F381076
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 276 | 165 | 276 | 384 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10083143|Ga0114129_100831432 |
| Length | 451 |
| Sequence | MRPRRIDGCNGYALRRSRHLRCSFIMRAPPSAGMSAPGRRQREKAMSGATSHLVKGHVSPGFDAVRKAFADNFARRHELGGACCAYSDGDTVVDLWGGIRNTETGEAWEQDTMVIVYSATKGLAAMTLAIAHSRGWLDYDERVSAYWPEFAQHGKERITVRQLLAHQAGLFALDEPVDRTLVGDLDRLAIVLARQKPAWEPGTRQAYHGITLGYYESELLRRIDPGHRSVGQFFQDEIASPLGVDVYIRLPEDIPSSRLATIARPRTIDMLLGFPLRLTLEAMNPRSKIVRALRGSELPHDPERIYARNFEVPAGGAVGTARGIARAYSVFATGGHELGLRQQTLDLLAAPAIPPTRGFRDECLHGEVQFSLGFMKPSPLWPFGSASSFGSPGAGGXXXXADPDAGVGYAYVTSQMGTRVTGDPRDVALRKALYSALARQKPHAAPERMAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 109 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 110 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 111 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 113 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 116 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 117 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 118 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 135 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 150 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 151 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 152 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 153 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 154 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.9 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 96.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10006103 | 3300003203 | Bacteria | 5565 |
| 2 | Ga0065714_10084788 | 3300005288 | Bacteria | 2180 |
| 3 | Ga0065704_10007371 | 3300005289 | Bacteria | 3995 |
| 4 | Ga0065712_10089944 | 3300005290 | Bacteria | 2445 |
| 5 | Ga0065707_10000944 | 3300005295 | Bacteria | 10277 |
| 6 | Ga0065707_10013868 | 3300005295 | Bacteria | 1785 |
| 7 | Ga0070683_100074275 | 3300005329 | Bacteria | 3175 |
| 8 | Ga0070690_100159731 | 3300005330 | Bacteria | 1543 |
| 9 | Ga0070670_100004261 | 3300005331 | Bacteria | 11965 |
| 10 | Ga0070670_100005621 | 3300005331 | Bacteria | 10577 |
| 11 | Ga0070677_10020281 | 3300005333 | Bacteria | 2419 |
| 12 | Ga0068869_100093879 | 3300005334 | Bacteria | 2261 |
| 13 | Ga0070680_100010012 | 3300005336 | Bacteria | 7304 |
| 14 | Ga0070689_100000426 | 3300005340 | Bacteria | 24842 |
| 15 | Ga0070661_100069594 | 3300005344 | Bacteria | 2588 |
| 16 | Ga0070669_100000434 | 3300005353 | Bacteria | 31964 |
| 17 | Ga0070675_100002465 | 3300005354 | Bacteria | 13839 |
| 18 | Ga0070675_100006241 | 3300005354 | Bacteria | 9146 |
| 19 | Ga0070675_100022512 | 3300005354 | Bacteria | 5036 |
| 20 | Ga0070675_100054748 | 3300005354 | Bacteria | 3283 |
| 21 | Ga0070675_100133510 | 3300005354 | Unclassified | 2117 |
| 22 | Ga0070671_100039235 | 3300005355 | Bacteria | 3931 |
| 23 | Ga0070673_100012006 | 3300005364 | Bacteria | 5932 |
| 24 | Ga0070673_100031209 | 3300005364 | Bacteria | 3997 |
| 25 | Ga0070673_100064910 | 3300005364 | Bacteria | 2910 |
| 26 | Ga0070667_100334736 | 3300005367 | Bacteria | 1368 |
| 27 | Ga0070713_100020144 | 3300005436 | Bacteria | 5108 |
| 28 | Ga0070701_10002284 | 3300005438 | Bacteria | 7345 |
| 29 | Ga0070700_100039320 | 3300005441 | Bacteria | 2889 |
| 30 | Ga0070700_100124260 | 3300005441 | Bacteria | 1733 |
| 31 | Ga0070700_100170670 | 3300005441 | Unclassified | 1506 |
| 32 | Ga0070694_100004232 | 3300005444 | Bacteria | 8632 |
| 33 | Ga0070678_100022073 | 3300005456 | Unclassified | 4208 |
| 34 | Ga0070678_100034754 | 3300005456 | Bacteria | 3513 |
| 35 | Ga0070662_100029668 | 3300005457 | Bacteria | 3819 |
| 36 | Ga0070681_10025784 | 3300005458 | Bacteria | 5911 |
| 37 | Ga0068867_100020825 | 3300005459 | Bacteria | 4676 |
| 38 | Ga0070698_100270764 | 3300005471 | Bacteria | 1630 |
| 39 | Ga0070699_100013117 | 3300005518 | Bacteria | 7143 |
| 40 | Ga0070679_100011744 | 3300005530 | Bacteria | 8347 |
| 41 | Ga0070684_100030279 | 3300005535 | Bacteria | 4597 |
| 42 | Ga0068853_100045227 | 3300005539 | Bacteria | 3770 |
| 43 | Ga0070672_100015077 | 3300005543 | Bacteria | 5494 |
| 44 | Ga0070672_100042967 | 3300005543 | Bacteria | 3482 |
| 45 | Ga0070672_100057438 | 3300005543 | Bacteria | 3055 |
| 46 | Ga0070686_100003720 | 3300005544 | Bacteria | 8384 |
| 47 | Ga0070704_100001168 | 3300005549 | Bacteria | 13704 |
| 48 | Ga0070704_100012743 | 3300005549 | Bacteria | 5201 |
| 49 | Ga0070704_100067869 | 3300005549 | Bacteria | 2577 |
| 50 | Ga0070664_100013432 | 3300005564 | Bacteria | 6670 |
| 51 | Ga0070664_100014624 | 3300005564 | Bacteria | 6405 |
| 52 | Ga0070664_100033429 | 3300005564 | Bacteria | 4307 |
| 53 | Ga0070664_100040350 | 3300005564 | Bacteria | 3934 |
| 54 | Ga0068857_100003547 | 3300005577 | Bacteria | 13045 |
| 55 | Ga0068857_100006921 | 3300005577 | Bacteria | 9759 |
| 56 | Ga0068859_100000544 | 3300005617 | Bacteria | 37370 |
| 57 | Ga0068859_100015103 | 3300005617 | Bacteria | 7752 |
| 58 | Ga0068859_100016779 | 3300005617 | Bacteria | 7353 |
