
13 3300026067 Ga0207678_10007855 Ga0207678_100078554 365
14 3300026095 Ga0207676_10100679 Ga0207676_101006791 365
15 3300035118 Ga0373954_0001945 Ga0373954_0001945_302_1456 365
16 3300035172 Ga0373955_0002553 Ga0373955_0002553_440_1594 365
17 3300035692 Ga0373935_0020420 Ga0373935_0020420_383_1537 365
18 3300037068 Ga0373925_0182898 Ga0373925_0182898_138_1292 365
19 3300046472 Ga0495580_0080048 Ga0495580_0080048_967_2121 365
20 3300046517 Ga0495630_0081028 Ga0495630_0081028_116_1270 365
21 3300046533 Ga0495640_0071102 Ga0495640_0071102_423_1577 365
22 3300046675 Ga0495657_0059104 Ga0495657_0059104_250_1404 365
23 3300046689 Ga0495613_0041853 Ga0495613_0041853_417_1571 365
24 3300047471 Ga0495684_0004274 Ga0495684_0004274_423_1577 365
25 3300009147 Ga0114129_10004230 Ga0114129_1000423012 366
26 3300026118 Ga0207675_100185458 Ga0207675_1001854581 366
27 3300026121 Ga0207683_10016763 Ga0207683_100167632 366
28 3300037588 Ga0316581_0029271 Ga0316581_0029271_209_1432 366
29 3300046664 Ga0495659_0001087 Ga0495659_0001087_2019_3224 366
30 3300046684 Ga0495669_0010825 Ga0495669_0010825_782_1987 366
31 3300049575 Ga0501039_0137736 Ga0501039_0137736_28_1218 366
32 3300049580 Ga0501046_0013075 Ga0501046_0013075_5838_7028 366
33 3300049593 Ga0501077_0095517 Ga0501077_0095517_368_1558 366
34 3300049741 Ga0501079_0179656 Ga0501079_0179656_171_1361 366
35 3300050507 nmdc:mga05p37_2796_c1 nmdc:mga05p37_2796_c1_16839_18023 366
36 3300060353 Ga0501082_0295226 Ga0501082_0295226_37_1221 366
37 3300005354 Ga0070675_100022512 Ga0070675_1000225123 367
38 3300005364 Ga0070673_100012006 Ga0070673_1000120064 367
39 3300005367 Ga0070667_100334736 Ga0070667_1003347362 367
40 3300005441 Ga0070700_100124260 Ga0070700_1001242602 367
41 3300005543 Ga0070672_100015077 Ga0070672_1000150776 367
42 3300005617 Ga0068859_100015103 Ga0068859_1000151038 367
43 3300005841 Ga0068863_100202894 Ga0068863_1002028942 367
44 3300005842 Ga0068858_100129739 Ga0068858_1001297392 367
45 3300006931 Ga0097620_100015103 Ga0097620_1000151033 367
46 3300025923 Ga0207681_10071752 Ga0207681_100717522 367
47 3300025926 Ga0207659_10043982 Ga0207659_100439823 367
48 3300025940 Ga0207691_10026232 Ga0207691_100262326 367
49 3300025960 Ga0207651_10032888 Ga0207651_100328882 367
50 3300026075 Ga0207708_10167249 Ga0207708_101672492 367
51 3300046684 Ga0495669_0028247 Ga0495669_0028247_107_1342 367
52 3300054114 Ga0501084_0128267 Ga0501084_0128267_502_1692 367
53 3300005340 Ga0070689_100000426 Ga0070689_1000004264 368
54 3300005353 Ga0070669_100000434 Ga0070669_10000043412 368
55 3300005354 Ga0070675_100006241 Ga0070675_1000062416 368
56 3300005364 Ga0070673_100064910 Ga0070673_1000649102 368
57 3300005438 Ga0070701_10002284 Ga0070701_100022844 368
58 3300005441 Ga0070700_100039320 Ga0070700_1000393204 368
59 3300005444 Ga0070694_100004232 Ga0070694_1000042323 368
60 3300005457 Ga0070662_100029668 Ga0070662_1000296682 368
61 3300005459 Ga0068867_100020825 Ga0068867_1000208256 368
