F380989

General Info

Members Datasets Scaffolds Average Seq Length
276 157 265 390

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000267|Ga0070665_10000026779
Length 413
Sequence MLIGDCFVPRNDGRIKMDIQRSIKNIAILGSTGSIGTQALEVVSENPALFNAYVLTAQNNAELLIQQSLKFKPAYAIICNEKYYDRVKEALASTEVKVLAGIDAIKDIVTDPAIDMVLTAMVGFAGLEPTINAIKAGKDIALANKETLVVAGELITELAKQHNINILPVDSEHSAIFQCLVGEEHHTIEKVIITASGGPFRGKTLDYLAGVTREDALKHPNWVMGAKITIDSASLMNKGLEVIESKWLFDLDIEQIDVIVHPQSIVHSMVQFRDGSLKAQMGLPDMKLPIQYALTYPGRIENNFKRFDFTNYPSLTFEKPDIKTFRNLAFAFEALKQGGNMPCIINAANEIAVAGFLNNGLSFLAMSDVIEECMLKVGYQAKPTLEDYLNTDKETRIFAQNLIKQIPLKTFTN

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
7 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
8 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
116 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
117 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
154 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
157 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 0
Isolates 3.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.41
Nodule 0
Rhizoplane 0.36
Rhizosphere 76.81
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000842 3300001989 Bacteria 11279
2 JGI24737J22298_10000042 3300001990 Bacteria 37008
3 JGI24743J22301_10013384 3300001991 Bacteria 1502
4 JGI24735J21928_10000014 3300002067 Bacteria 186670
5 JGI24735J21928_10005946 3300002067 Bacteria 4030
6 JGI24744J21845_10006453 3300002077 Bacteria 2434
7 JGI25162J39368_1001975 3300002737 Bacteria 9204
8 JGI25154J39366_1000007 3300002738 Bacteria 335932
9 JGI25157J39369_1002444 3300002741 Bacteria 4627
10 JGI25164J39214_1001162 3300002772 Bacteria 7306
11 JGI25165J46597_1001557 3300003214 Bacteria 11362
12 JGI25153J46596_10003527 3300003215 Bacteria 8726
13 rootH1_10060934 3300003316 Bacteria 17837
14 rootH2_10002871 3300003320 Bacteria 62767
15 rootH2_10063286 3300003320 Bacteria 1592
16 rootH2_10082586 3300003320 Bacteria 2359
17 rootL2_10015332 3300003322 Bacteria 4219
18 rootL2_10172002 3300003322 Bacteria 2150
19 rootL2_10273580 3300003322 Bacteria 3096
20 rootH1_10003212 3300003323 Bacteria 182359
21 rootH1_10042297 3300003323 Bacteria 3812
22 rootH1_10087960 3300003323 Bacteria 9243
23 JGI25160J50197_1005197 3300003354 Bacteria 5459
24 Ga0055528_1000232 3300003790 Bacteria 46543
25 Ga0055530_10008983 3300003791 Bacteria 3909
26 Ga0055531_10000085 3300003794 Bacteria 102372
27 Ga0065165_1000010 3300005262 Bacteria 323737
28 Ga0065714_10002604 3300005288 Bacteria 27641
29 Ga0065714_10075257 3300005288 Bacteria 2924
30 Ga0065714_10076438 3300005288 Bacteria 2788
31 Ga0070658_10000047 3300005327 Bacteria 129483
32 Ga0070658_10148872 3300005327 Bacteria 1959
33 Ga0070676_10003024 3300005328 Bacteria 8695
34 Ga0070683_100021316 3300005329 Bacteria 5782
35 Ga0070660_100072538 3300005339 Bacteria 2691
36 Ga0070660_100091114 3300005339 Bacteria 2404
37 Ga0070671_100001421 3300005355 Bacteria 17898
38 Ga0070673_100061574 3300005364 Bacteria 2978
39 Ga0070688_100061496 3300005365 Bacteria 2374
40 Ga0070659_100001065 3300005366 Bacteria 20070
41 Ga0070659_100002048 3300005366 Bacteria 14397
42 Ga0070659_100002496 3300005366 Bacteria 13069
43 Ga0070663_100009803 3300005455 Bacteria 5950
44 Ga0070678_100018460 3300005456 Bacteria 4520
45 Ga0070662_100009885 3300005457 Bacteria 6249
46 Ga0070662_100205976 3300005457 Bacteria 1563
47 Ga0070681_10006165 3300005458 Bacteria 11644
48 Ga0070681_10018262 3300005458 Bacteria 7010
49 Ga0068867_100003316 3300005459 Bacteria 11340
50 Ga0070679_100079640 3300005530 Bacteria 3265
51 Ga0070679_100127906 3300005530 Bacteria 2522
52 Ga0070665_100000267 3300005548 Bacteria 85526
53 Ga0068855_100000506 3300005563 Bacteria 48223
54 Ga0068855_100000748 3300005563 Bacteria 39873
55 Ga0068855_100009826 3300005563 Bacteria 11542
56 Ga0068855_100029610 3300005563 Bacteria 6544
57 Ga0068857_100069753 3300005577 Bacteria 3130
58 Ga0068856_100022643 3300005614 Bacteria 6109
59 Ga0068852_100005630 3300005616 Bacteria 8986
60 Ga0068852_100215166 3300005616 Bacteria 1825
61 Ga0075366_10000386 3300006195 Bacteria 20464
62 Ga0075366_10002926 3300006195 Bacteria 8877
63 Ga0075366_10008877 3300006195 Bacteria 5599
64 Ga0097621_100000259 3300006237 Bacteria 35593
65 Ga0068871_100000247 3300006358 Bacteria 37582
66 Ga0068865_100002893 3300006881 Bacteria 10236