| 59 | Ga0068864_100000610 | 3300005618 | Bacteria | 30198 |
| 60 | Ga0068864_100005249 | 3300005618 | Bacteria | 10618 |
| 61 | Ga0068861_100002011 | 3300005719 | Bacteria | 13159 |
| 62 | Ga0068861_100018493 | 3300005719 | Bacteria | 4965 |
| 63 | Ga0068861_100122116 | 3300005719 | Bacteria | 2103 |
| 64 | Ga0068861_100172284 | 3300005719 | Unclassified | 1795 |
| 65 | Ga0068870_10000082 | 3300005840 | Bacteria | 30914 |
| 66 | Ga0068870_10006569 | 3300005840 | Bacteria | 5134 |
| 67 | Ga0068870_10123684 | 3300005840 | Bacteria | 1493 |
| 68 | Ga0068863_100202894 | 3300005841 | Bacteria | 1908 |
| 69 | Ga0068858_100129739 | 3300005842 | Bacteria | 2363 |
| 70 | Ga0068860_100005772 | 3300005843 | Bacteria | 12473 |
| 71 | Ga0068862_100000322 | 3300005844 | Bacteria | 52031 |
| 72 | Ga0068862_100051658 | 3300005844 | Bacteria | 3516 |
| 73 | Ga0081539_10001029 | 3300005985 | Bacteria | 51437 |
| 74 | Ga0070717_10019812 | 3300006028 | Bacteria | 5281 |
| 75 | Ga0075365_10026460 | 3300006038 | Bacteria | 3684 |
| 76 | Ga0075364_10037596 | 3300006051 | Bacteria | 3135 |
| 77 | Ga0075367_10045365 | 3300006178 | Unclassified | 2579 |
| 78 | Ga0075366_10005604 | 3300006195 | Bacteria | 6811 |
| 79 | Ga0097621_100045915 | 3300006237 | Unclassified | 3531 |
| 80 | Ga0068871_100004422 | 3300006358 | Bacteria | 9773 |
| 81 | Ga0068871_100292990 | 3300006358 | Bacteria | 1426 |
| 82 | Ga0075428_100000693 | 3300006844 | Bacteria | 34771 |
| 83 | Ga0075428_100010847 | 3300006844 | Bacteria | 10128 |
| 84 | Ga0075428_100026209 | 3300006844 | Bacteria | 6455 |
| 85 | Ga0075428_100062062 | 3300006844 | Bacteria | 4092 |
| 86 | Ga0075428_100238079 | 3300006844 | Bacteria | 1964 |
| 87 | Ga0075431_100004067 | 3300006847 | Bacteria | 14262 |
| 88 | Ga0075433_10005015 | 3300006852 | Bacteria | 10370 |
| 89 | Ga0075433_10017448 | 3300006852 | Bacteria | 5945 |
| 90 | Ga0075434_100007278 | 3300006871 | Bacteria | 10238 |
| 91 | Ga0075434_100012709 | 3300006871 | Bacteria | 7987 |
| 92 | Ga0075429_100113482 | 3300006880 | Bacteria | 2368 |
| 93 | Ga0075429_100171222 | 3300006880 | Bacteria | 1902 |
| 94 | Ga0097620_100000544 | 3300006931 | Bacteria | 37370 |
| 95 | Ga0097620_100015103 | 3300006931 | Bacteria | 7752 |
| 96 | Ga0097620_100016779 | 3300006931 | Bacteria | 7353 |
| 97 | Ga0075435_100088575 | 3300007076 | Bacteria | 2552 |
| 98 | Ga0111539_10000522 | 3300009094 | Bacteria | 48538 |
| 99 | Ga0111539_10002910 | 3300009094 | Bacteria | 22714 |
| 100 | Ga0111539_10010978 | 3300009094 | Bacteria | 11402 |
| 101 | Ga0111539_10012272 | 3300009094 | Bacteria | 10743 |
| 102 | Ga0111539_10483615 | 3300009094 | Unclassified | 1442 |
| 103 | Ga0105245_10265392 | 3300009098 | Unclassified | 1672 |
| 104 | Ga0114129_10004230 | 3300009147 | Bacteria | 20287 |
| 105 | Ga0114129_10051176 | 3300009147 | Bacteria | 5800 |
| 106 | Ga0114129_10083143 | 3300009147 | Bacteria | 4448 |
| 107 | Ga0114129_10160804 | 3300009147 | Unclassified | 3068 |
| 108 | Ga0105248_10052176 | 3300009177 | Unclassified | 4589 |
| 109 | Ga0105248_10060123 | 3300009177 | Bacteria | 4266 |
| 110 | Ga0105248_10089529 | 3300009177 | Bacteria | 3464 |
| 111 | Ga0105237_10049065 | 3300009545 | Bacteria | 4244 |
| 112 | Ga0105238_10132206 | 3300009551 | Bacteria | 2474 |
| 113 | Ga0105249_10011514 | 3300009553 | Bacteria | 7772 |
| 114 | Ga0105249_10026335 | 3300009553 | Bacteria | 5239 |
| 115 | Ga0105249_10298584 | 3300009553 | Bacteria | 1615 |
| 116 | Ga0157369_10018670 | 3300013105 | Bacteria | 7774 |
| 117 | Ga0163162_10069774 | 3300013306 | Bacteria | 3566 |
| 118 | Ga0157372_10021498 | 3300013307 | Bacteria | 6971 |
| 119 | Ga0157375_10001795 | 3300013308 | Bacteria | 18406 |
| 120 | Ga0163163_10237368 | 3300014325 | Unclassified | 1873 |
| 121 | Ga0157380_10004807 | 3300014326 | Bacteria | 9416 |
| 122 | Ga0157380_10006570 | 3300014326 | Bacteria | 8199 |
| 123 | Ga0157377_10007501 | 3300014745 | Bacteria | 5270 |
| 124 | Ga0157377_10015842 | 3300014745 | Bacteria | 3865 |
| 125 | Ga0157377_10029545 | 3300014745 | Bacteria | 2960 |
| 126 | Ga0157376_10062306 | 3300014969 | Unclassified | 3138 |
| 127 | Ga0157376_10073382 | 3300014969 | Unclassified | 2914 |
| 128 | Ga0207688_10130234 | 3300025901 | Bacteria | 1474 |
| 129 | Ga0207643_10000440 | 3300025908 | Bacteria | 27191 |
| 130 | Ga0207643_10020219 | 3300025908 | Unclassified | 3652 |
| 131 | Ga0207707_10014278 | 3300025912 | Bacteria | 6919 |
| 132 | Ga0207660_10009253 | 3300025917 | Bacteria | 6377 |
| 133 | Ga0207662_10004060 | 3300025918 | Bacteria | 7639 |
| 134 | Ga0207662_10052230 | 3300025918 | Bacteria | 2432 |
| 135 | Ga0207652_10069293 | 3300025921 | Bacteria | 3062 |
| 136 | Ga0207681_10000766 | 3300025923 | Bacteria | 21118 |
| 137 | Ga0207681_10071752 | 3300025923 | Bacteria | 2416 |
| 138 | Ga0207650_10005884 | 3300025925 | Bacteria | 8369 |
| 139 | Ga0207650_10010932 | 3300025925 | Bacteria | 6239 |
| 140 | Ga0207650_10240998 | 3300025925 | Unclassified | 1461 |
| 141 | Ga0207659_10003596 | 3300025926 | Bacteria | 9331 |