62 3300005471 Ga0070698_100270764 Ga0070698_1002707641 368
63 3300005518 Ga0070699_100013117 Ga0070699_1000131174 368
64 3300005543 Ga0070672_100042967 Ga0070672_1000429671 368
65 3300005544 Ga0070686_100003720 Ga0070686_1000037203 368
66 3300005549 Ga0070704_100001168 Ga0070704_1000011683 368
67 3300005577 Ga0068857_100003547 Ga0068857_10000354711 368
68 3300005617 Ga0068859_100000544 Ga0068859_10000054424 368
69 3300005618 Ga0068864_100005249 Ga0068864_1000052496 368
70 3300005719 Ga0068861_100002011 Ga0068861_10000201111 368
71 3300005840 Ga0068870_10000082 Ga0068870_1000008217 368
72 3300005844 Ga0068862_100000322 Ga0068862_10000032229 368
73 3300006844 Ga0075428_100238079 Ga0075428_1002380793 368
74 3300006931 Ga0097620_100000544 Ga0097620_10000054416 368
75 3300009094 Ga0111539_10000522 Ga0111539_1000052223 368
76 3300009553 Ga0105249_10026335 Ga0105249_100263357 368
77 3300013308 Ga0157375_10001795 Ga0157375_1000179514 368
78 3300014745 Ga0157377_10007501 Ga0157377_100075013 368
79 3300025901 Ga0207688_10130234 Ga0207688_101302341 368
80 3300025908 Ga0207643_10000440 Ga0207643_100004409 368
81 3300025918 Ga0207662_10004060 Ga0207662_100040605 368
82 3300025923 Ga0207681_10000766 Ga0207681_1000076610 368
83 3300025926 Ga0207659_10003763 Ga0207659_100037637 368
84 3300025933 Ga0207706_10046761 Ga0207706_100467616 368
85 3300025936 Ga0207670_10002569 Ga0207670_100025699 368
86 3300025938 Ga0207704_10012651 Ga0207704_100126511 368
87 3300025940 Ga0207691_10051938 Ga0207691_100519382 368
88 3300025961 Ga0207712_10016187 Ga0207712_100161872 368
89 3300026075 Ga0207708_10060205 Ga0207708_100602054 368
90 3300026089 Ga0207648_10031708 Ga0207648_100317087 368
91 3300026095 Ga0207676_10015404 Ga0207676_100154046 368
92 3300026118 Ga0207675_100004751 Ga0207675_10000475111 368
93 3300027907 Ga0207428_10000810 Ga0207428_1000081010 368
94 3300028380 Ga0268265_10001611 Ga0268265_100016113 368
95 3300046511 Ga0495608_0007600 Ga0495608_0007600_2965_4194 368
96 3300046559 Ga0495667_0006628 Ga0495667_0006628_6489_7718 368
97 3300046675 Ga0495657_0001377 Ga0495657_0001377_9644_10873 368
98 3300047444 Ga0495675_0011476 Ga0495675_0011476_3877_5106 368
99 3300050509 nmdc:mga0qj67_98160_c1 nmdc:mga0qj67_98160_c1_666_1889 368
100 3300050511 nmdc:mga08y16_592_c1 nmdc:mga08y16_592_c1_7360_8562 368
101 3300061734 Ga0530510_0170041 Ga0530510_0170041_189_1364 368
102 3300005290 Ga0065712_10089944 Ga0065712_100899442 369
103 3300005331 Ga0070670_100005621 Ga0070670_1000056215 369
104 3300005564 Ga0070664_100040350 Ga0070664_1000403506 369
105 3300005618 Ga0068864_100000610 Ga0068864_10000061022 369
106 3300006852 Ga0075433_10005015 Ga0075433_100050154 369
107 3300006871 Ga0075434_100007278 Ga0075434_1000072787 369
108 3300007076 Ga0075435_100088575 Ga0075435_1000885752 369
109 3300025925 Ga0207650_10005884 Ga0207650_100058845 369
110 3300025945 Ga0207679_10002182 Ga0207679_100021824 369
111 3300028381 Ga0268264_10097934 Ga0268264_100979343 369