67 Ga0105240_10000728 3300009093 Bacteria 60140
68 Ga0105240_10018402 3300009093 Bacteria 9380
69 Ga0105240_10093164 3300009093 Bacteria 3677
70 Ga0105240_10128819 3300009093 Bacteria 3038
71 Ga0105240_10209593 3300009093 Bacteria 2278
72 Ga0105245_10283654 3300009098 Bacteria 1620
73 Ga0105241_10002347 3300009174 Bacteria 14220
74 Ga0105241_10011646 3300009174 Bacteria 6453
75 Ga0105241_10090537 3300009174 Bacteria 2413
76 Ga0105242_10050492 3300009176 Bacteria 3387
77 Ga0105237_10000622 3300009545 Bacteria 49566
78 Ga0105237_10000717 3300009545 Bacteria 45892
79 Ga0105237_10004898 3300009545 Bacteria 15327
80 Ga0105237_10009042 3300009545 Bacteria 10708
81 Ga0105237_10095593 3300009545 Bacteria 2961
82 Ga0105237_10294604 3300009545 Bacteria 1625
83 Ga0105238_10034246 3300009551 Bacteria 5168
84 Ga0105239_10000005 3300010375 Bacteria 496066
85 Ga0105239_10000010 3300010375 Bacteria 341545
86 Ga0105239_10000887 3300010375 Bacteria 42411
87 Ga0105239_10001617 3300010375 Bacteria 29762
88 Ga0105239_10003996 3300010375 Bacteria 17861
89 Ga0105239_10025928 3300010375 Bacteria 6455
90 Ga0105239_10032964 3300010375 Bacteria 5690
91 Ga0105239_10053123 3300010375 Bacteria 4445
92 Ga0105239_10053315 3300010375 Bacteria 4437
93 Ga0105246_10026914 3300011119 Bacteria 3763
94 Ga0157373_10000128 3300013100 Bacteria 59306
95 Ga0157373_10001208 3300013100 Bacteria 19728
96 Ga0157373_10004894 3300013100 Bacteria 10082
97 Ga0157373_10044702 3300013100 Bacteria 3162
98 Ga0157371_10000216 3300013102 Bacteria 83975
99 Ga0157371_10001331 3300013102 Bacteria 25968
100 Ga0157371_10008303 3300013102 Bacteria 8293
101 Ga0157371_10116774 3300013102 Bacteria 1896
102 Ga0157370_10022940 3300013104 Bacteria 6203
103 Ga0157370_10036224 3300013104 Bacteria 4789
104 Ga0157370_10110713 3300013104 Bacteria 2567
105 Ga0157369_10001212 3300013105 Bacteria 32139
106 Ga0157369_10032683 3300013105 Bacteria 5719
107 Ga0157369_10124425 3300013105 Bacteria 2735
108 Ga0157374_10001231 3300013296 Bacteria 21878
109 Ga0157374_10003261 3300013296 Bacteria 13627
110 Ga0157374_10091543 3300013296 Bacteria 2900
111 Ga0157374_10306758 3300013296 Bacteria 1571
112 Ga0157378_10084670 3300013297 Bacteria 2871
113 Ga0157378_10103279 3300013297 Bacteria 2604
114 Ga0163162_10000034 3300013306 Bacteria 149611
115 Ga0163162_10010526 3300013306 Bacteria 8995
116 Ga0163162_10243259 3300013306 Bacteria 1930
117 Ga0157372_10000021 3300013307 Bacteria 207801
118 Ga0157372_10002015 3300013307 Bacteria 22086
119 Ga0157372_10004302 3300013307 Bacteria 15224
120 Ga0157372_10023185 3300013307 Bacteria 6727
121 Ga0157372_10025438 3300013307 Bacteria 6436
122 Ga0157372_10193043 3300013307 Bacteria 2358
123 Ga0157375_10006092 3300013308 Bacteria 10514
124 Ga0157375_10172764 3300013308 Bacteria 2309
125 Ga0163161_10036304 3300017792 Bacteria 3529
126 Ga0213872_10003957 3300021361 Bacteria 8000
127 Ga0207427_100085 3300025231 Bacteria 142561
128 Ga0209437_100024 3300025233 Bacteria 592878
129 Ga0209437_100052 3300025233 Bacteria 380548
130 Ga0209646_1000002 3300025246 Bacteria 1425781
131 Ga0209026_1000086 3300025250 Bacteria 185551
132 Ga0209026_1000390 3300025250 Bacteria 39167
133 Ga0209026_1000595 3300025250 Bacteria 23580
134 Ga0209233_1000067 3300025261 Bacteria 380554
135 Ga0209233_1007086 3300025261 Bacteria 3576
136 Ga0209233_1010247 3300025261 Bacteria 2819
137 Ga0209233_1024504 3300025261 Bacteria 1507
138 Ga0209673_1000082 3300025273 Bacteria 219716
139 Ga0209564_1015350 3300025295 Bacteria 3121
140 Ga0209758_1002611 3300025297 Bacteria 17961
141 Ga0207426_1000419 3300025302 Bacteria 69963
142 Ga0207426_1001628 3300025302 Bacteria 17671
143 Ga0209051_1031940 3300025303 Bacteria 2017
144 Ga0209257_1000001 3300025304 Bacteria 2274655
145 Ga0207647_10000098 3300025904 Bacteria 67170
146 Ga0207647_10000104 3300025904 Bacteria 65696
147 Ga0207647_10020568 3300025904 Bacteria 4423
148 Ga0207645_10003564 3300025907 Bacteria 11781
149 Ga0207705_10000052 3300025909 Bacteria 168319
150 Ga0207654_10005033 3300025911 Bacteria 6676
151 Ga0207654_10014953 3300025911 Bacteria 4018
152 Ga0207654_10035008 3300025911 Bacteria 2795
153 Ga0207707_10037077 3300025912 Bacteria 4260
154 Ga0207695_10000189 3300025913 Bacteria 177142
155 Ga0207695_10005513 3300025913 Bacteria 16753
156 Ga0207695_10212138 3300025913 Bacteria 1846