| 142 | Ga0207659_10003763 | 3300025926 | Bacteria | 9146 |
| 143 | Ga0207659_10043982 | 3300025926 | Bacteria | 3141 |
| 144 | Ga0207659_10068441 | 3300025926 | Bacteria | 2582 |
| 145 | Ga0207659_10128805 | 3300025926 | Bacteria | 1950 |
| 146 | Ga0207700_10015114 | 3300025928 | Bacteria | 5079 |
| 147 | Ga0207706_10046761 | 3300025933 | Bacteria | 3831 |
| 148 | Ga0207706_10171933 | 3300025933 | Bacteria | 1904 |
| 149 | Ga0207670_10002569 | 3300025936 | Bacteria | 9546 |
| 150 | Ga0207669_10006349 | 3300025937 | Bacteria | 5394 |
| 151 | Ga0207704_10012651 | 3300025938 | Bacteria | 4193 |
| 152 | Ga0207691_10026232 | 3300025940 | Bacteria | 5468 |
| 153 | Ga0207691_10048913 | 3300025940 | Bacteria | 3875 |
| 154 | Ga0207691_10051938 | 3300025940 | Bacteria | 3745 |
| 155 | Ga0207691_10304021 | 3300025940 | Bacteria | 1370 |
| 156 | Ga0207711_10071574 | 3300025941 | Bacteria | 3009 |
| 157 | Ga0207689_10036068 | 3300025942 | Bacteria | 4106 |
| 158 | Ga0207661_10023373 | 3300025944 | Bacteria | 4669 |
| 159 | Ga0207661_10115904 | 3300025944 | Bacteria | 2274 |
| 160 | Ga0207679_10002182 | 3300025945 | Bacteria | 12111 |
| 161 | Ga0207679_10012670 | 3300025945 | Bacteria | 5504 |
| 162 | Ga0207679_10058812 | 3300025945 | Bacteria | 2850 |
| 163 | Ga0207651_10032888 | 3300025960 | Bacteria | 3337 |
| 164 | Ga0207651_10076581 | 3300025960 | Unclassified | 2392 |
| 165 | Ga0207712_10012628 | 3300025961 | Bacteria | 5397 |
| 166 | Ga0207712_10016187 | 3300025961 | Bacteria | 4822 |
| 167 | Ga0207712_10191283 | 3300025961 | Bacteria | 1615 |
| 168 | Ga0207678_10007855 | 3300026067 | Bacteria | 9413 |
| 169 | Ga0207708_10060205 | 3300026075 | Bacteria | 2899 |
| 170 | Ga0207708_10075427 | 3300026075 | Bacteria | 2586 |
| 171 | Ga0207708_10167249 | 3300026075 | Bacteria | 1739 |
| 172 | Ga0207641_10066997 | 3300026088 | Bacteria | 3075 |
| 173 | Ga0207648_10031708 | 3300026089 | Bacteria | 4671 |
| 174 | Ga0207648_10241265 | 3300026089 | Bacteria | 1609 |
| 175 | Ga0207676_10015404 | 3300026095 | Bacteria | 5514 |
| 176 | Ga0207676_10100679 | 3300026095 | Bacteria | 2395 |
| 177 | Ga0207675_100004751 | 3300026118 | Bacteria | 13080 |
| 178 | Ga0207675_100014195 | 3300026118 | Bacteria | 7428 |
| 179 | Ga0207675_100093661 | 3300026118 | Unclassified | 2826 |
| 180 | Ga0207675_100142416 | 3300026118 | Bacteria | 2278 |
| 181 | Ga0207675_100185458 | 3300026118 | Bacteria | 1994 |
| 182 | Ga0207683_10016763 | 3300026121 | Bacteria | 6236 |
| 183 | Ga0207683_10023523 | 3300026121 | Bacteria | 5301 |
| 184 | Ga0207683_10035549 | 3300026121 | Unclassified | 4334 |
| 185 | Ga0207683_10328388 | 3300026121 | Bacteria | 1402 |
| 186 | Ga0209974_10019212 | 3300027876 | Bacteria | 2265 |
| 187 | Ga0207428_10000810 | 3300027907 | Bacteria | 35372 |
| 188 | Ga0207428_10003247 | 3300027907 | Bacteria | 15845 |
| 189 | Ga0207428_10046742 | 3300027907 | Bacteria | 3479 |
| 190 | Ga0268265_10001611 | 3300028380 | Bacteria | 18614 |
| 191 | Ga0268264_10097934 | 3300028381 | Bacteria | 2543 |
| 192 | Ga0307416_100011895 | 3300032002 | Bacteria | 5837 |
| 193 | Ga0307416_100064737 | 3300032002 | Bacteria | 3001 |
| 194 | Ga0307416_100113288 | 3300032002 | Bacteria | 2396 |
| 195 | Ga0307416_100130637 | 3300032002 | Bacteria | 2260 |
| 196 | Ga0373953_0000258 | 3300035117 | Bacteria | 14391 |
| 197 | Ga0373954_0001945 | 3300035118 | Bacteria | 8563 |
| 198 | Ga0373956_0000359 | 3300035119 | Bacteria | 18534 |
| 199 | Ga0373955_0002553 | 3300035172 | Bacteria | 7968 |
| 200 | Ga0373935_0020420 | 3300035692 | Bacteria | 4048 |
| 201 | Ga0373935_0193604 | 3300035692 | Unclassified | 1402 |
| 202 | Ga0373933_0060398 | 3300035724 | Bacteria | 2285 |
| 203 | Ga0373925_0182898 | 3300037068 | Bacteria | 1660 |
| 204 | Ga0316581_0029271 | 3300037588 | Bacteria | 1654 |
| 205 | Ga0450908_000845 | 3300042184 | Bacteria | 5910 |
| 206 | Ga0451576_0191741 | 3300045051 | Bacteria | 2135 |
| 207 | Ga0495580_0080048 | 3300046472 | Bacteria | 2278 |
| 208 | Ga0495594_0112062 | 3300046499 | Bacteria | 1538 |
| 209 | Ga0495608_0007600 | 3300046511 | Bacteria | 7642 |
| 210 | Ga0495618_0001773 | 3300046514 | Bacteria | 14300 |
| 211 | Ga0495618_0058333 | 3300046514 | Bacteria | 2445 |
| 212 | Ga0495630_0081028 | 3300046517 | Bacteria | 2449 |
| 213 | Ga0495640_0071102 | 3300046533 | Bacteria | 2335 |
| 214 | Ga0495586_0011427 | 3300046535 | Bacteria | 4723 |
| 215 | Ga0495667_0003968 | 3300046559 | Bacteria | 9932 |
| 216 | Ga0495667_0006628 | 3300046559 | Bacteria | 7861 |
| 217 | Ga0495659_0001087 | 3300046664 | Bacteria | 9465 |
| 218 | Ga0495657_0001377 | 3300046675 | Bacteria | 21103 |
| 219 | Ga0495657_0059104 | 3300046675 | Bacteria | 2544 |
| 220 | Ga0495669_0004041 | 3300046684 | Bacteria | 6036 |
| 221 | Ga0495669_0010825 | 3300046684 | Bacteria | 3861 |
| 222 | Ga0495669_0028247 | 3300046684 | Unclassified | 2456 |
| 223 | Ga0495613_0041853 | 3300046689 | Bacteria | 3391 |
| 224 | Ga0495604_0078197 | 3300047317 | Bacteria | 2483 |
| 225 | Ga0495636_0014150 | 3300047318 | Bacteria | 3173 |