112 3300050512 nmdc:mga0n895_2758_c1 nmdc:mga0n895_2758_c1_11670_12869 369
113 3300050513 nmdc:mga0rr50_126312_c1 nmdc:mga0rr50_126312_c1_485_1684 369
114 3300050515 nmdc:mga0a205_61939_c1 nmdc:mga0a205_61939_c1_2168_3367 369
115 3300006844 Ga0075428_100000693 Ga0075428_10000069327 371
116 3300006847 Ga0075431_100004067 Ga0075431_1000040678 371
117 3300009147 Ga0114129_10051176 Ga0114129_100511764 371
118 3300035117 Ga0373953_0000258 Ga0373953_0000258_327_1517 371
119 3300035119 Ga0373956_0000359 Ga0373956_0000359_371_1561 371
120 3300035724 Ga0373933_0060398 Ga0373933_0060398_782_1972 371
121 3300046514 Ga0495618_0001773 Ga0495618_0001773_546_1736 371
122 3300046535 Ga0495586_0011427 Ga0495586_0011427_3351_4541 371
123 3300046559 Ga0495667_0003968 Ga0495667_0003968_17_1207 371
124 3300047317 Ga0495604_0078197 Ga0495604_0078197_294_1484 371
125 3300050507 nmdc:mga05p37_1031_c1 nmdc:mga05p37_1031_c1_17442_18662 371
126 3300005288 Ga0065714_10084788 Ga0065714_100847882 372
127 3300005330 Ga0070690_100159731 Ga0070690_1001597311 372
128 3300005334 Ga0068869_100093879 Ga0068869_1000938792 372
129 3300009177 Ga0105248_10052176 Ga0105248_100521764 372
130 3300014325 Ga0163163_10237368 Ga0163163_102373681 372
131 3300025942 Ga0207689_10036068 Ga0207689_100360683 372
132 3300005329 Ga0070683_100074275 Ga0070683_1000742752 373
133 3300005331 Ga0070670_100004261 Ga0070670_1000042618 373
134 3300005336 Ga0070680_100010012 Ga0070680_1000100123 373
135 3300005344 Ga0070661_100069594 Ga0070661_1000695942 373
136 3300005458 Ga0070681_10025784 Ga0070681_100257842 373
137 3300005530 Ga0070679_100011744 Ga0070679_1000117444 373
138 3300005535 Ga0070684_100030279 Ga0070684_1000302792 373
139 3300005539 Ga0068853_100045227 Ga0068853_1000452272 373
140 3300005564 Ga0070664_100013432 Ga0070664_1000134325 373
141 3300005719 Ga0068861_100122116 Ga0068861_1001221162 373
142 3300005840 Ga0068870_10006569 Ga0068870_100065692 373
143 3300009545 Ga0105237_10049065 Ga0105237_100490653 373
144 3300009551 Ga0105238_10132206 Ga0105238_101322062 373
145 3300013105 Ga0157369_10018670 Ga0157369_100186703 373
146 3300013307 Ga0157372_10021498 Ga0157372_100214983 373
147 3300025908 Ga0207643_10020219 Ga0207643_100202193 373
148 3300025912 Ga0207707_10014278 Ga0207707_100142786 373
149 3300025917 Ga0207660_10009253 Ga0207660_100092535 373
150 3300025921 Ga0207652_10069293 Ga0207652_100692932 373
151 3300025925 Ga0207650_10010932 Ga0207650_100109323 373
152 3300025944 Ga0207661_10023373 Ga0207661_100233734 373
153 3300025945 Ga0207679_10012670 Ga0207679_100126704 373
154 3300026118 Ga0207675_100142416 Ga0207675_1001424162 373
155 3300006358 Ga0068871_100004422 Ga0068871_1000044227 374
156 3300013306 Ga0163162_10069774 Ga0163162_100697743 374
157 3300032002 Ga0307416_100113288 Ga0307416_1001132881 374
158 3300005354 Ga0070675_100002465 Ga0070675_10000246510 375
159 3300005441 Ga0070700_100170670 Ga0070700_1001706702 375