157 Ga0207671_10003566 3300025914 Bacteria 15409
158 Ga0207671_10006381 3300025914 Bacteria 10515
159 Ga0207671_10007561 3300025914 Bacteria 9410
160 Ga0207671_10010457 3300025914 Bacteria 7655
161 Ga0207671_10051689 3300025914 Bacteria 3045
162 Ga0207671_10205141 3300025914 Bacteria 1540
163 Ga0207657_10076110 3300025919 Bacteria 2832
164 Ga0207657_10114519 3300025919 Bacteria 2224
165 Ga0207652_10000029 3300025921 Bacteria 149054
166 Ga0207652_10095595 3300025921 Bacteria 2617
167 Ga0207652_10100771 3300025921 Bacteria 2550
168 Ga0207644_10001351 3300025931 Bacteria 15777
169 Ga0207690_10008777 3300025932 Bacteria 5999
170 Ga0207690_10009292 3300025932 Bacteria 5842
171 Ga0207706_10000176 3300025933 Bacteria 70917
172 Ga0207704_10056162 3300025938 Bacteria 2410
173 Ga0207691_10172604 3300025940 Bacteria 1893
174 Ga0207661_10014578 3300025944 Bacteria 5766
175 Ga0207667_10000375 3300025949 Bacteria 60547
176 Ga0207667_10002384 3300025949 Bacteria 23511
177 Ga0207667_10002632 3300025949 Bacteria 22201
178 Ga0207667_10041730 3300025949 Bacteria 4879
179 Ga0207667_10091894 3300025949 Bacteria 3135
180 Ga0207651_10008311 3300025960 Bacteria 5599
181 Ga0207639_10125380 3300026041 Bacteria 2117
182 Ga0207678_10013801 3300026067 Bacteria 7099
183 Ga0207702_10002568 3300026078 Bacteria 17064
184 Ga0207702_10034792 3300026078 Bacteria 4214
185 Ga0207648_10000294 3300026089 Bacteria 54322
186 Ga0207674_10064540 3300026116 Bacteria 3693
187 Ga0207683_10007945 3300026121 Bacteria 9076
188 Ga0268266_10000018 3300028379 Bacteria 569141
189 Ga0307517_10001867 3300028786 Bacteria 34483
190 Ga0307515_10005287 3300028794 Bacteria 26245
191 Ga0307515_10017194 3300028794 Bacteria 13192
192 Ga0265338_10002270 3300028800 Bacteria 29274
193 Ga0265338_10022389 3300028800 Bacteria 6543
194 Ga0265327_10000270 3300031251 Bacteria 102617
195 Ga0307405_10042084 3300031731 Bacteria 2778
196 Ga0307414_10119951 3300032004 Bacteria 2020
197 Ga0307507_10002030 3300033179 Bacteria 43887
198 Ga0307510_10005272 3300033180 Bacteria 15373
199 Ga0373941_0007429 3300035115 Bacteria 2681
200 Ga0395899_0000002 3300037312 Bacteria 1324310
201 Ga0395899_0001327 3300037312 Bacteria 21244
202 Ga0395899_0007925 3300037312 Bacteria 8181
203 Ga0395899_0013968 3300037312 Bacteria 6133
204 Ga0395900_0000181 3300037418 Bacteria 101531
205 Ga0395900_0001549 3300037418 Bacteria 27320
206 Ga0395900_0002285 3300037418 Bacteria 21289
207 Ga0395900_0013073 3300037418 Bacteria 8482
208 Ga0395900_0173876 3300037418 Bacteria 2191
209 Ga0395898_0004777 3300037466 Bacteria 14740
210 Ga0395898_0036944 3300037466 Bacteria 4848
211 Ga0395905_0002197 3300037471 Bacteria 22041
212 Ga0395905_0003309 3300037471 Bacteria 17296
213 Ga0395901_0011043 3300038443 Bacteria 9149
214 Ga0395901_0063792 3300038443 Bacteria 3835
215 Ga0436361_0199837 3300039447 Bacteria 14699
216 Ga0439449_0015536 3300042007 Bacteria 2862
217 Ga0453683_0068759 3300044673 Bacteria 2214
218 Ga0466966_0015715 3300044684 Bacteria 5005
219 Ga0466961_0021113 3300044693 Bacteria 4191
220 Ga0466958_0026064 3300045836 Bacteria 3453
221 Ga0495627_002327 3300046453 Bacteria 9319
222 Ga0495650_0000003 3300046471 Bacteria 900730
223 Ga0495585_0000085 3300046492 Bacteria 97836
224 Ga0495585_0001353 3300046492 Bacteria 19417
225 Ga0495606_0000145 3300046507 Bacteria 122857
226 Ga0495606_0018198 3300046507 Bacteria 5279
227 Ga0495610_0002148 3300046512 Bacteria 16763
228 Ga0495616_0006043 3300046513 Bacteria 7378
229 Ga0495644_0011798 3300046523 Bacteria 3363
230 Ga0495648_0000813 3300046524 Bacteria 33045
231 Ga0495648_0106925 3300046524 Bacteria 1530
232 Ga0495609_0009549 3300046538 Bacteria 4690
233 Ga0495633_0000069 3300046558 Bacteria 135128
234 Ga0495633_0000154 3300046558 Bacteria 90209
235 Ga0495633_0014938 3300046558 Bacteria 4037
236 Ga0495668_0000044 3300046616 Bacteria 227585
237 Ga0495625_0000005 3300046660 Bacteria 596135
238 Ga0495625_0000248 3300046660 Bacteria 84339
239 Ga0495625_0001880 3300046660 Bacteria 23825
240 Ga0495625_0055762 3300046660 Bacteria 2817
241 Ga0495625_0081323 3300046660 Bacteria 2255
242 Ga0495661_0000511 3300046665 Bacteria 40405
243 Ga0495661_0016228 3300046665 Bacteria 4944
244 Ga0495671_0033456 3300046692 Bacteria 2619
245 Ga0495649_0000003 3300046694 Bacteria 880817
246 Ga0495660_0012596 3300046810 Bacteria 4908
247 Ga0495683_0028934 3300047323 Bacteria 2832