| 226 | Ga0495675_0011476 | 3300047444 | Bacteria | 5562 |
| 227 | Ga0495684_0004274 | 3300047471 | Bacteria | 11145 |
| 228 | Ga0496102_0305498 | 3300048905 | Bacteria | 1499 |
| 229 | Ga0501034_0000065 | 3300049571 | Bacteria | 184952 |
| 230 | Ga0501038_0221806 | 3300049574 | Bacteria | 1508 |
| 231 | Ga0501039_0137736 | 3300049575 | Bacteria | 1917 |
| 232 | Ga0501040_0035625 | 3300049576 | Bacteria | 3376 |
| 233 | Ga0501041_0070462 | 3300049577 | Bacteria | 2146 |
| 234 | Ga0501042_0048115 | 3300049578 | Bacteria | 3041 |
| 235 | Ga0501046_0013075 | 3300049580 | Bacteria | 7046 |
| 236 | Ga0501048_0038588 | 3300049582 | Bacteria | 3427 |
| 237 | Ga0501048_0165616 | 3300049582 | Bacteria | 1565 |
| 238 | Ga0501069_0073545 | 3300049585 | Bacteria | 1917 |
| 239 | Ga0501071_0018643 | 3300049587 | Bacteria | 4810 |
| 240 | Ga0501074_0000261 | 3300049590 | Bacteria | 29899 |
| 241 | Ga0501074_0100293 | 3300049590 | Unclassified | 2073 |
| 242 | Ga0501076_0048256 | 3300049592 | Bacteria | 3366 |
| 243 | Ga0501077_0095517 | 3300049593 | Unclassified | 1884 |
| 244 | Ga0501079_0060577 | 3300049741 | Bacteria | 2919 |
| 245 | Ga0501079_0179656 | 3300049741 | Bacteria | 1651 |
| 246 | Ga0501283_001565 | 3300049779 | Unclassified | 2967 |
| 247 | nmdc:mga03683_12739_c1 | 3300050489 | Bacteria | 3078 |
| 248 | nmdc:mga0yw44_55315_c1 | 3300050492 | Bacteria | 2414 |
| 249 | nmdc:mga0k408_4489_c1 | 3300050493 | Bacteria | 7405 |
| 250 | nmdc:mga06z11_33961_c1 | 3300050494 | Bacteria | 2500 |
| 251 | nmdc:mga05p37_1031_c1 | 3300050507 | Bacteria | 31776 |
| 252 | nmdc:mga05p37_168474_c1 | 3300050507 | Bacteria | 2672 |
| 253 | nmdc:mga05p37_2796_c1 | 3300050507 | Bacteria | 20287 |
| 254 | nmdc:mga09592_125927_c1 | 3300050508 | Unclassified | 2202 |
| 255 | nmdc:mga09592_63585_c1 | 3300050508 | Bacteria | 3124 |
| 256 | nmdc:mga0qj67_113732_c1 | 3300050509 | Bacteria | 2186 |
| 257 | nmdc:mga0qj67_98160_c1 | 3300050509 | Bacteria | 2360 |
| 258 | nmdc:mga06r32_212906_c1 | 3300050510 | Bacteria | 1920 |
| 259 | nmdc:mga08y16_126832_c1 | 3300050511 | Bacteria | 2012 |
| 260 | nmdc:mga08y16_14178_c1 | 3300050511 | Bacteria | 8388 |
| 261 | nmdc:mga08y16_41771_c1 | 3300050511 | Unclassified | 4803 |
| 262 | nmdc:mga08y16_592_c1 | 3300050511 | Bacteria | 33756 |
| 263 | nmdc:mga08y16_6132_c1 | 3300050511 | Bacteria | 12604 |
| 264 | nmdc:mga08y16_8907_c1 | 3300050511 | Bacteria | 10537 |
| 265 | nmdc:mga0n895_2758_c1 | 3300050512 | Bacteria | 13875 |
| 266 | nmdc:mga0n895_6731_c1 | 3300050512 | Bacteria | 9801 |
| 267 | nmdc:mga0rr50_126312_c1 | 3300050513 | Bacteria | 2043 |
| 268 | nmdc:mga0a205_13169_c1 | 3300050515 | Bacteria | 7685 |
| 269 | nmdc:mga0a205_61939_c1 | 3300050515 | Bacteria | 3615 |
| 270 | Ga0495619_0020791 | 3300053085 | Bacteria | 4186 |
| 271 | Ga0501084_0128267 | 3300054114 | Unclassified | 2135 |
| 272 | Ga0501082_0072111 | 3300060353 | Bacteria | 2975 |
| 273 | Ga0501082_0295226 | 3300060353 | Bacteria | 1411 |
| 274 | Ga0530510_0011183 | 3300061734 | Bacteria | 6297 |
| 275 | Ga0530510_0121102 | 3300061734 | Bacteria | 1921 |
| 276 | Ga0530510_0170041 | 3300061734 | Bacteria | 1614 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014745 | Ga0157377_10015842 | Ga0157377_100158421 | 300 |
| 2 | 3300025933 | Ga0207706_10171933 | Ga0207706_101719332 | 339 |
| 3 | 3300035692 | Ga0373935_0193604 | Ga0373935_0193604_286_1344 | 340 |
| 4 | 3300046499 | Ga0495594_0112062 | Ga0495594_0112062_34_1185 | 355 |
| 5 | 3300009177 | Ga0105248_10089529 | Ga0105248_100895291 | 359 |
| 6 | 3300005295 | Ga0065707_10013868 | Ga0065707_100138682 | 360 |
| 7 | 3300050511 | nmdc:mga08y16_6132_c1 | nmdc:mga08y16_6132_c1_1087_2280 | 360 |
| 8 | 3300005289 | Ga0065704_10007371 | Ga0065704_100073713 | 364 |
| 9 | 3300005355 | Ga0070671_100039235 | Ga0070671_1000392354 | 365 |
| 10 | 3300005364 | Ga0070673_100031209 | Ga0070673_1000312092 | 365 |
| 11 | 3300005564 | Ga0070664_100033429 | Ga0070664_1000334292 | 365 |
| 12 | 3300025945 | Ga0207679_10058812 | Ga0207679_100588122 | 365 |
| 13 | 3300026067 | Ga0207678_10007855 | Ga0207678_100078554 | 365 |
| 14 | 3300026095 | Ga0207676_10100679 | Ga0207676_101006791 | 365 |
| 15 | 3300035118 | Ga0373954_0001945 | Ga0373954_0001945_302_1456 | 365 |
| 16 | 3300035172 | Ga0373955_0002553 | Ga0373955_0002553_440_1594 | 365 |
| 17 | 3300035692 | Ga0373935_0020420 | Ga0373935_0020420_383_1537 | 365 |
| 18 | 3300037068 | Ga0373925_0182898 | Ga0373925_0182898_138_1292 | 365 |
| 19 | 3300046472 | Ga0495580_0080048 | Ga0495580_0080048_967_2121 | 365 |
| 20 | 3300046517 | Ga0495630_0081028 | Ga0495630_0081028_116_1270 | 365 |
| 21 | 3300046533 | Ga0495640_0071102 | Ga0495640_0071102_423_1577 | 365 |
| 22 | 3300046675 | Ga0495657_0059104 | Ga0495657_0059104_250_1404 | 365 |
| 23 | 3300046689 | Ga0495613_0041853 | Ga0495613_0041853_417_1571 | 365 |
| 24 | 3300047471 | Ga0495684_0004274 | Ga0495684_0004274_423_1577 | 365 |
| 25 | 3300009147 | Ga0114129_10004230 | Ga0114129_1000423012 | 366 |