160 3300005543 Ga0070672_100057438 Ga0070672_1000574383 375
161 3300005617 Ga0068859_100016779 Ga0068859_10001677910 375
162 3300005843 Ga0068860_100005772 Ga0068860_1000057729 375
163 3300006358 Ga0068871_100292990 Ga0068871_1002929902 375
164 3300006931 Ga0097620_100016779 Ga0097620_10001677910 375
165 3300009094 Ga0111539_10012272 Ga0111539_100122723 375
166 3300009177 Ga0105248_10060123 Ga0105248_100601232 375
167 3300014745 Ga0157377_10029545 Ga0157377_100295453 375
168 3300025940 Ga0207691_10048913 Ga0207691_100489132 375
169 3300025941 Ga0207711_10071574 Ga0207711_100715743 375
170 3300025960 Ga0207651_10076581 Ga0207651_100765812 375
171 3300026075 Ga0207708_10075427 Ga0207708_100754271 375
172 3300027907 Ga0207428_10046742 Ga0207428_100467423 375
173 3300049582 Ga0501048_0038588 Ga0501048_0038588_237_1472 375
174 3300049587 Ga0501071_0018643 Ga0501071_0018643_1323_2558 375
175 3300049592 Ga0501076_0048256 Ga0501076_0048256_1399_2634 375
176 3300005840 Ga0068870_10123684 Ga0068870_101236841 377
177 3300042184 Ga0450908_000845 Ga0450908_000845_2126_3373 377
178 3300006237 Ga0097621_100045915 Ga0097621_1000459152 378
179 3300006880 Ga0075429_100171222 Ga0075429_1001712221 378
180 3300014969 Ga0157376_10062306 Ga0157376_100623062 378
181 3300026088 Ga0207641_10066997 Ga0207641_100669972 378
182 3300046514 Ga0495618_0058333 Ga0495618_0058333_91_1263 378
183 3300049574 Ga0501038_0221806 Ga0501038_0221806_47_1282 378
184 3300049576 Ga0501040_0035625 Ga0501040_0035625_767_2002 378
185 3300049577 Ga0501041_0070462 Ga0501041_0070462_379_1614 378
186 3300049578 Ga0501042_0048115 Ga0501042_0048115_1278_2513 378
187 3300061734 Ga0530510_0011183 Ga0530510_0011183_485_1720 378
188 3300025944 Ga0207661_10115904 Ga0207661_101159042 379
189 3300026121 Ga0207683_10328388 Ga0207683_103283881 379
190 3300049582 Ga0501048_0165616 Ga0501048_0165616_161_1402 380
191 3300005719 Ga0068861_100172284 Ga0068861_1001722841 381
192 3300009098 Ga0105245_10265392 Ga0105245_102653922 381
193 3300025918 Ga0207662_10052230 Ga0207662_100522301 381
194 3300049585 Ga0501069_0073545 Ga0501069_0073545_691_1896 382
195 3300005295 Ga0065707_10000944 Ga0065707_100009444 383
196 3300005354 Ga0070675_100054748 Ga0070675_1000547482 383
197 3300005549 Ga0070704_100012743 Ga0070704_1000127432 383
198 3300009553 Ga0105249_10011514 Ga0105249_100115145 383
199 3300014326 Ga0157380_10004807 Ga0157380_100048073 383
200 3300025926 Ga0207659_10068441 Ga0207659_100684412 383
201 3300025961 Ga0207712_10012628 Ga0207712_100126284 383
202 3300050512 nmdc:mga0n895_6731_c1 nmdc:mga0n895_6731_c1_129_1325 383
203 3300005456 Ga0070678_100022073 Ga0070678_1000220733 384
204 3300006852 Ga0075433_10017448 Ga0075433_100174483 384
205 3300006871 Ga0075434_100012709 Ga0075434_1000127096 384
206 3300014326 Ga0157380_10006570 Ga0157380_100065705 384
207 3300025937 Ga0207669_10006349 Ga0207669_100063495 384
208 3300026121 Ga0207683_10035549 Ga0207683_100355493 384