248 Ga0495687_000672 3300047443 Bacteria 38920
249 Ga0495687_002396 3300047443 Bacteria 15120
250 Ga0495686_0000367 3300047472 Bacteria 73112
251 Ga0495686_0006142 3300047472 Bacteria 9291
252 Ga0495686_0033041 3300047472 Bacteria 3343
253 Ga0501047_0012511 3300049581 Bacteria 8037
254 Ga0501223_000621 3300049663 Bacteria 8515
255 nmdc:mga0k408_2981_c1 3300050493 Bacteria 6809
256 nmdc:mga0k408_342_c1 3300050493 Bacteria 25447
257 nmdc:mga0k408_4661_c1 3300050493 Bacteria 7265
258 Ga0500635_0000424 3300053080 Bacteria 12390
259 Ga0500635_0010556 3300053080 Bacteria 2598
260 Ga0500608_000736 3300053122 Bacteria 11950
261 Ga0500618_000002 3300053125 Bacteria 370822
262 Ga0500642_0011456 3300053130 Bacteria 3173
263 Ga0500622_0000077 3300053156 Bacteria 108558
264 Ga0500622_0000477 3300053156 Bacteria 37687
265 Ga0500624_000271 3300053157 Bacteria 17926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0018198 Ga0495606_0018198_1019_2062 347
2 3300003320 rootH2_10082586 rootH2_100825863 355
3 3300005329 Ga0070683_100021316 Ga0070683_1000213162 355
4 3300013100 Ga0157373_10000128 Ga0157373_1000012842 355
5 3300013307 Ga0157372_10023185 Ga0157372_100231854 355
6 3300025250 Ga0209026_1000390 Ga0209026_100039013 355
7 3300025944 Ga0207661_10014578 Ga0207661_100145784 355
8 3300003794 Ga0055531_10000085 Ga0055531_1000008550 357
9 3300010375 Ga0105239_10053315 Ga0105239_100533153 357
10 3300025304 Ga0209257_1000001 Ga0209257_10000011215 357
11 3300042007 Ga0439449_0015536 Ga0439449_0015536_965_2131 357
12 3300046453 Ga0495627_002327 Ga0495627_002327_7254_8420 357
13 3300046558 Ga0495633_0000154 Ga0495633_0000154_38083_39249 357
14 3300053156 Ga0500622_0000077 Ga0500622_0000077_39180_40346 357
15 3300003322 rootL2_10015332 rootL2_100153322 358
16 3300049581 Ga0501047_0012511 Ga0501047_0012511_4767_5933 358
17 3300002738 JGI25154J39366_1000007 JGI25154J39366_1000007162 359
18 3300002741 JGI25157J39369_1002444 JGI25157J39369_10024442 359
19 3300003215 JGI25153J46596_10003527 JGI25153J46596_100035277 359
20 3300003323 rootH1_10042297 rootH1_100422973 359
21 3300025246 Ga0209646_1000002 Ga0209646_1000002767 359
22 3300025250 Ga0209026_1000086 Ga0209026_100008631 359
23 3300025297 Ga0209758_1002611 Ga0209758_10026112 359
24 3300025302 Ga0207426_1000419 Ga0207426_100041956 359
25 3300005577 Ga0068857_100069753 Ga0068857_1000697533 366
26 3300026116 Ga0207674_10064540 Ga0207674_100645402 366
27 3300005288 Ga0065714_10002604 Ga0065714_1000260419 367
28 3300010375 Ga0105239_10025928 Ga0105239_100259287 369
29 3300013308 Ga0157375_10006092 Ga0157375_100060927 369
30 3300047443 Ga0495687_002396 Ga0495687_002396_2316_3497 369
31 3300005339 Ga0070660_100072538 Ga0070660_1000725382 370
32 3300005366 Ga0070659_100002496 Ga0070659_1000024965 370
33 3300025919 Ga0207657_10076110 Ga0207657_100761102 370
34 3300025932 Ga0207690_10008777 Ga0207690_100087773 370
35 3300053080 Ga0500635_0010556 Ga0500635_0010556_1454_2569 371
36 3300037312 Ga0395899_0007925 Ga0395899_0007925_1432_2556 374
37 3300037418 Ga0395900_0001549 Ga0395900_0001549_14344_15468 374
38 3300037466 Ga0395898_0036944 Ga0395898_0036944_992_2116 374
39 3300037471 Ga0395905_0003309 Ga0395905_0003309_1865_2989 374
40 iso_pu_bacteria 2910245624 2910249274 380
41 3300031251 Ga0265327_10000270 Ga0265327_1000027057 382
42 3300003320 rootH2_10002871 rootH2_1000287158 383
43 iso_pu_bacteria 2929921140 2929923492 384
44 iso_pu_bacteria 8003151029 8003152894 384
45 3300028786 Ga0307517_10001867 Ga0307517_100018674 385
46 3300031731 Ga0307405_10042084 Ga0307405_100420842 385
47 3300032004 Ga0307414_10119951 Ga0307414_101199513 385
48 3300049663 Ga0501223_000621 Ga0501223_000621_3794_4951 385
49 3300003322 rootL2_10273580 rootL2_102735802 386
50 3300013104 Ga0157370_10022940 Ga0157370_100229405 386
51 3300028800 Ga0265338_10002270 Ga0265338_1000227014 386
52 3300044673 Ga0453683_0068759 Ga0453683_0068759_227_1390 386
53 iso_pu_bacteria 2852623160 2852623793 386
54 3300005365 Ga0070688_100061496 Ga0070688_1000614962 387
55 3300005458 Ga0070681_10018262 Ga0070681_100182622 387
56 3300013100 Ga0157373_10004894 Ga0157373_100048946 387
57 3300013102 Ga0157371_10001331 Ga0157371_100013312 387
58 3300013105 Ga0157369_10124425 Ga0157369_101244252 387
59 3300025919 Ga0207657_10114519 Ga0207657_101145192 387