| 26 | 3300026118 | Ga0207675_100185458 | Ga0207675_1001854581 | 366 |
| 27 | 3300026121 | Ga0207683_10016763 | Ga0207683_100167632 | 366 |
| 28 | 3300037588 | Ga0316581_0029271 | Ga0316581_0029271_209_1432 | 366 |
| 29 | 3300046664 | Ga0495659_0001087 | Ga0495659_0001087_2019_3224 | 366 |
| 30 | 3300046684 | Ga0495669_0010825 | Ga0495669_0010825_782_1987 | 366 |
| 31 | 3300049575 | Ga0501039_0137736 | Ga0501039_0137736_28_1218 | 366 |
| 32 | 3300049580 | Ga0501046_0013075 | Ga0501046_0013075_5838_7028 | 366 |
| 33 | 3300049593 | Ga0501077_0095517 | Ga0501077_0095517_368_1558 | 366 |
| 34 | 3300049741 | Ga0501079_0179656 | Ga0501079_0179656_171_1361 | 366 |
| 35 | 3300050507 | nmdc:mga05p37_2796_c1 | nmdc:mga05p37_2796_c1_16839_18023 | 366 |
| 36 | 3300060353 | Ga0501082_0295226 | Ga0501082_0295226_37_1221 | 366 |
| 37 | 3300005354 | Ga0070675_100022512 | Ga0070675_1000225123 | 367 |
| 38 | 3300005364 | Ga0070673_100012006 | Ga0070673_1000120064 | 367 |
| 39 | 3300005367 | Ga0070667_100334736 | Ga0070667_1003347362 | 367 |
| 40 | 3300005441 | Ga0070700_100124260 | Ga0070700_1001242602 | 367 |
| 41 | 3300005543 | Ga0070672_100015077 | Ga0070672_1000150776 | 367 |
| 42 | 3300005617 | Ga0068859_100015103 | Ga0068859_1000151038 | 367 |
| 43 | 3300005841 | Ga0068863_100202894 | Ga0068863_1002028942 | 367 |
| 44 | 3300005842 | Ga0068858_100129739 | Ga0068858_1001297392 | 367 |
| 45 | 3300006931 | Ga0097620_100015103 | Ga0097620_1000151033 | 367 |
| 46 | 3300025923 | Ga0207681_10071752 | Ga0207681_100717522 | 367 |
| 47 | 3300025926 | Ga0207659_10043982 | Ga0207659_100439823 | 367 |
| 48 | 3300025940 | Ga0207691_10026232 | Ga0207691_100262326 | 367 |
| 49 | 3300025960 | Ga0207651_10032888 | Ga0207651_100328882 | 367 |
| 50 | 3300026075 | Ga0207708_10167249 | Ga0207708_101672492 | 367 |
| 51 | 3300046684 | Ga0495669_0028247 | Ga0495669_0028247_107_1342 | 367 |
| 52 | 3300054114 | Ga0501084_0128267 | Ga0501084_0128267_502_1692 | 367 |
| 53 | 3300005340 | Ga0070689_100000426 | Ga0070689_1000004264 | 368 |
| 54 | 3300005353 | Ga0070669_100000434 | Ga0070669_10000043412 | 368 |
| 55 | 3300005354 | Ga0070675_100006241 | Ga0070675_1000062416 | 368 |
| 56 | 3300005364 | Ga0070673_100064910 | Ga0070673_1000649102 | 368 |
| 57 | 3300005438 | Ga0070701_10002284 | Ga0070701_100022844 | 368 |
| 58 | 3300005441 | Ga0070700_100039320 | Ga0070700_1000393204 | 368 |
| 59 | 3300005444 | Ga0070694_100004232 | Ga0070694_1000042323 | 368 |
| 60 | 3300005457 | Ga0070662_100029668 | Ga0070662_1000296682 | 368 |
| 61 | 3300005459 | Ga0068867_100020825 | Ga0068867_1000208256 | 368 |
| 62 | 3300005471 | Ga0070698_100270764 | Ga0070698_1002707641 | 368 |
| 63 | 3300005518 | Ga0070699_100013117 | Ga0070699_1000131174 | 368 |
| 64 | 3300005543 | Ga0070672_100042967 | Ga0070672_1000429671 | 368 |
| 65 | 3300005544 | Ga0070686_100003720 | Ga0070686_1000037203 | 368 |
| 66 | 3300005549 | Ga0070704_100001168 | Ga0070704_1000011683 | 368 |
| 67 | 3300005577 | Ga0068857_100003547 | Ga0068857_10000354711 | 368 |
| 68 | 3300005617 | Ga0068859_100000544 | Ga0068859_10000054424 | 368 |
| 69 | 3300005618 | Ga0068864_100005249 | Ga0068864_1000052496 | 368 |
| 70 | 3300005719 | Ga0068861_100002011 | Ga0068861_10000201111 | 368 |
| 71 | 3300005840 | Ga0068870_10000082 | Ga0068870_1000008217 | 368 |
| 72 | 3300005844 | Ga0068862_100000322 | Ga0068862_10000032229 | 368 |
| 73 | 3300006844 | Ga0075428_100238079 | Ga0075428_1002380793 | 368 |
| 74 | 3300006931 | Ga0097620_100000544 | Ga0097620_10000054416 | 368 |
| 75 | 3300009094 | Ga0111539_10000522 | Ga0111539_1000052223 | 368 |
| 76 | 3300009553 | Ga0105249_10026335 | Ga0105249_100263357 | 368 |
| 77 | 3300013308 | Ga0157375_10001795 | Ga0157375_1000179514 | 368 |
| 78 | 3300014745 | Ga0157377_10007501 | Ga0157377_100075013 | 368 |
| 79 | 3300025901 | Ga0207688_10130234 | Ga0207688_101302341 | 368 |
| 80 | 3300025908 | Ga0207643_10000440 | Ga0207643_100004409 | 368 |
| 81 | 3300025918 | Ga0207662_10004060 | Ga0207662_100040605 | 368 |
| 82 | 3300025923 | Ga0207681_10000766 | Ga0207681_1000076610 | 368 |
| 83 | 3300025926 | Ga0207659_10003763 | Ga0207659_100037637 | 368 |
| 84 | 3300025933 | Ga0207706_10046761 | Ga0207706_100467616 | 368 |
| 85 | 3300025936 | Ga0207670_10002569 | Ga0207670_100025699 | 368 |
| 86 | 3300025938 | Ga0207704_10012651 | Ga0207704_100126511 | 368 |
| 87 | 3300025940 | Ga0207691_10051938 | Ga0207691_100519382 | 368 |
| 88 | 3300025961 | Ga0207712_10016187 | Ga0207712_100161872 | 368 |
| 89 | 3300026075 | Ga0207708_10060205 | Ga0207708_100602054 | 368 |
| 90 | 3300026089 | Ga0207648_10031708 | Ga0207648_100317087 | 368 |
| 91 | 3300026095 | Ga0207676_10015404 | Ga0207676_100154046 | 368 |
| 92 | 3300026118 | Ga0207675_100004751 | Ga0207675_10000475111 | 368 |
| 93 | 3300027907 | Ga0207428_10000810 | Ga0207428_1000081010 | 368 |
| 94 | 3300028380 | Ga0268265_10001611 | Ga0268265_100016113 | 368 |
| 95 | 3300046511 | Ga0495608_0007600 | Ga0495608_0007600_2965_4194 | 368 |
| 96 | 3300046559 | Ga0495667_0006628 | Ga0495667_0006628_6489_7718 | 368 |