209 3300048905 Ga0496102_0305498 Ga0496102_0305498_197_1405 384
210 3300050515 nmdc:mga0a205_13169_c1 nmdc:mga0a205_13169_c1_6360_7556 384
211 3300006844 Ga0075428_100026209 Ga0075428_1000262092 385
212 3300009147 Ga0114129_10160804 Ga0114129_101608043 385
213 3300050508 nmdc:mga09592_125927_c1 nmdc:mga09592_125927_c1_751_1965 385
214 3300049590 Ga0501074_0100293 Ga0501074_0100293_317_1507 386
215 3300049741 Ga0501079_0060577 Ga0501079_0060577_80_1270 386
216 3300005354 Ga0070675_100133510 Ga0070675_1001335102 387
217 3300005564 Ga0070664_100014624 Ga0070664_1000146247 387
218 3300009094 Ga0111539_10010978 Ga0111539_100109783 388
219 3300014969 Ga0157376_10073382 Ga0157376_100733822 388
220 3300025926 Ga0207659_10003596 Ga0207659_1000359610 388
221 3300025926 Ga0207659_10128805 Ga0207659_101288052 388
222 3300025940 Ga0207691_10304021 Ga0207691_103040211 388
223 3300046684 Ga0495669_0004041 Ga0495669_0004041_4159_5358 388
224 3300050511 nmdc:mga08y16_14178_c1 nmdc:mga08y16_14178_c1_1145_2356 388
225 3300026118 Ga0207675_100093661 Ga0207675_1000936612 390
226 3300032002 Ga0307416_100130637 Ga0307416_1001306373 390
227 3300050509 nmdc:mga0qj67_113732_c1 nmdc:mga0qj67_113732_c1_322_1608 390
228 3300050510 nmdc:mga06r32_212906_c1 nmdc:mga06r32_212906_c1_92_1378 390
229 3300006844 Ga0075428_100010847 Ga0075428_1000108479 391
230 3300009094 Ga0111539_10483615 Ga0111539_104836151 391
231 3300045051 Ga0451576_0191741 Ga0451576_0191741_258_1463 391
232 3300047318 Ga0495636_0014150 Ga0495636_0014150_382_1587 391
233 3300053085 Ga0495619_0020791 Ga0495619_0020791_441_1649 393
234 3300006028 Ga0070717_10019812 Ga0070717_100198123 395
235 3300005549 Ga0070704_100067869 Ga0070704_1000678691 396
236 3300027876 Ga0209974_10019212 Ga0209974_100192121 396
237 3300050507 nmdc:mga05p37_168474_c1 nmdc:mga05p37_168474_c1_1463_2659 396
238 3300005436 Ga0070713_100020144 Ga0070713_1000201443 397
239 3300025928 Ga0207700_10015114 Ga0207700_100151144 397
240 3300005333 Ga0070677_10020281 Ga0070677_100202811 398
241 3300005456 Ga0070678_100034754 Ga0070678_1000347543 398
242 3300005719 Ga0068861_100018493 Ga0068861_1000184933 398
243 3300026089 Ga0207648_10241265 Ga0207648_102412651 398
244 3300026118 Ga0207675_100014195 Ga0207675_1000141955 398
245 3300026121 Ga0207683_10023523 Ga0207683_100235233 398
246 3300061734 Ga0530510_0121102 Ga0530510_0121102_632_1876 398
247 3300025925 Ga0207650_10240998 Ga0207650_102409982 399
248 3300032002 Ga0307416_100011895 Ga0307416_1000118952 401
249 3300005844 Ga0068862_100051658 Ga0068862_1000516583 402
250 3300006038 Ga0075365_10026460 Ga0075365_100264604 402
251 3300006051 Ga0075364_10037596 Ga0075364_100375963 402
252 3300006178 Ga0075367_10045365 Ga0075367_100453652 402
253 3300006195 Ga0075366_10005604 Ga0075366_100056042 402
254 3300006844 Ga0075428_100062062 Ga0075428_1000620623 402
255 3300006880 Ga0075429_100113482 Ga0075429_1001134822 402
256 3300009094 Ga0111539_10002910 Ga0111539_100029106 402
257 3300009553 Ga0105249_10298584 Ga0105249_102985841 402
258 3300025961 Ga0207712_10191283 Ga0207712_101912831 402
259 3300027907 Ga0207428_10003247 Ga0207428_100032476 402
260 3300032002 Ga0307416_100064737 Ga0307416_1000647371 402
261 3300050489 nmdc:mga03683_12739_c1 nmdc:mga03683_12739_c1_1641_2861 402
262 3300050492 nmdc:mga0yw44_55315_c1 nmdc:mga0yw44_55315_c1_1019_2239 402
263 3300050493 nmdc:mga0k408_4489_c1 nmdc:mga0k408_4489_c1_6075_7295 402
264 3300050494 nmdc:mga06z11_33961_c1 nmdc:mga06z11_33961_c1_89_1309 402
265 3300050508 nmdc:mga09592_63585_c1 nmdc:mga09592_63585_c1_1812_3032 402
266 3300050511 nmdc:mga08y16_126832_c1 nmdc:mga08y16_126832_c1_320_1528 402
267 3300050511 nmdc:mga08y16_8907_c1 nmdc:mga08y16_8907_c1_4357_5577 402
268 3300005577 Ga0068857_100006921 Ga0068857_1000069219 403
269 3300049571 Ga0501034_0000065 Ga0501034_0000065_65241_66524 403
270 3300049590 Ga0501074_0000261 Ga0501074_0000261_5439_6722 403
271 3300060353 Ga0501082_0072111 Ga0501082_0072111_1333_2616 403
272 3300009147 Ga0114129_10083143 Ga0114129_100831432 408
273 3300049779 Ga0501283_001565 Ga0501283_001565_1271_2599 409
274 3300050511 nmdc:mga08y16_41771_c1 nmdc:mga08y16_41771_c1_1914_3203 409
275 3300003203 JGI25406J46586_10006103 JGI25406J46586_100061033 411
276 3300005985 Ga0081539_10001029 Ga0081539_1000102940 411

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

65

434

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gkv-assembly1.cif.gz_A crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus 0.8896 12 393
7y3z-assembly2.cif.gz_A structure of a novel carboxylesterase feh from acinetobacter sp. dl-2 0.8826 12 393
3zyt-assembly1.cif.gz_A structure determination of esta from arthrobacter nitroguajacolicus rue61a 0.8775 14 393
5gmx-assembly2.cif.gz_B crystal structure of a family viii carboxylesterase 0.8757 11 394
5gkv-assembly1.cif.gz_A crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus 0.8734 12 393
ID Description Score Start End Superfamily
af_Q9XU43_37_429_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8821 14 393 3.40.710.10
3zytA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8775 14 393 3.40.710.10
af_Q21523_36_427_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8763 14 393 3.40.710.10
af_Q21569_36_429_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8754 14 393 3.40.710.10
af_Q09621_65_456_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8712 14 393 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A517MFB6-F1-model_v4 Beta-lactamase (EC 3.5.2.6) 0.9609 6 393 GO:0008800
AF-A0A7C1EH67-F1-model_v4 Class A beta-lactamase-related serine hydrolase 0.9594 9 297 GO:0016787
AF-A0A016WRC4-F1-model_v4 Beta-lactamase-related domain-containing protein 0.9578 9 199
AF-A0A0Q7NBM9-F1-model_v4 Carboxylesterase 0.9571 7 393
AF-A0A535TA19-F1-model_v4 Beta-lactamase family protein 0.9564 12 198

Feature Viewer

pLDDT pTM Quality
85.6 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map