60 3300025921 Ga0207652_10000029 Ga0207652_1000002960 387
61 3300037418 Ga0395900_0002285 Ga0395900_0002285_4819_5985 387
62 3300037418 Ga0395900_0173876 Ga0395900_0173876_554_1720 387
63 3300037466 Ga0395898_0004777 Ga0395898_0004777_11804_12970 387
64 3300038443 Ga0395901_0063792 Ga0395901_0063792_2249_3415 387
65 3300046660 Ga0495625_0081323 Ga0495625_0081323_910_2100 387
66 3300053156 Ga0500622_0000477 Ga0500622_0000477_22467_23657 387
67 3300003354 JGI25160J50197_1005197 JGI25160J50197_10051977 388
68 3300003790 Ga0055528_1000232 Ga0055528_100023241 388
69 3300003791 Ga0055530_10008983 Ga0055530_100089831 388
70 3300005262 Ga0065165_1000010 Ga0065165_1000010104 388
71 3300006195 Ga0075366_10008877 Ga0075366_100088774 388
72 3300013102 Ga0157371_10116774 Ga0157371_101167742 388
73 3300025273 Ga0209673_1000082 Ga0209673_100008278 388
74 3300025295 Ga0209564_1015350 Ga0209564_10153503 388
75 3300025302 Ga0207426_1001628 Ga0207426_100162811 388
76 3300025303 Ga0209051_1031940 Ga0209051_10319401 388
77 3300050493 nmdc:mga0k408_2981_c1 nmdc:mga0k408_2981_c1_2669_3841 388
78 3300025261 Ga0209233_1024504 Ga0209233_10245042 389
79 iso_pu_bacteria 2599185184 2599477713 391
80 iso_pu_bacteria 2919437846 2919441668 391
81 iso_pu_bacteria 2928078545 2928079629 391
82 iso_pu_bacteria 2928147474 2928147895 391
83 iso_pu_bacteria 2932082852 2932086747 391
84 3300005366 Ga0070659_100002048 Ga0070659_1000020481 392
85 3300001991 JGI24743J22301_10013384 JGI24743J22301_100133842 393
86 3300002077 JGI24744J21845_10006453 JGI24744J21845_100064532 393
87 3300005328 Ga0070676_10003024 Ga0070676_100030246 393
88 3300005339 Ga0070660_100091114 Ga0070660_1000911142 393
89 3300005355 Ga0070671_100001421 Ga0070671_10000142110 393
90 3300005364 Ga0070673_100061574 Ga0070673_1000615742 393
91 3300005456 Ga0070678_100018460 Ga0070678_1000184603 393
92 3300005457 Ga0070662_100009885 Ga0070662_1000098854 393
93 3300005459 Ga0068867_100003316 Ga0068867_1000033163 393
94 3300005530 Ga0070679_100127906 Ga0070679_1001279062 393
95 3300005616 Ga0068852_100005630 Ga0068852_1000056306 393
96 3300006237 Ga0097621_100000259 Ga0097621_10000025922 393
97 3300006358 Ga0068871_100000247 Ga0068871_1000002472 393
98 3300006881 Ga0068865_100002893 Ga0068865_1000028933 393
99 3300009093 Ga0105240_10018402 Ga0105240_100184025 393
100 3300009174 Ga0105241_10002347 Ga0105241_1000234713 393
101 3300009174 Ga0105241_10011646 Ga0105241_100116466 393
102 3300009176 Ga0105242_10050492 Ga0105242_100504922 393
103 3300009551 Ga0105238_10034246 Ga0105238_100342463 393
104 3300011119 Ga0105246_10026914 Ga0105246_100269144 393
105 3300013100 Ga0157373_10044702 Ga0157373_100447022 393
106 3300013296 Ga0157374_10001231 Ga0157374_1000123120 393
107 3300013296 Ga0157374_10003261 Ga0157374_100032612 393
108 3300013296 Ga0157374_10091543 Ga0157374_100915432 393
109 3300013297 Ga0157378_10084670 Ga0157378_100846702 393
110 3300013297 Ga0157378_10103279 Ga0157378_101032792 393
111 3300013307 Ga0157372_10193043 Ga0157372_101930432 393
112 3300025904 Ga0207647_10000098 Ga0207647_1000009845 393
113 3300025907 Ga0207645_10003564 Ga0207645_1000356410 393
114 3300025911 Ga0207654_10005033 Ga0207654_100050332 393
115 3300025911 Ga0207654_10035008 Ga0207654_100350082 393
116 3300025913 Ga0207695_10005513 Ga0207695_100055136 393
117 3300025921 Ga0207652_10100771 Ga0207652_101007712 393
118 3300025931 Ga0207644_10001351 Ga0207644_1000135110 393
119 3300025933 Ga0207706_10000176 Ga0207706_1000017648 393
120 3300025938 Ga0207704_10056162 Ga0207704_100561622 393
121 3300025940 Ga0207691_10172604 Ga0207691_101726042 393
122 3300025960 Ga0207651_10008311 Ga0207651_100083113 393
123 3300026041 Ga0207639_10125380 Ga0207639_101253802 393
124 3300026089 Ga0207648_10000294 Ga0207648_1000029452 393
125 3300026121 Ga0207683_10007945 Ga0207683_100079457 393
126 3300037312 Ga0395899_0013968 Ga0395899_0013968_4308_5489 393
127 3300037418 Ga0395900_0000181 Ga0395900_0000181_39394_40575 393
128 3300037418 Ga0395900_0013073 Ga0395900_0013073_938_2119 393
129 3300037471 Ga0395905_0002197 Ga0395905_0002197_19922_21103 393
130 3300038443 Ga0395901_0011043 Ga0395901_0011043_3808_4989 393
131 3300053130 Ga0500642_0011456 Ga0500642_0011456_1839_3020 393
132 3300002737 JGI25162J39368_1001975 JGI25162J39368_10019754 394
133 3300002772 JGI25164J39214_1001162 JGI25164J39214_10011624 394