| 97 | 3300046675 | Ga0495657_0001377 | Ga0495657_0001377_9644_10873 | 368 |
| 98 | 3300047444 | Ga0495675_0011476 | Ga0495675_0011476_3877_5106 | 368 |
| 99 | 3300050509 | nmdc:mga0qj67_98160_c1 | nmdc:mga0qj67_98160_c1_666_1889 | 368 |
| 100 | 3300050511 | nmdc:mga08y16_592_c1 | nmdc:mga08y16_592_c1_7360_8562 | 368 |
| 101 | 3300061734 | Ga0530510_0170041 | Ga0530510_0170041_189_1364 | 368 |
| 102 | 3300005290 | Ga0065712_10089944 | Ga0065712_100899442 | 369 |
| 103 | 3300005331 | Ga0070670_100005621 | Ga0070670_1000056215 | 369 |
| 104 | 3300005564 | Ga0070664_100040350 | Ga0070664_1000403506 | 369 |
| 105 | 3300005618 | Ga0068864_100000610 | Ga0068864_10000061022 | 369 |
| 106 | 3300006852 | Ga0075433_10005015 | Ga0075433_100050154 | 369 |
| 107 | 3300006871 | Ga0075434_100007278 | Ga0075434_1000072787 | 369 |
| 108 | 3300007076 | Ga0075435_100088575 | Ga0075435_1000885752 | 369 |
| 109 | 3300025925 | Ga0207650_10005884 | Ga0207650_100058845 | 369 |
| 110 | 3300025945 | Ga0207679_10002182 | Ga0207679_100021824 | 369 |
| 111 | 3300028381 | Ga0268264_10097934 | Ga0268264_100979343 | 369 |
| 112 | 3300050512 | nmdc:mga0n895_2758_c1 | nmdc:mga0n895_2758_c1_11670_12869 | 369 |
| 113 | 3300050513 | nmdc:mga0rr50_126312_c1 | nmdc:mga0rr50_126312_c1_485_1684 | 369 |
| 114 | 3300050515 | nmdc:mga0a205_61939_c1 | nmdc:mga0a205_61939_c1_2168_3367 | 369 |
| 115 | 3300006844 | Ga0075428_100000693 | Ga0075428_10000069327 | 371 |
| 116 | 3300006847 | Ga0075431_100004067 | Ga0075431_1000040678 | 371 |
| 117 | 3300009147 | Ga0114129_10051176 | Ga0114129_100511764 | 371 |
| 118 | 3300035117 | Ga0373953_0000258 | Ga0373953_0000258_327_1517 | 371 |
| 119 | 3300035119 | Ga0373956_0000359 | Ga0373956_0000359_371_1561 | 371 |
| 120 | 3300035724 | Ga0373933_0060398 | Ga0373933_0060398_782_1972 | 371 |
| 121 | 3300046514 | Ga0495618_0001773 | Ga0495618_0001773_546_1736 | 371 |
| 122 | 3300046535 | Ga0495586_0011427 | Ga0495586_0011427_3351_4541 | 371 |
| 123 | 3300046559 | Ga0495667_0003968 | Ga0495667_0003968_17_1207 | 371 |
| 124 | 3300047317 | Ga0495604_0078197 | Ga0495604_0078197_294_1484 | 371 |
| 125 | 3300050507 | nmdc:mga05p37_1031_c1 | nmdc:mga05p37_1031_c1_17442_18662 | 371 |
| 126 | 3300005288 | Ga0065714_10084788 | Ga0065714_100847882 | 372 |
| 127 | 3300005330 | Ga0070690_100159731 | Ga0070690_1001597311 | 372 |
| 128 | 3300005334 | Ga0068869_100093879 | Ga0068869_1000938792 | 372 |
| 129 | 3300009177 | Ga0105248_10052176 | Ga0105248_100521764 | 372 |
| 130 | 3300014325 | Ga0163163_10237368 | Ga0163163_102373681 | 372 |
| 131 | 3300025942 | Ga0207689_10036068 | Ga0207689_100360683 | 372 |
| 132 | 3300005329 | Ga0070683_100074275 | Ga0070683_1000742752 | 373 |
| 133 | 3300005331 | Ga0070670_100004261 | Ga0070670_1000042618 | 373 |
| 134 | 3300005336 | Ga0070680_100010012 | Ga0070680_1000100123 | 373 |
| 135 | 3300005344 | Ga0070661_100069594 | Ga0070661_1000695942 | 373 |
| 136 | 3300005458 | Ga0070681_10025784 | Ga0070681_100257842 | 373 |
| 137 | 3300005530 | Ga0070679_100011744 | Ga0070679_1000117444 | 373 |
| 138 | 3300005535 | Ga0070684_100030279 | Ga0070684_1000302792 | 373 |
| 139 | 3300005539 | Ga0068853_100045227 | Ga0068853_1000452272 | 373 |
| 140 | 3300005564 | Ga0070664_100013432 | Ga0070664_1000134325 | 373 |
| 141 | 3300005719 | Ga0068861_100122116 | Ga0068861_1001221162 | 373 |
| 142 | 3300005840 | Ga0068870_10006569 | Ga0068870_100065692 | 373 |
| 143 | 3300009545 | Ga0105237_10049065 | Ga0105237_100490653 | 373 |
| 144 | 3300009551 | Ga0105238_10132206 | Ga0105238_101322062 | 373 |
| 145 | 3300013105 | Ga0157369_10018670 | Ga0157369_100186703 | 373 |
| 146 | 3300013307 | Ga0157372_10021498 | Ga0157372_100214983 | 373 |
| 147 | 3300025908 | Ga0207643_10020219 | Ga0207643_100202193 | 373 |
| 148 | 3300025912 | Ga0207707_10014278 | Ga0207707_100142786 | 373 |
| 149 | 3300025917 | Ga0207660_10009253 | Ga0207660_100092535 | 373 |
| 150 | 3300025921 | Ga0207652_10069293 | Ga0207652_100692932 | 373 |
| 151 | 3300025925 | Ga0207650_10010932 | Ga0207650_100109323 | 373 |
| 152 | 3300025944 | Ga0207661_10023373 | Ga0207661_100233734 | 373 |
| 153 | 3300025945 | Ga0207679_10012670 | Ga0207679_100126704 | 373 |
| 154 | 3300026118 | Ga0207675_100142416 | Ga0207675_1001424162 | 373 |
| 155 | 3300006358 | Ga0068871_100004422 | Ga0068871_1000044227 | 374 |
| 156 | 3300013306 | Ga0163162_10069774 | Ga0163162_100697743 | 374 |
| 157 | 3300032002 | Ga0307416_100113288 | Ga0307416_1001132881 | 374 |
| 158 | 3300005354 | Ga0070675_100002465 | Ga0070675_10000246510 | 375 |
| 159 | 3300005441 | Ga0070700_100170670 | Ga0070700_1001706702 | 375 |
| 160 | 3300005543 | Ga0070672_100057438 | Ga0070672_1000574383 | 375 |
| 161 | 3300005617 | Ga0068859_100016779 | Ga0068859_10001677910 | 375 |
| 162 | 3300005843 | Ga0068860_100005772 | Ga0068860_1000057729 | 375 |
| 163 | 3300006358 | Ga0068871_100292990 | Ga0068871_1002929902 | 375 |
| 164 | 3300006931 | Ga0097620_100016779 | Ga0097620_10001677910 | 375 |