134 3300003214 JGI25165J46597_1001557 JGI25165J46597_10015577 394
135 3300003323 rootH1_10003212 rootH1_10003212131 394
136 3300003323 rootH1_10087960 rootH1_100879604 394
137 3300005288 Ga0065714_10076438 Ga0065714_100764382 394
138 3300005455 Ga0070663_100009803 Ga0070663_1000098036 394
139 3300005458 Ga0070681_10006165 Ga0070681_100061655 394
140 3300005530 Ga0070679_100079640 Ga0070679_1000796402 394
141 3300005563 Ga0068855_100000506 Ga0068855_10000050638 394
142 3300005563 Ga0068855_100000748 Ga0068855_10000074826 394
143 3300009093 Ga0105240_10000728 Ga0105240_1000072833 394
144 3300009093 Ga0105240_10128819 Ga0105240_101288192 394
145 3300009174 Ga0105241_10090537 Ga0105241_100905372 394
146 3300009545 Ga0105237_10000622 Ga0105237_1000062223 394
147 3300009545 Ga0105237_10000717 Ga0105237_1000071712 394
148 3300010375 Ga0105239_10000010 Ga0105239_10000010246 394
149 3300010375 Ga0105239_10001617 Ga0105239_1000161716 394
150 3300013104 Ga0157370_10110713 Ga0157370_101107132 394
151 3300013105 Ga0157369_10001212 Ga0157369_1000121212 394
152 3300013296 Ga0157374_10306758 Ga0157374_103067582 394
153 3300013306 Ga0163162_10010526 Ga0163162_100105264 394
154 3300013306 Ga0163162_10243259 Ga0163162_102432592 394
155 3300013307 Ga0157372_10000021 Ga0157372_1000002194 394
156 3300025231 Ga0207427_100085 Ga0207427_10008555 394
157 3300025233 Ga0209437_100052 Ga0209437_100052189 394
158 3300025261 Ga0209233_1000067 Ga0209233_1000067189 394
159 3300025261 Ga0209233_1007086 Ga0209233_10070862 394
160 3300025911 Ga0207654_10014953 Ga0207654_100149533 394
161 3300025912 Ga0207707_10037077 Ga0207707_100370772 394
162 3300025913 Ga0207695_10000189 Ga0207695_10000189132 394
163 3300025913 Ga0207695_10212138 Ga0207695_102121382 394
164 3300025914 Ga0207671_10006381 Ga0207671_100063817 394
165 3300025914 Ga0207671_10010457 Ga0207671_100104574 394
166 3300025921 Ga0207652_10095595 Ga0207652_100955952 394
167 3300025949 Ga0207667_10000375 Ga0207667_1000037548 394
168 3300025949 Ga0207667_10002632 Ga0207667_100026328 394
169 3300026067 Ga0207678_10013801 Ga0207678_100138012 394
170 3300028800 Ga0265338_10022389 Ga0265338_100223893 394
171 3300035115 Ga0373941_0007429 Ga0373941_0007429_541_1767 394
172 3300037312 Ga0395899_0000002 Ga0395899_0000002_1285757_1286941 394
173 3300037312 Ga0395899_0001327 Ga0395899_0001327_3544_4737 394
174 3300044684 Ga0466966_0015715 Ga0466966_0015715_1117_2310 394
175 3300044693 Ga0466961_0021113 Ga0466961_0021113_1681_2874 394
176 3300045836 Ga0466958_0026064 Ga0466958_0026064_784_1977 394
177 3300046492 Ga0495585_0000085 Ga0495585_0000085_21825_23009 394
178 3300046660 Ga0495625_0055762 Ga0495625_0055762_814_1998 394
179 3300046665 Ga0495661_0000511 Ga0495661_0000511_4073_5257 394
180 3300047472 Ga0495686_0006142 Ga0495686_0006142_4013_5200 394
181 3300001989 JGI24739J22299_10000842 JGI24739J22299_100008426 395
182 3300001990 JGI24737J22298_10000042 JGI24737J22298_1000004220 395
183 3300002067 JGI24735J21928_10000014 JGI24735J21928_1000001462 395
184 3300002067 JGI24735J21928_10005946 JGI24735J21928_100059464 395
185 3300003316 rootH1_10060934 rootH1_100609344 395
186 3300003320 rootH2_10063286 rootH2_100632862 395
187 3300003322 rootL2_10172002 rootL2_101720021 395
188 3300005288 Ga0065714_10075257 Ga0065714_100752572 395
189 3300005327 Ga0070658_10000047 Ga0070658_1000004784 395
190 3300005327 Ga0070658_10148872 Ga0070658_101488722 395
191 3300005366 Ga0070659_100001065 Ga0070659_10000106510 395
192 3300005457 Ga0070662_100205976 Ga0070662_1002059762 395
193 3300005548 Ga0070665_100000267 Ga0070665_10000026779 395
194 3300005563 Ga0068855_100009826 Ga0068855_1000098263 395
195 3300005563 Ga0068855_100029610 Ga0068855_1000296103 395
196 3300005614 Ga0068856_100022643 Ga0068856_1000226434 395
197 3300005616 Ga0068852_100215166 Ga0068852_1002151662 395
198 3300006195 Ga0075366_10000386 Ga0075366_1000038611 395
199 3300006195 Ga0075366_10002926 Ga0075366_100029264 395
200 3300009093 Ga0105240_10093164 Ga0105240_100931643 395
201 3300009093 Ga0105240_10209593 Ga0105240_102095932 395
202 3300009098 Ga0105245_10283654 Ga0105245_102836542 395
203 3300009545 Ga0105237_10004898 Ga0105237_100048989 395
204 3300009545 Ga0105237_10009042 Ga0105237_100090426 395
205 3300009545 Ga0105237_10095593 Ga0105237_100955933 395
206 3300009545 Ga0105237_10294604 Ga0105237_102946041 395
207 3300010375 Ga0105239_10000005 Ga0105239_10000005144 395
208 3300010375 Ga0105239_10000887 Ga0105239_1000088710 395
209 3300010375 Ga0105239_10003996 Ga0105239_100039966 395
210 3300010375 Ga0105239_10032964 Ga0105239_100329645 395
211 3300010375 Ga0105239_10053123 Ga0105239_100531231 395
212 3300013100 Ga0157373_10001208 Ga0157373_1000120816 395
213 3300013102 Ga0157371_10000216 Ga0157371_1000021620 395
214 3300013102 Ga0157371_10008303 Ga0157371_100083034 395
215 3300013104 Ga0157370_10036224 Ga0157370_100362243 395
216 3300013105 Ga0157369_10032683 Ga0157369_100326831 395
217 3300013306 Ga0163162_10000034 Ga0163162_10000034113 395
218 3300013307 Ga0157372_10002015 Ga0157372_1000201511 395
219 3300013307 Ga0157372_10004302 Ga0157372_100043026 395
220 3300013307 Ga0157372_10025438 Ga0157372_100254386 395
221 3300013308 Ga0157375_10172764 Ga0157375_101727642 395
222 3300017792 Ga0163161_10036304 Ga0163161_100363041 395
223 3300021361 Ga0213872_10003957 Ga0213872_100039571 395
224 3300025233 Ga0209437_100024 Ga0209437_100024498 395
225 3300025250 Ga0209026_1000595 Ga0209026_100059526 395
226 3300025261 Ga0209233_1010247 Ga0209233_10102472 395
227 3300025904 Ga0207647_10000104 Ga0207647_1000010420 395
228 3300025904 Ga0207647_10020568 Ga0207647_100205682 395
229 3300025909 Ga0207705_10000052 Ga0207705_1000005285 395
230 3300025914 Ga0207671_10003566 Ga0207671_100035667 395
231 3300025914 Ga0207671_10007561 Ga0207671_1000756111 395
232 3300025914 Ga0207671_10051689 Ga0207671_100516893 395
233 3300025914 Ga0207671_10205141 Ga0207671_102051412 395
234 3300025932 Ga0207690_10009292 Ga0207690_100092925 395
235 3300025949 Ga0207667_10002384 Ga0207667_1000238413 395
236 3300025949 Ga0207667_10041730 Ga0207667_100417302 395
237 3300025949 Ga0207667_10091894 Ga0207667_100918943 395
238 3300026078 Ga0207702_10002568 Ga0207702_100025687 395
239 3300026078 Ga0207702_10034792 Ga0207702_100347922 395
240 3300028379 Ga0268266_10000018 Ga0268266_10000018483 395
241 3300028794 Ga0307515_10005287 Ga0307515_1000528711 395
242 3300028794 Ga0307515_10017194 Ga0307515_100171949 395
243 3300033179 Ga0307507_10002030 Ga0307507_1000203033 395
244 3300033180 Ga0307510_10005272 Ga0307510_100052723 395
245 3300039447 Ga0436361_0199837 Ga0436361_0199837_12354_13550 395
246 3300046471 Ga0495650_0000003 Ga0495650_0000003_119899_121086 395
247 3300046492 Ga0495585_0001353 Ga0495585_0001353_11433_12620 395
248 3300046507 Ga0495606_0000145 Ga0495606_0000145_66940_68127 395
249 3300046512 Ga0495610_0002148 Ga0495610_0002148_2945_4132 395
250 3300046513 Ga0495616_0006043 Ga0495616_0006043_5070_6257 395
251 3300046523 Ga0495644_0011798 Ga0495644_0011798_1845_3056 395
252 3300046524 Ga0495648_0000813 Ga0495648_0000813_7202_8389 395
253 3300046524 Ga0495648_0106925 Ga0495648_0106925_137_1324 395
254 3300046538 Ga0495609_0009549 Ga0495609_0009549_2254_3441 395
255 3300046558 Ga0495633_0000069 Ga0495633_0000069_121820_123007 395
256 3300046558 Ga0495633_0014938 Ga0495633_0014938_2838_4025 395
257 3300046616 Ga0495668_0000044 Ga0495668_0000044_425_1612 395
258 3300046660 Ga0495625_0000005 Ga0495625_0000005_236908_238095 395
259 3300046660 Ga0495625_0000248 Ga0495625_0000248_79719_80906 395
260 3300046660 Ga0495625_0001880 Ga0495625_0001880_8463_9650 395
261 3300046665 Ga0495661_0016228 Ga0495661_0016228_2096_3283 395
262 3300046692 Ga0495671_0033456 Ga0495671_0033456_860_2047 395
263 3300046694 Ga0495649_0000003 Ga0495649_0000003_236930_238117 395
264 3300046810 Ga0495660_0012596 Ga0495660_0012596_1899_3086 395
265 3300047323 Ga0495683_0028934 Ga0495683_0028934_1434_2621 395
266 3300047443 Ga0495687_000672 Ga0495687_000672_121_1308 395
267 3300047472 Ga0495686_0000367 Ga0495686_0000367_53771_54958 395
268 3300047472 Ga0495686_0033041 Ga0495686_0033041_1231_2418 395
269 3300050493 nmdc:mga0k408_342_c1 nmdc:mga0k408_342_c1_17588_18775 395
270 3300050493 nmdc:mga0k408_4661_c1 nmdc:mga0k408_4661_c1_2589_3776 395
271 3300053080 Ga0500635_0000424 Ga0500635_0000424_10762_11952 395
272 3300053122 Ga0500608_000736 Ga0500608_000736_1179_2366 395
273 3300053125 Ga0500618_000002 Ga0500618_000002_102492_103679 395
274 3300053157 Ga0500624_000271 Ga0500624_000271_1702_2889 395
275 iso_pu_bacteria 2884933994 2884937302 395
276 iso_pu_bacteria 2977232053 2977235793 395

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02670

DXP_reductoisom

1-deoxy-D-xylulose 5-phosphate reductoisomerase

26

152

0.99

PF08436

DXP_redisom_C

1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain

166

249

0.99

PF13288

DXPR_C

DXP reductoisomerase C-terminal domain

281

398

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mh5-assembly1.cif.gz_A crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from staphylococcus schleiferi in complex with fosmidomycin (fom) 0.9669 5 378
1q0h-assembly1.cif.gz_A crystal structure of selenomethionine-labelled dxr in complex with fosmidomycin 0.9641 5 390
1r0k-assembly2.cif.gz_D crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis 0.9631 4 387
7s04-assembly1.cif.gz_A-2 1-deoxy-d-xylulose 5-phosphate reductoisomerase (ispc) from acinetobacter baumannii in complex with fr900098, nadph, and a magnesium ion 0.9615 6 389
1r0k-assembly2.cif.gz_C crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis 0.9609 4 390
ID Description Score Start End Superfamily
5kqoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9695 4 152 3.40.50.720
4zn6B03 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9665 310 386 1.10.1740.10
af_A0A1D6MNI9_107_243_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9649 21 152 3.40.50.720
af_I1MM97_67_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 6 152 3.40.50.720
4zqhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9575 5 152 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2J6HIP4-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase 0.9965 296 388 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-W2CC69-F1-model_v4 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (EC 1.1.1.267) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) 0.9941 4 389 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A418XPW4-F1-model_v4 1-deoxy-D-xylulose-5-phosphate reductoisomerase 0.9938 4 142 GO:0016853
GO:0030145
GO:0030604
GO:0051484
GO:0070402
AF-A0A4Q8S3C4-F1-model_v4 deleted 0.9937 4 389
AF-A0A660WYM9-F1-model_v4 deleted 0.9924 188 384

Feature Viewer

pLDDT pTM Quality
94.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map