| 165 | 3300009094 | Ga0111539_10012272 | Ga0111539_100122723 | 375 |
| 166 | 3300009177 | Ga0105248_10060123 | Ga0105248_100601232 | 375 |
| 167 | 3300014745 | Ga0157377_10029545 | Ga0157377_100295453 | 375 |
| 168 | 3300025940 | Ga0207691_10048913 | Ga0207691_100489132 | 375 |
| 169 | 3300025941 | Ga0207711_10071574 | Ga0207711_100715743 | 375 |
| 170 | 3300025960 | Ga0207651_10076581 | Ga0207651_100765812 | 375 |
| 171 | 3300026075 | Ga0207708_10075427 | Ga0207708_100754271 | 375 |
| 172 | 3300027907 | Ga0207428_10046742 | Ga0207428_100467423 | 375 |
| 173 | 3300049582 | Ga0501048_0038588 | Ga0501048_0038588_237_1472 | 375 |
| 174 | 3300049587 | Ga0501071_0018643 | Ga0501071_0018643_1323_2558 | 375 |
| 175 | 3300049592 | Ga0501076_0048256 | Ga0501076_0048256_1399_2634 | 375 |
| 176 | 3300005840 | Ga0068870_10123684 | Ga0068870_101236841 | 377 |
| 177 | 3300042184 | Ga0450908_000845 | Ga0450908_000845_2126_3373 | 377 |
| 178 | 3300006237 | Ga0097621_100045915 | Ga0097621_1000459152 | 378 |
| 179 | 3300006880 | Ga0075429_100171222 | Ga0075429_1001712221 | 378 |
| 180 | 3300014969 | Ga0157376_10062306 | Ga0157376_100623062 | 378 |
| 181 | 3300026088 | Ga0207641_10066997 | Ga0207641_100669972 | 378 |
| 182 | 3300046514 | Ga0495618_0058333 | Ga0495618_0058333_91_1263 | 378 |
| 183 | 3300049574 | Ga0501038_0221806 | Ga0501038_0221806_47_1282 | 378 |
| 184 | 3300049576 | Ga0501040_0035625 | Ga0501040_0035625_767_2002 | 378 |
| 185 | 3300049577 | Ga0501041_0070462 | Ga0501041_0070462_379_1614 | 378 |
| 186 | 3300049578 | Ga0501042_0048115 | Ga0501042_0048115_1278_2513 | 378 |
| 187 | 3300061734 | Ga0530510_0011183 | Ga0530510_0011183_485_1720 | 378 |
| 188 | 3300025944 | Ga0207661_10115904 | Ga0207661_101159042 | 379 |
| 189 | 3300026121 | Ga0207683_10328388 | Ga0207683_103283881 | 379 |
| 190 | 3300049582 | Ga0501048_0165616 | Ga0501048_0165616_161_1402 | 380 |
| 191 | 3300005719 | Ga0068861_100172284 | Ga0068861_1001722841 | 381 |
| 192 | 3300009098 | Ga0105245_10265392 | Ga0105245_102653922 | 381 |
| 193 | 3300025918 | Ga0207662_10052230 | Ga0207662_100522301 | 381 |
| 194 | 3300049585 | Ga0501069_0073545 | Ga0501069_0073545_691_1896 | 382 |
| 195 | 3300005295 | Ga0065707_10000944 | Ga0065707_100009444 | 383 |
| 196 | 3300005354 | Ga0070675_100054748 | Ga0070675_1000547482 | 383 |
| 197 | 3300005549 | Ga0070704_100012743 | Ga0070704_1000127432 | 383 |
| 198 | 3300009553 | Ga0105249_10011514 | Ga0105249_100115145 | 383 |
| 199 | 3300014326 | Ga0157380_10004807 | Ga0157380_100048073 | 383 |
| 200 | 3300025926 | Ga0207659_10068441 | Ga0207659_100684412 | 383 |
| 201 | 3300025961 | Ga0207712_10012628 | Ga0207712_100126284 | 383 |
| 202 | 3300050512 | nmdc:mga0n895_6731_c1 | nmdc:mga0n895_6731_c1_129_1325 | 383 |
| 203 | 3300005456 | Ga0070678_100022073 | Ga0070678_1000220733 | 384 |
| 204 | 3300006852 | Ga0075433_10017448 | Ga0075433_100174483 | 384 |
| 205 | 3300006871 | Ga0075434_100012709 | Ga0075434_1000127096 | 384 |
| 206 | 3300014326 | Ga0157380_10006570 | Ga0157380_100065705 | 384 |
| 207 | 3300025937 | Ga0207669_10006349 | Ga0207669_100063495 | 384 |
| 208 | 3300026121 | Ga0207683_10035549 | Ga0207683_100355493 | 384 |
| 209 | 3300048905 | Ga0496102_0305498 | Ga0496102_0305498_197_1405 | 384 |
| 210 | 3300050515 | nmdc:mga0a205_13169_c1 | nmdc:mga0a205_13169_c1_6360_7556 | 384 |
| 211 | 3300006844 | Ga0075428_100026209 | Ga0075428_1000262092 | 385 |
| 212 | 3300009147 | Ga0114129_10160804 | Ga0114129_101608043 | 385 |
| 213 | 3300050508 | nmdc:mga09592_125927_c1 | nmdc:mga09592_125927_c1_751_1965 | 385 |
| 214 | 3300049590 | Ga0501074_0100293 | Ga0501074_0100293_317_1507 | 386 |
| 215 | 3300049741 | Ga0501079_0060577 | Ga0501079_0060577_80_1270 | 386 |
| 216 | 3300005354 | Ga0070675_100133510 | Ga0070675_1001335102 | 387 |
| 217 | 3300005564 | Ga0070664_100014624 | Ga0070664_1000146247 | 387 |
| 218 | 3300009094 | Ga0111539_10010978 | Ga0111539_100109783 | 388 |
| 219 | 3300014969 | Ga0157376_10073382 | Ga0157376_100733822 | 388 |
| 220 | 3300025926 | Ga0207659_10003596 | Ga0207659_1000359610 | 388 |
| 221 | 3300025926 | Ga0207659_10128805 | Ga0207659_101288052 | 388 |
| 222 | 3300025940 | Ga0207691_10304021 | Ga0207691_103040211 | 388 |
| 223 | 3300046684 | Ga0495669_0004041 | Ga0495669_0004041_4159_5358 | 388 |
| 224 | 3300050511 | nmdc:mga08y16_14178_c1 | nmdc:mga08y16_14178_c1_1145_2356 | 388 |
| 225 | 3300026118 | Ga0207675_100093661 | Ga0207675_1000936612 | 390 |
| 226 | 3300032002 | Ga0307416_100130637 | Ga0307416_1001306373 | 390 |
| 227 | 3300050509 | nmdc:mga0qj67_113732_c1 | nmdc:mga0qj67_113732_c1_322_1608 | 390 |
| 228 | 3300050510 | nmdc:mga06r32_212906_c1 | nmdc:mga06r32_212906_c1_92_1378 | 390 |
| 229 | 3300006844 | Ga0075428_100010847 | Ga0075428_1000108479 | 391 |
| 230 | 3300009094 | Ga0111539_10483615 | Ga0111539_104836151 | 391 |
| 231 | 3300045051 | Ga0451576_0191741 | Ga0451576_0191741_258_1463 | 391 |
| 232 | 3300047318 | Ga0495636_0014150 | Ga0495636_0014150_382_1587 | 391 |
| 233 | 3300053085 | Ga0495619_0020791 | Ga0495619_0020791_441_1649 | 393 |
| 234 | 3300006028 | Ga0070717_10019812 | Ga0070717_100198123 | 395 |
| 235 | 3300005549 | Ga0070704_100067869 | Ga0070704_1000678691 | 396 |
| 236 | 3300027876 | Ga0209974_10019212 | Ga0209974_100192121 | 396 |
| 237 | 3300050507 | nmdc:mga05p37_168474_c1 | nmdc:mga05p37_168474_c1_1463_2659 | 396 |
| 238 | 3300005436 | Ga0070713_100020144 | Ga0070713_1000201443 | 397 |
| 239 | 3300025928 | Ga0207700_10015114 | Ga0207700_100151144 | 397 |
| 240 | 3300005333 | Ga0070677_10020281 | Ga0070677_100202811 | 398 |
| 241 | 3300005456 | Ga0070678_100034754 | Ga0070678_1000347543 | 398 |
| 242 | 3300005719 | Ga0068861_100018493 | Ga0068861_1000184933 | 398 |
| 243 | 3300026089 | Ga0207648_10241265 | Ga0207648_102412651 | 398 |
| 244 | 3300026118 | Ga0207675_100014195 | Ga0207675_1000141955 | 398 |
| 245 | 3300026121 | Ga0207683_10023523 | Ga0207683_100235233 | 398 |
| 246 | 3300061734 | Ga0530510_0121102 | Ga0530510_0121102_632_1876 | 398 |
| 247 | 3300025925 | Ga0207650_10240998 | Ga0207650_102409982 | 399 |
| 248 | 3300032002 | Ga0307416_100011895 | Ga0307416_1000118952 | 401 |
| 249 | 3300005844 | Ga0068862_100051658 | Ga0068862_1000516583 | 402 |
| 250 | 3300006038 | Ga0075365_10026460 | Ga0075365_100264604 | 402 |
| 251 | 3300006051 | Ga0075364_10037596 | Ga0075364_100375963 | 402 |
| 252 | 3300006178 | Ga0075367_10045365 | Ga0075367_100453652 | 402 |
| 253 | 3300006195 | Ga0075366_10005604 | Ga0075366_100056042 | 402 |
| 254 | 3300006844 | Ga0075428_100062062 | Ga0075428_1000620623 | 402 |
| 255 | 3300006880 | Ga0075429_100113482 | Ga0075429_1001134822 | 402 |
| 256 | 3300009094 | Ga0111539_10002910 | Ga0111539_100029106 | 402 |
| 257 | 3300009553 | Ga0105249_10298584 | Ga0105249_102985841 | 402 |
| 258 | 3300025961 | Ga0207712_10191283 | Ga0207712_101912831 | 402 |
| 259 | 3300027907 | Ga0207428_10003247 | Ga0207428_100032476 | 402 |
| 260 | 3300032002 | Ga0307416_100064737 | Ga0307416_1000647371 | 402 |
| 261 | 3300050489 | nmdc:mga03683_12739_c1 | nmdc:mga03683_12739_c1_1641_2861 | 402 |
| 262 | 3300050492 | nmdc:mga0yw44_55315_c1 | nmdc:mga0yw44_55315_c1_1019_2239 | 402 |
| 263 | 3300050493 | nmdc:mga0k408_4489_c1 | nmdc:mga0k408_4489_c1_6075_7295 | 402 |
| 264 | 3300050494 | nmdc:mga06z11_33961_c1 | nmdc:mga06z11_33961_c1_89_1309 | 402 |
| 265 | 3300050508 | nmdc:mga09592_63585_c1 | nmdc:mga09592_63585_c1_1812_3032 | 402 |
| 266 | 3300050511 | nmdc:mga08y16_126832_c1 | nmdc:mga08y16_126832_c1_320_1528 | 402 |
| 267 | 3300050511 | nmdc:mga08y16_8907_c1 | nmdc:mga08y16_8907_c1_4357_5577 | 402 |
| 268 | 3300005577 | Ga0068857_100006921 | Ga0068857_1000069219 | 403 |
| 269 | 3300049571 | Ga0501034_0000065 | Ga0501034_0000065_65241_66524 | 403 |
| 270 | 3300049590 | Ga0501074_0000261 | Ga0501074_0000261_5439_6722 | 403 |
| 271 | 3300060353 | Ga0501082_0072111 | Ga0501082_0072111_1333_2616 | 403 |
| 272 | 3300009147 | Ga0114129_10083143 | Ga0114129_100831432 | 408 |
| 273 | 3300049779 | Ga0501283_001565 | Ga0501283_001565_1271_2599 | 409 |
| 274 | 3300050511 | nmdc:mga08y16_41771_c1 | nmdc:mga08y16_41771_c1_1914_3203 | 409 |
| 275 | 3300003203 | JGI25406J46586_10006103 | JGI25406J46586_100061033 | 411 |
| 276 | 3300005985 | Ga0081539_10001029 | Ga0081539_1000102940 | 411 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5gkv-assembly1.cif.gz_A | crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus | 0.8896 | 12 | 393 |
| 7y3z-assembly2.cif.gz_A | structure of a novel carboxylesterase feh from acinetobacter sp. dl-2 | 0.8826 | 12 | 393 |
| 3zyt-assembly1.cif.gz_A | structure determination of esta from arthrobacter nitroguajacolicus rue61a | 0.8775 | 14 | 393 |
| 5gmx-assembly2.cif.gz_B | crystal structure of a family viii carboxylesterase | 0.8757 | 11 | 394 |
| 5gkv-assembly1.cif.gz_A | crystal structure of a novel penicillin-binding protein (pbp) homolog from caulobacter crescentus | 0.8734 | 12 | 393 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XU43_37_429_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8821 | 14 | 393 | 3.40.710.10 |
| 3zytA00 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8775 | 14 | 393 | 3.40.710.10 |
| af_Q21523_36_427_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8763 | 14 | 393 | 3.40.710.10 |
| af_Q21569_36_429_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8754 | 14 | 393 | 3.40.710.10 |
| af_Q09621_65_456_3.40.710.10 | Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily | 0.8712 | 14 | 393 | 3.40.710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A517MFB6-F1-model_v4 | Beta-lactamase (EC 3.5.2.6) | 0.9609 | 6 | 393 |
GO:0008800
|
| AF-A0A7C1EH67-F1-model_v4 | Class A beta-lactamase-related serine hydrolase | 0.9594 | 9 | 297 |
GO:0016787
|
| AF-A0A016WRC4-F1-model_v4 | Beta-lactamase-related domain-containing protein | 0.9578 | 9 | 199 |
|
| AF-A0A0Q7NBM9-F1-model_v4 | Carboxylesterase | 0.9571 | 7 | 393 |
|
| AF-A0A535TA19-F1-model_v4 | Beta-lactamase family protein | 0.9564 | 12 | 198 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar