F380989
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 276 | 157 | 265 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100000267|Ga0070665_10000026779 |
| Length | 413 |
| Sequence | MLIGDCFVPRNDGRIKMDIQRSIKNIAILGSTGSIGTQALEVVSENPALFNAYVLTAQNNAELLIQQSLKFKPAYAIICNEKYYDRVKEALASTEVKVLAGIDAIKDIVTDPAIDMVLTAMVGFAGLEPTINAIKAGKDIALANKETLVVAGELITELAKQHNINILPVDSEHSAIFQCLVGEEHHTIEKVIITASGGPFRGKTLDYLAGVTREDALKHPNWVMGAKITIDSASLMNKGLEVIESKWLFDLDIEQIDVIVHPQSIVHSMVQFRDGSLKAQMGLPDMKLPIQYALTYPGRIENNFKRFDFTNYPSLTFEKPDIKTFRNLAFAFEALKQGGNMPCIINAANEIAVAGFLNNGLSFLAMSDVIEECMLKVGYQAKPTLEDYLNTDKETRIFAQNLIKQIPLKTFTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 5 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 6 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 7 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 8 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 9 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 10 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 18 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 19 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 74 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 77 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 110 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 111 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 116 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 117 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 124 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 125 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 126 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 127 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 128 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 129 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 150 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 151 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 152 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 153 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 154 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 155 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 156 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 157 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.01 |
| Metatranscriptomes | 0 |
| Isolates | 3.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.41 |
| Nodule | 0 |
| Rhizoplane | 0.36 |
| Rhizosphere | 76.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10000842 | 3300001989 | Bacteria | 11279 |
| 2 | JGI24737J22298_10000042 | 3300001990 | Bacteria | 37008 |
| 3 | JGI24743J22301_10013384 | 3300001991 | Bacteria | 1502 |
| 4 | JGI24735J21928_10000014 | 3300002067 | Bacteria | 186670 |
| 5 | JGI24735J21928_10005946 | 3300002067 | Bacteria | 4030 |
| 6 | JGI24744J21845_10006453 | 3300002077 | Bacteria | 2434 |
| 7 | JGI25162J39368_1001975 | 3300002737 | Bacteria | 9204 |
| 8 | JGI25154J39366_1000007 | 3300002738 | Bacteria | 335932 |
| 9 | JGI25157J39369_1002444 | 3300002741 | Bacteria | 4627 |
| 10 | JGI25164J39214_1001162 | 3300002772 | Bacteria | 7306 |
| 11 | JGI25165J46597_1001557 | 3300003214 | Bacteria | 11362 |
| 12 | JGI25153J46596_10003527 | 3300003215 | Bacteria | 8726 |
| 13 | rootH1_10060934 | 3300003316 | Bacteria | 17837 |
| 14 | rootH2_10002871 | 3300003320 | Bacteria | 62767 |
| 15 | rootH2_10063286 | 3300003320 | Bacteria | 1592 |
| 16 | rootH2_10082586 | 3300003320 | Bacteria | 2359 |
| 17 | rootL2_10015332 | 3300003322 | Bacteria | 4219 |
| 18 | rootL2_10172002 | 3300003322 | Bacteria | 2150 |
| 19 | rootL2_10273580 | 3300003322 | Bacteria | 3096 |
| 20 | rootH1_10003212 | 3300003323 | Bacteria | 182359 |
| 21 | rootH1_10042297 | 3300003323 | Bacteria | 3812 |
| 22 | rootH1_10087960 | 3300003323 | Bacteria | 9243 |
| 23 | JGI25160J50197_1005197 | 3300003354 | Bacteria | 5459 |
| 24 | Ga0055528_1000232 | 3300003790 | Bacteria | 46543 |
| 25 | Ga0055530_10008983 | 3300003791 | Bacteria | 3909 |
| 26 | Ga0055531_10000085 | 3300003794 | Bacteria | 102372 |
| 27 | Ga0065165_1000010 | 3300005262 | Bacteria | 323737 |
| 28 | Ga0065714_10002604 | 3300005288 | Bacteria | 27641 |
| 29 | Ga0065714_10075257 | 3300005288 | Bacteria | 2924 |
| 30 | Ga0065714_10076438 | 3300005288 | Bacteria | 2788 |
| 31 | Ga0070658_10000047 | 3300005327 | Bacteria | 129483 |
| 32 | Ga0070658_10148872 | 3300005327 | Bacteria | 1959 |
| 33 | Ga0070676_10003024 | 3300005328 | Bacteria | 8695 |
| 34 | Ga0070683_100021316 | 3300005329 | Bacteria | 5782 |
| 35 | Ga0070660_100072538 | 3300005339 | Bacteria | 2691 |
| 36 | Ga0070660_100091114 | 3300005339 | Bacteria | 2404 |
| 37 | Ga0070671_100001421 | 3300005355 | Bacteria | 17898 |
| 38 | Ga0070673_100061574 | 3300005364 | Bacteria | 2978 |
| 39 | Ga0070688_100061496 | 3300005365 | Bacteria | 2374 |
| 40 | Ga0070659_100001065 | 3300005366 | Bacteria | 20070 |
| 41 | Ga0070659_100002048 | 3300005366 | Bacteria | 14397 |
| 42 | Ga0070659_100002496 | 3300005366 | Bacteria | 13069 |
| 43 | Ga0070663_100009803 | 3300005455 | Bacteria | 5950 |
| 44 | Ga0070678_100018460 | 3300005456 | Bacteria | 4520 |
| 45 | Ga0070662_100009885 | 3300005457 | Bacteria | 6249 |
| 46 | Ga0070662_100205976 | 3300005457 | Bacteria | 1563 |
| 47 | Ga0070681_10006165 | 3300005458 | Bacteria | 11644 |
| 48 | Ga0070681_10018262 | 3300005458 | Bacteria | 7010 |
| 49 | Ga0068867_100003316 | 3300005459 | Bacteria | 11340 |
| 50 | Ga0070679_100079640 | 3300005530 | Bacteria | 3265 |
| 51 | Ga0070679_100127906 | 3300005530 | Bacteria | 2522 |
| 52 | Ga0070665_100000267 | 3300005548 | Bacteria | 85526 |
| 53 | Ga0068855_100000506 | 3300005563 | Bacteria | 48223 |
| 54 | Ga0068855_100000748 | 3300005563 | Bacteria | 39873 |
| 55 | Ga0068855_100009826 | 3300005563 | Bacteria | 11542 |
| 56 | Ga0068855_100029610 | 3300005563 | Bacteria | 6544 |
| 57 | Ga0068857_100069753 | 3300005577 | Bacteria | 3130 |
| 58 | Ga0068856_100022643 | 3300005614 | Bacteria | 6109 |
| 59 | Ga0068852_100005630 | 3300005616 | Bacteria | 8986 |
| 60 | Ga0068852_100215166 | 3300005616 | Bacteria | 1825 |
| 61 | Ga0075366_10000386 | 3300006195 | Bacteria | 20464 |
| 62 | Ga0075366_10002926 | 3300006195 | Bacteria | 8877 |
| 63 | Ga0075366_10008877 | 3300006195 | Bacteria | 5599 |
| 64 | Ga0097621_100000259 | 3300006237 | Bacteria | 35593 |
| 65 | Ga0068871_100000247 | 3300006358 | Bacteria | 37582 |
| 66 | Ga0068865_100002893 | 3300006881 | Bacteria | 10236 |
| 67 | Ga0105240_10000728 | 3300009093 | Bacteria | 60140 |
| 68 | Ga0105240_10018402 | 3300009093 | Bacteria | 9380 |
| 69 | Ga0105240_10093164 | 3300009093 | Bacteria | 3677 |
| 70 | Ga0105240_10128819 | 3300009093 | Bacteria | 3038 |
| 71 | Ga0105240_10209593 | 3300009093 | Bacteria | 2278 |
| 72 | Ga0105245_10283654 | 3300009098 | Bacteria | 1620 |
| 73 | Ga0105241_10002347 | 3300009174 | Bacteria | 14220 |
| 74 | Ga0105241_10011646 | 3300009174 | Bacteria | 6453 |
| 75 | Ga0105241_10090537 | 3300009174 | Bacteria | 2413 |
| 76 | Ga0105242_10050492 | 3300009176 | Bacteria | 3387 |
| 77 | Ga0105237_10000622 | 3300009545 | Bacteria | 49566 |
| 78 | Ga0105237_10000717 | 3300009545 | Bacteria | 45892 |
| 79 | Ga0105237_10004898 | 3300009545 | Bacteria | 15327 |
| 80 | Ga0105237_10009042 | 3300009545 | Bacteria | 10708 |
| 81 | Ga0105237_10095593 | 3300009545 | Bacteria | 2961 |
| 82 | Ga0105237_10294604 | 3300009545 | Bacteria | 1625 |
| 83 | Ga0105238_10034246 | 3300009551 | Bacteria | 5168 |
| 84 | Ga0105239_10000005 | 3300010375 | Bacteria | 496066 |
| 85 | Ga0105239_10000010 | 3300010375 | Bacteria | 341545 |
| 86 | Ga0105239_10000887 | 3300010375 | Bacteria | 42411 |
| 87 | Ga0105239_10001617 | 3300010375 | Bacteria | 29762 |
| 88 | Ga0105239_10003996 | 3300010375 | Bacteria | 17861 |
| 89 | Ga0105239_10025928 | 3300010375 | Bacteria | 6455 |
| 90 | Ga0105239_10032964 | 3300010375 | Bacteria | 5690 |
| 91 | Ga0105239_10053123 | 3300010375 | Bacteria | 4445 |
| 92 | Ga0105239_10053315 | 3300010375 | Bacteria | 4437 |
| 93 | Ga0105246_10026914 | 3300011119 | Bacteria | 3763 |
| 94 | Ga0157373_10000128 | 3300013100 | Bacteria | 59306 |
| 95 | Ga0157373_10001208 | 3300013100 | Bacteria | 19728 |
| 96 | Ga0157373_10004894 | 3300013100 | Bacteria | 10082 |
| 97 | Ga0157373_10044702 | 3300013100 | Bacteria | 3162 |
| 98 | Ga0157371_10000216 | 3300013102 | Bacteria | 83975 |
| 99 | Ga0157371_10001331 | 3300013102 | Bacteria | 25968 |
| 100 | Ga0157371_10008303 | 3300013102 | Bacteria | 8293 |
| 101 | Ga0157371_10116774 | 3300013102 | Bacteria | 1896 |
| 102 | Ga0157370_10022940 | 3300013104 | Bacteria | 6203 |
| 103 | Ga0157370_10036224 | 3300013104 | Bacteria | 4789 |
| 104 | Ga0157370_10110713 | 3300013104 | Bacteria | 2567 |
| 105 | Ga0157369_10001212 | 3300013105 | Bacteria | 32139 |
| 106 | Ga0157369_10032683 | 3300013105 | Bacteria | 5719 |
| 107 | Ga0157369_10124425 | 3300013105 | Bacteria | 2735 |
| 108 | Ga0157374_10001231 | 3300013296 | Bacteria | 21878 |
| 109 | Ga0157374_10003261 | 3300013296 | Bacteria | 13627 |
| 110 | Ga0157374_10091543 | 3300013296 | Bacteria | 2900 |
| 111 | Ga0157374_10306758 | 3300013296 | Bacteria | 1571 |
| 112 | Ga0157378_10084670 | 3300013297 | Bacteria | 2871 |
| 113 | Ga0157378_10103279 | 3300013297 | Bacteria | 2604 |
| 114 | Ga0163162_10000034 | 3300013306 | Bacteria | 149611 |
| 115 | Ga0163162_10010526 | 3300013306 | Bacteria | 8995 |
| 116 | Ga0163162_10243259 | 3300013306 | Bacteria | 1930 |
| 117 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 118 | Ga0157372_10002015 | 3300013307 | Bacteria | 22086 |
| 119 | Ga0157372_10004302 | 3300013307 | Bacteria | 15224 |
| 120 | Ga0157372_10023185 | 3300013307 | Bacteria | 6727 |
| 121 | Ga0157372_10025438 | 3300013307 | Bacteria | 6436 |
| 122 | Ga0157372_10193043 | 3300013307 | Bacteria | 2358 |
| 123 | Ga0157375_10006092 | 3300013308 | Bacteria | 10514 |
| 124 | Ga0157375_10172764 | 3300013308 | Bacteria | 2309 |
| 125 | Ga0163161_10036304 | 3300017792 | Bacteria | 3529 |
| 126 | Ga0213872_10003957 | 3300021361 | Bacteria | 8000 |
| 127 | Ga0207427_100085 | 3300025231 | Bacteria | 142561 |
| 128 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 129 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 130 | Ga0209646_1000002 | 3300025246 | Bacteria | 1425781 |
| 131 | Ga0209026_1000086 | 3300025250 | Bacteria | 185551 |
| 132 | Ga0209026_1000390 | 3300025250 | Bacteria | 39167 |
| 133 | Ga0209026_1000595 | 3300025250 | Bacteria | 23580 |
| 134 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 135 | Ga0209233_1007086 | 3300025261 | Bacteria | 3576 |
| 136 | Ga0209233_1010247 | 3300025261 | Bacteria | 2819 |
| 137 | Ga0209233_1024504 | 3300025261 | Bacteria | 1507 |
| 138 | Ga0209673_1000082 | 3300025273 | Bacteria | 219716 |
| 139 | Ga0209564_1015350 | 3300025295 | Bacteria | 3121 |
| 140 | Ga0209758_1002611 | 3300025297 | Bacteria | 17961 |
| 141 | Ga0207426_1000419 | 3300025302 | Bacteria | 69963 |
| 142 | Ga0207426_1001628 | 3300025302 | Bacteria | 17671 |
| 143 | Ga0209051_1031940 | 3300025303 | Bacteria | 2017 |
| 144 | Ga0209257_1000001 | 3300025304 | Bacteria | 2274655 |
| 145 | Ga0207647_10000098 | 3300025904 | Bacteria | 67170 |
| 146 | Ga0207647_10000104 | 3300025904 | Bacteria | 65696 |
| 147 | Ga0207647_10020568 | 3300025904 | Bacteria | 4423 |
| 148 | Ga0207645_10003564 | 3300025907 | Bacteria | 11781 |
| 149 | Ga0207705_10000052 | 3300025909 | Bacteria | 168319 |
| 150 | Ga0207654_10005033 | 3300025911 | Bacteria | 6676 |
| 151 | Ga0207654_10014953 | 3300025911 | Bacteria | 4018 |
| 152 | Ga0207654_10035008 | 3300025911 | Bacteria | 2795 |
| 153 | Ga0207707_10037077 | 3300025912 | Bacteria | 4260 |
| 154 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 155 | Ga0207695_10005513 | 3300025913 | Bacteria | 16753 |
| 156 | Ga0207695_10212138 | 3300025913 | Bacteria | 1846 |
| 157 | Ga0207671_10003566 | 3300025914 | Bacteria | 15409 |
| 158 | Ga0207671_10006381 | 3300025914 | Bacteria | 10515 |
| 159 | Ga0207671_10007561 | 3300025914 | Bacteria | 9410 |
| 160 | Ga0207671_10010457 | 3300025914 | Bacteria | 7655 |
| 161 | Ga0207671_10051689 | 3300025914 | Bacteria | 3045 |
| 162 | Ga0207671_10205141 | 3300025914 | Bacteria | 1540 |
| 163 | Ga0207657_10076110 | 3300025919 | Bacteria | 2832 |
| 164 | Ga0207657_10114519 | 3300025919 | Bacteria | 2224 |
| 165 | Ga0207652_10000029 | 3300025921 | Bacteria | 149054 |
| 166 | Ga0207652_10095595 | 3300025921 | Bacteria | 2617 |
| 167 | Ga0207652_10100771 | 3300025921 | Bacteria | 2550 |
| 168 | Ga0207644_10001351 | 3300025931 | Bacteria | 15777 |
| 169 | Ga0207690_10008777 | 3300025932 | Bacteria | 5999 |
| 170 | Ga0207690_10009292 | 3300025932 | Bacteria | 5842 |
| 171 | Ga0207706_10000176 | 3300025933 | Bacteria | 70917 |
| 172 | Ga0207704_10056162 | 3300025938 | Bacteria | 2410 |
| 173 | Ga0207691_10172604 | 3300025940 | Bacteria | 1893 |
| 174 | Ga0207661_10014578 | 3300025944 | Bacteria | 5766 |
| 175 | Ga0207667_10000375 | 3300025949 | Bacteria | 60547 |
| 176 | Ga0207667_10002384 | 3300025949 | Bacteria | 23511 |
| 177 | Ga0207667_10002632 | 3300025949 | Bacteria | 22201 |
| 178 | Ga0207667_10041730 | 3300025949 | Bacteria | 4879 |
| 179 | Ga0207667_10091894 | 3300025949 | Bacteria | 3135 |
| 180 | Ga0207651_10008311 | 3300025960 | Bacteria | 5599 |
| 181 | Ga0207639_10125380 | 3300026041 | Bacteria | 2117 |
| 182 | Ga0207678_10013801 | 3300026067 | Bacteria | 7099 |
| 183 | Ga0207702_10002568 | 3300026078 | Bacteria | 17064 |
| 184 | Ga0207702_10034792 | 3300026078 | Bacteria | 4214 |
| 185 | Ga0207648_10000294 | 3300026089 | Bacteria | 54322 |
| 186 | Ga0207674_10064540 | 3300026116 | Bacteria | 3693 |
| 187 | Ga0207683_10007945 | 3300026121 | Bacteria | 9076 |
| 188 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 189 | Ga0307517_10001867 | 3300028786 | Bacteria | 34483 |
| 190 | Ga0307515_10005287 | 3300028794 | Bacteria | 26245 |
| 191 | Ga0307515_10017194 | 3300028794 | Bacteria | 13192 |
| 192 | Ga0265338_10002270 | 3300028800 | Bacteria | 29274 |
| 193 | Ga0265338_10022389 | 3300028800 | Bacteria | 6543 |
| 194 | Ga0265327_10000270 | 3300031251 | Bacteria | 102617 |
| 195 | Ga0307405_10042084 | 3300031731 | Bacteria | 2778 |
| 196 | Ga0307414_10119951 | 3300032004 | Bacteria | 2020 |
| 197 | Ga0307507_10002030 | 3300033179 | Bacteria | 43887 |
| 198 | Ga0307510_10005272 | 3300033180 | Bacteria | 15373 |
| 199 | Ga0373941_0007429 | 3300035115 | Bacteria | 2681 |
| 200 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 201 | Ga0395899_0001327 | 3300037312 | Bacteria | 21244 |
| 202 | Ga0395899_0007925 | 3300037312 | Bacteria | 8181 |
| 203 | Ga0395899_0013968 | 3300037312 | Bacteria | 6133 |
| 204 | Ga0395900_0000181 | 3300037418 | Bacteria | 101531 |
| 205 | Ga0395900_0001549 | 3300037418 | Bacteria | 27320 |
| 206 | Ga0395900_0002285 | 3300037418 | Bacteria | 21289 |
| 207 | Ga0395900_0013073 | 3300037418 | Bacteria | 8482 |
| 208 | Ga0395900_0173876 | 3300037418 | Bacteria | 2191 |
| 209 | Ga0395898_0004777 | 3300037466 | Bacteria | 14740 |
| 210 | Ga0395898_0036944 | 3300037466 | Bacteria | 4848 |
| 211 | Ga0395905_0002197 | 3300037471 | Bacteria | 22041 |
| 212 | Ga0395905_0003309 | 3300037471 | Bacteria | 17296 |
| 213 | Ga0395901_0011043 | 3300038443 | Bacteria | 9149 |
| 214 | Ga0395901_0063792 | 3300038443 | Bacteria | 3835 |
| 215 | Ga0436361_0199837 | 3300039447 | Bacteria | 14699 |
| 216 | Ga0439449_0015536 | 3300042007 | Bacteria | 2862 |
| 217 | Ga0453683_0068759 | 3300044673 | Bacteria | 2214 |
| 218 | Ga0466966_0015715 | 3300044684 | Bacteria | 5005 |
| 219 | Ga0466961_0021113 | 3300044693 | Bacteria | 4191 |
| 220 | Ga0466958_0026064 | 3300045836 | Bacteria | 3453 |
| 221 | Ga0495627_002327 | 3300046453 | Bacteria | 9319 |
| 222 | Ga0495650_0000003 | 3300046471 | Bacteria | 900730 |
| 223 | Ga0495585_0000085 | 3300046492 | Bacteria | 97836 |
| 224 | Ga0495585_0001353 | 3300046492 | Bacteria | 19417 |
| 225 | Ga0495606_0000145 | 3300046507 | Bacteria | 122857 |
| 226 | Ga0495606_0018198 | 3300046507 | Bacteria | 5279 |
| 227 | Ga0495610_0002148 | 3300046512 | Bacteria | 16763 |
| 228 | Ga0495616_0006043 | 3300046513 | Bacteria | 7378 |
| 229 | Ga0495644_0011798 | 3300046523 | Bacteria | 3363 |
| 230 | Ga0495648_0000813 | 3300046524 | Bacteria | 33045 |
| 231 | Ga0495648_0106925 | 3300046524 | Bacteria | 1530 |
| 232 | Ga0495609_0009549 | 3300046538 | Bacteria | 4690 |
| 233 | Ga0495633_0000069 | 3300046558 | Bacteria | 135128 |
| 234 | Ga0495633_0000154 | 3300046558 | Bacteria | 90209 |
| 235 | Ga0495633_0014938 | 3300046558 | Bacteria | 4037 |
| 236 | Ga0495668_0000044 | 3300046616 | Bacteria | 227585 |
| 237 | Ga0495625_0000005 | 3300046660 | Bacteria | 596135 |
| 238 | Ga0495625_0000248 | 3300046660 | Bacteria | 84339 |
| 239 | Ga0495625_0001880 | 3300046660 | Bacteria | 23825 |
| 240 | Ga0495625_0055762 | 3300046660 | Bacteria | 2817 |
| 241 | Ga0495625_0081323 | 3300046660 | Bacteria | 2255 |
| 242 | Ga0495661_0000511 | 3300046665 | Bacteria | 40405 |
| 243 | Ga0495661_0016228 | 3300046665 | Bacteria | 4944 |
| 244 | Ga0495671_0033456 | 3300046692 | Bacteria | 2619 |
| 245 | Ga0495649_0000003 | 3300046694 | Bacteria | 880817 |
| 246 | Ga0495660_0012596 | 3300046810 | Bacteria | 4908 |
| 247 | Ga0495683_0028934 | 3300047323 | Bacteria | 2832 |
| 248 | Ga0495687_000672 | 3300047443 | Bacteria | 38920 |
| 249 | Ga0495687_002396 | 3300047443 | Bacteria | 15120 |
| 250 | Ga0495686_0000367 | 3300047472 | Bacteria | 73112 |
| 251 | Ga0495686_0006142 | 3300047472 | Bacteria | 9291 |
| 252 | Ga0495686_0033041 | 3300047472 | Bacteria | 3343 |
| 253 | Ga0501047_0012511 | 3300049581 | Bacteria | 8037 |
| 254 | Ga0501223_000621 | 3300049663 | Bacteria | 8515 |
| 255 | nmdc:mga0k408_2981_c1 | 3300050493 | Bacteria | 6809 |
| 256 | nmdc:mga0k408_342_c1 | 3300050493 | Bacteria | 25447 |
| 257 | nmdc:mga0k408_4661_c1 | 3300050493 | Bacteria | 7265 |
| 258 | Ga0500635_0000424 | 3300053080 | Bacteria | 12390 |
| 259 | Ga0500635_0010556 | 3300053080 | Bacteria | 2598 |
| 260 | Ga0500608_000736 | 3300053122 | Bacteria | 11950 |
| 261 | Ga0500618_000002 | 3300053125 | Bacteria | 370822 |
| 262 | Ga0500642_0011456 | 3300053130 | Bacteria | 3173 |
| 263 | Ga0500622_0000077 | 3300053156 | Bacteria | 108558 |
| 264 | Ga0500622_0000477 | 3300053156 | Bacteria | 37687 |
| 265 | Ga0500624_000271 | 3300053157 | Bacteria | 17926 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046507 | Ga0495606_0018198 | Ga0495606_0018198_1019_2062 | 347 |
| 2 | 3300003320 | rootH2_10082586 | rootH2_100825863 | 355 |
| 3 | 3300005329 | Ga0070683_100021316 | Ga0070683_1000213162 | 355 |
| 4 | 3300013100 | Ga0157373_10000128 | Ga0157373_1000012842 | 355 |
| 5 | 3300013307 | Ga0157372_10023185 | Ga0157372_100231854 | 355 |
| 6 | 3300025250 | Ga0209026_1000390 | Ga0209026_100039013 | 355 |
| 7 | 3300025944 | Ga0207661_10014578 | Ga0207661_100145784 | 355 |
| 8 | 3300003794 | Ga0055531_10000085 | Ga0055531_1000008550 | 357 |
| 9 | 3300010375 | Ga0105239_10053315 | Ga0105239_100533153 | 357 |
| 10 | 3300025304 | Ga0209257_1000001 | Ga0209257_10000011215 | 357 |
| 11 | 3300042007 | Ga0439449_0015536 | Ga0439449_0015536_965_2131 | 357 |
| 12 | 3300046453 | Ga0495627_002327 | Ga0495627_002327_7254_8420 | 357 |
| 13 | 3300046558 | Ga0495633_0000154 | Ga0495633_0000154_38083_39249 | 357 |
| 14 | 3300053156 | Ga0500622_0000077 | Ga0500622_0000077_39180_40346 | 357 |
| 15 | 3300003322 | rootL2_10015332 | rootL2_100153322 | 358 |
| 16 | 3300049581 | Ga0501047_0012511 | Ga0501047_0012511_4767_5933 | 358 |
| 17 | 3300002738 | JGI25154J39366_1000007 | JGI25154J39366_1000007162 | 359 |
| 18 | 3300002741 | JGI25157J39369_1002444 | JGI25157J39369_10024442 | 359 |
| 19 | 3300003215 | JGI25153J46596_10003527 | JGI25153J46596_100035277 | 359 |
| 20 | 3300003323 | rootH1_10042297 | rootH1_100422973 | 359 |
| 21 | 3300025246 | Ga0209646_1000002 | Ga0209646_1000002767 | 359 |
| 22 | 3300025250 | Ga0209026_1000086 | Ga0209026_100008631 | 359 |
| 23 | 3300025297 | Ga0209758_1002611 | Ga0209758_10026112 | 359 |
| 24 | 3300025302 | Ga0207426_1000419 | Ga0207426_100041956 | 359 |
| 25 | 3300005577 | Ga0068857_100069753 | Ga0068857_1000697533 | 366 |
| 26 | 3300026116 | Ga0207674_10064540 | Ga0207674_100645402 | 366 |
| 27 | 3300005288 | Ga0065714_10002604 | Ga0065714_1000260419 | 367 |
| 28 | 3300010375 | Ga0105239_10025928 | Ga0105239_100259287 | 369 |
| 29 | 3300013308 | Ga0157375_10006092 | Ga0157375_100060927 | 369 |
| 30 | 3300047443 | Ga0495687_002396 | Ga0495687_002396_2316_3497 | 369 |
| 31 | 3300005339 | Ga0070660_100072538 | Ga0070660_1000725382 | 370 |
| 32 | 3300005366 | Ga0070659_100002496 | Ga0070659_1000024965 | 370 |
| 33 | 3300025919 | Ga0207657_10076110 | Ga0207657_100761102 | 370 |
| 34 | 3300025932 | Ga0207690_10008777 | Ga0207690_100087773 | 370 |
| 35 | 3300053080 | Ga0500635_0010556 | Ga0500635_0010556_1454_2569 | 371 |
| 36 | 3300037312 | Ga0395899_0007925 | Ga0395899_0007925_1432_2556 | 374 |
| 37 | 3300037418 | Ga0395900_0001549 | Ga0395900_0001549_14344_15468 | 374 |
| 38 | 3300037466 | Ga0395898_0036944 | Ga0395898_0036944_992_2116 | 374 |
| 39 | 3300037471 | Ga0395905_0003309 | Ga0395905_0003309_1865_2989 | 374 |
| 40 | iso_pu_bacteria | 2910245624 | 2910249274 | 380 |
| 41 | 3300031251 | Ga0265327_10000270 | Ga0265327_1000027057 | 382 |
| 42 | 3300003320 | rootH2_10002871 | rootH2_1000287158 | 383 |
| 43 | iso_pu_bacteria | 2929921140 | 2929923492 | 384 |
| 44 | iso_pu_bacteria | 8003151029 | 8003152894 | 384 |
| 45 | 3300028786 | Ga0307517_10001867 | Ga0307517_100018674 | 385 |
| 46 | 3300031731 | Ga0307405_10042084 | Ga0307405_100420842 | 385 |
| 47 | 3300032004 | Ga0307414_10119951 | Ga0307414_101199513 | 385 |
| 48 | 3300049663 | Ga0501223_000621 | Ga0501223_000621_3794_4951 | 385 |
| 49 | 3300003322 | rootL2_10273580 | rootL2_102735802 | 386 |
| 50 | 3300013104 | Ga0157370_10022940 | Ga0157370_100229405 | 386 |
| 51 | 3300028800 | Ga0265338_10002270 | Ga0265338_1000227014 | 386 |
| 52 | 3300044673 | Ga0453683_0068759 | Ga0453683_0068759_227_1390 | 386 |
| 53 | iso_pu_bacteria | 2852623160 | 2852623793 | 386 |
| 54 | 3300005365 | Ga0070688_100061496 | Ga0070688_1000614962 | 387 |
| 55 | 3300005458 | Ga0070681_10018262 | Ga0070681_100182622 | 387 |
| 56 | 3300013100 | Ga0157373_10004894 | Ga0157373_100048946 | 387 |
| 57 | 3300013102 | Ga0157371_10001331 | Ga0157371_100013312 | 387 |
| 58 | 3300013105 | Ga0157369_10124425 | Ga0157369_101244252 | 387 |
| 59 | 3300025919 | Ga0207657_10114519 | Ga0207657_101145192 | 387 |
| 60 | 3300025921 | Ga0207652_10000029 | Ga0207652_1000002960 | 387 |
| 61 | 3300037418 | Ga0395900_0002285 | Ga0395900_0002285_4819_5985 | 387 |
| 62 | 3300037418 | Ga0395900_0173876 | Ga0395900_0173876_554_1720 | 387 |
| 63 | 3300037466 | Ga0395898_0004777 | Ga0395898_0004777_11804_12970 | 387 |
| 64 | 3300038443 | Ga0395901_0063792 | Ga0395901_0063792_2249_3415 | 387 |
| 65 | 3300046660 | Ga0495625_0081323 | Ga0495625_0081323_910_2100 | 387 |
| 66 | 3300053156 | Ga0500622_0000477 | Ga0500622_0000477_22467_23657 | 387 |
| 67 | 3300003354 | JGI25160J50197_1005197 | JGI25160J50197_10051977 | 388 |
| 68 | 3300003790 | Ga0055528_1000232 | Ga0055528_100023241 | 388 |
| 69 | 3300003791 | Ga0055530_10008983 | Ga0055530_100089831 | 388 |
| 70 | 3300005262 | Ga0065165_1000010 | Ga0065165_1000010104 | 388 |
| 71 | 3300006195 | Ga0075366_10008877 | Ga0075366_100088774 | 388 |
| 72 | 3300013102 | Ga0157371_10116774 | Ga0157371_101167742 | 388 |
| 73 | 3300025273 | Ga0209673_1000082 | Ga0209673_100008278 | 388 |
| 74 | 3300025295 | Ga0209564_1015350 | Ga0209564_10153503 | 388 |
| 75 | 3300025302 | Ga0207426_1001628 | Ga0207426_100162811 | 388 |
| 76 | 3300025303 | Ga0209051_1031940 | Ga0209051_10319401 | 388 |
| 77 | 3300050493 | nmdc:mga0k408_2981_c1 | nmdc:mga0k408_2981_c1_2669_3841 | 388 |
| 78 | 3300025261 | Ga0209233_1024504 | Ga0209233_10245042 | 389 |
| 79 | iso_pu_bacteria | 2599185184 | 2599477713 | 391 |
| 80 | iso_pu_bacteria | 2919437846 | 2919441668 | 391 |
| 81 | iso_pu_bacteria | 2928078545 | 2928079629 | 391 |
| 82 | iso_pu_bacteria | 2928147474 | 2928147895 | 391 |
| 83 | iso_pu_bacteria | 2932082852 | 2932086747 | 391 |
| 84 | 3300005366 | Ga0070659_100002048 | Ga0070659_1000020481 | 392 |
| 85 | 3300001991 | JGI24743J22301_10013384 | JGI24743J22301_100133842 | 393 |
| 86 | 3300002077 | JGI24744J21845_10006453 | JGI24744J21845_100064532 | 393 |
| 87 | 3300005328 | Ga0070676_10003024 | Ga0070676_100030246 | 393 |
| 88 | 3300005339 | Ga0070660_100091114 | Ga0070660_1000911142 | 393 |
| 89 | 3300005355 | Ga0070671_100001421 | Ga0070671_10000142110 | 393 |
| 90 | 3300005364 | Ga0070673_100061574 | Ga0070673_1000615742 | 393 |
| 91 | 3300005456 | Ga0070678_100018460 | Ga0070678_1000184603 | 393 |
| 92 | 3300005457 | Ga0070662_100009885 | Ga0070662_1000098854 | 393 |
| 93 | 3300005459 | Ga0068867_100003316 | Ga0068867_1000033163 | 393 |
| 94 | 3300005530 | Ga0070679_100127906 | Ga0070679_1001279062 | 393 |
| 95 | 3300005616 | Ga0068852_100005630 | Ga0068852_1000056306 | 393 |
| 96 | 3300006237 | Ga0097621_100000259 | Ga0097621_10000025922 | 393 |
| 97 | 3300006358 | Ga0068871_100000247 | Ga0068871_1000002472 | 393 |
| 98 | 3300006881 | Ga0068865_100002893 | Ga0068865_1000028933 | 393 |
| 99 | 3300009093 | Ga0105240_10018402 | Ga0105240_100184025 | 393 |
| 100 | 3300009174 | Ga0105241_10002347 | Ga0105241_1000234713 | 393 |
| 101 | 3300009174 | Ga0105241_10011646 | Ga0105241_100116466 | 393 |
| 102 | 3300009176 | Ga0105242_10050492 | Ga0105242_100504922 | 393 |
| 103 | 3300009551 | Ga0105238_10034246 | Ga0105238_100342463 | 393 |
| 104 | 3300011119 | Ga0105246_10026914 | Ga0105246_100269144 | 393 |
| 105 | 3300013100 | Ga0157373_10044702 | Ga0157373_100447022 | 393 |
| 106 | 3300013296 | Ga0157374_10001231 | Ga0157374_1000123120 | 393 |
| 107 | 3300013296 | Ga0157374_10003261 | Ga0157374_100032612 | 393 |
| 108 | 3300013296 | Ga0157374_10091543 | Ga0157374_100915432 | 393 |
| 109 | 3300013297 | Ga0157378_10084670 | Ga0157378_100846702 | 393 |
| 110 | 3300013297 | Ga0157378_10103279 | Ga0157378_101032792 | 393 |
| 111 | 3300013307 | Ga0157372_10193043 | Ga0157372_101930432 | 393 |
| 112 | 3300025904 | Ga0207647_10000098 | Ga0207647_1000009845 | 393 |
| 113 | 3300025907 | Ga0207645_10003564 | Ga0207645_1000356410 | 393 |
| 114 | 3300025911 | Ga0207654_10005033 | Ga0207654_100050332 | 393 |
| 115 | 3300025911 | Ga0207654_10035008 | Ga0207654_100350082 | 393 |
| 116 | 3300025913 | Ga0207695_10005513 | Ga0207695_100055136 | 393 |
| 117 | 3300025921 | Ga0207652_10100771 | Ga0207652_101007712 | 393 |
| 118 | 3300025931 | Ga0207644_10001351 | Ga0207644_1000135110 | 393 |
| 119 | 3300025933 | Ga0207706_10000176 | Ga0207706_1000017648 | 393 |
| 120 | 3300025938 | Ga0207704_10056162 | Ga0207704_100561622 | 393 |
| 121 | 3300025940 | Ga0207691_10172604 | Ga0207691_101726042 | 393 |
| 122 | 3300025960 | Ga0207651_10008311 | Ga0207651_100083113 | 393 |
| 123 | 3300026041 | Ga0207639_10125380 | Ga0207639_101253802 | 393 |
| 124 | 3300026089 | Ga0207648_10000294 | Ga0207648_1000029452 | 393 |
| 125 | 3300026121 | Ga0207683_10007945 | Ga0207683_100079457 | 393 |
| 126 | 3300037312 | Ga0395899_0013968 | Ga0395899_0013968_4308_5489 | 393 |
| 127 | 3300037418 | Ga0395900_0000181 | Ga0395900_0000181_39394_40575 | 393 |
| 128 | 3300037418 | Ga0395900_0013073 | Ga0395900_0013073_938_2119 | 393 |
| 129 | 3300037471 | Ga0395905_0002197 | Ga0395905_0002197_19922_21103 | 393 |
| 130 | 3300038443 | Ga0395901_0011043 | Ga0395901_0011043_3808_4989 | 393 |
| 131 | 3300053130 | Ga0500642_0011456 | Ga0500642_0011456_1839_3020 | 393 |
| 132 | 3300002737 | JGI25162J39368_1001975 | JGI25162J39368_10019754 | 394 |
| 133 | 3300002772 | JGI25164J39214_1001162 | JGI25164J39214_10011624 | 394 |
| 134 | 3300003214 | JGI25165J46597_1001557 | JGI25165J46597_10015577 | 394 |
| 135 | 3300003323 | rootH1_10003212 | rootH1_10003212131 | 394 |
| 136 | 3300003323 | rootH1_10087960 | rootH1_100879604 | 394 |
| 137 | 3300005288 | Ga0065714_10076438 | Ga0065714_100764382 | 394 |
| 138 | 3300005455 | Ga0070663_100009803 | Ga0070663_1000098036 | 394 |
| 139 | 3300005458 | Ga0070681_10006165 | Ga0070681_100061655 | 394 |
| 140 | 3300005530 | Ga0070679_100079640 | Ga0070679_1000796402 | 394 |
| 141 | 3300005563 | Ga0068855_100000506 | Ga0068855_10000050638 | 394 |
| 142 | 3300005563 | Ga0068855_100000748 | Ga0068855_10000074826 | 394 |
| 143 | 3300009093 | Ga0105240_10000728 | Ga0105240_1000072833 | 394 |
| 144 | 3300009093 | Ga0105240_10128819 | Ga0105240_101288192 | 394 |
| 145 | 3300009174 | Ga0105241_10090537 | Ga0105241_100905372 | 394 |
| 146 | 3300009545 | Ga0105237_10000622 | Ga0105237_1000062223 | 394 |
| 147 | 3300009545 | Ga0105237_10000717 | Ga0105237_1000071712 | 394 |
| 148 | 3300010375 | Ga0105239_10000010 | Ga0105239_10000010246 | 394 |
| 149 | 3300010375 | Ga0105239_10001617 | Ga0105239_1000161716 | 394 |
| 150 | 3300013104 | Ga0157370_10110713 | Ga0157370_101107132 | 394 |
| 151 | 3300013105 | Ga0157369_10001212 | Ga0157369_1000121212 | 394 |
| 152 | 3300013296 | Ga0157374_10306758 | Ga0157374_103067582 | 394 |
| 153 | 3300013306 | Ga0163162_10010526 | Ga0163162_100105264 | 394 |
| 154 | 3300013306 | Ga0163162_10243259 | Ga0163162_102432592 | 394 |
| 155 | 3300013307 | Ga0157372_10000021 | Ga0157372_1000002194 | 394 |
| 156 | 3300025231 | Ga0207427_100085 | Ga0207427_10008555 | 394 |
| 157 | 3300025233 | Ga0209437_100052 | Ga0209437_100052189 | 394 |
| 158 | 3300025261 | Ga0209233_1000067 | Ga0209233_1000067189 | 394 |
| 159 | 3300025261 | Ga0209233_1007086 | Ga0209233_10070862 | 394 |
| 160 | 3300025911 | Ga0207654_10014953 | Ga0207654_100149533 | 394 |
| 161 | 3300025912 | Ga0207707_10037077 | Ga0207707_100370772 | 394 |
| 162 | 3300025913 | Ga0207695_10000189 | Ga0207695_10000189132 | 394 |
| 163 | 3300025913 | Ga0207695_10212138 | Ga0207695_102121382 | 394 |
| 164 | 3300025914 | Ga0207671_10006381 | Ga0207671_100063817 | 394 |
| 165 | 3300025914 | Ga0207671_10010457 | Ga0207671_100104574 | 394 |
| 166 | 3300025921 | Ga0207652_10095595 | Ga0207652_100955952 | 394 |
| 167 | 3300025949 | Ga0207667_10000375 | Ga0207667_1000037548 | 394 |
| 168 | 3300025949 | Ga0207667_10002632 | Ga0207667_100026328 | 394 |
| 169 | 3300026067 | Ga0207678_10013801 | Ga0207678_100138012 | 394 |
| 170 | 3300028800 | Ga0265338_10022389 | Ga0265338_100223893 | 394 |
| 171 | 3300035115 | Ga0373941_0007429 | Ga0373941_0007429_541_1767 | 394 |
| 172 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_1285757_1286941 | 394 |
| 173 | 3300037312 | Ga0395899_0001327 | Ga0395899_0001327_3544_4737 | 394 |
| 174 | 3300044684 | Ga0466966_0015715 | Ga0466966_0015715_1117_2310 | 394 |
| 175 | 3300044693 | Ga0466961_0021113 | Ga0466961_0021113_1681_2874 | 394 |
| 176 | 3300045836 | Ga0466958_0026064 | Ga0466958_0026064_784_1977 | 394 |
| 177 | 3300046492 | Ga0495585_0000085 | Ga0495585_0000085_21825_23009 | 394 |
| 178 | 3300046660 | Ga0495625_0055762 | Ga0495625_0055762_814_1998 | 394 |
| 179 | 3300046665 | Ga0495661_0000511 | Ga0495661_0000511_4073_5257 | 394 |
| 180 | 3300047472 | Ga0495686_0006142 | Ga0495686_0006142_4013_5200 | 394 |
| 181 | 3300001989 | JGI24739J22299_10000842 | JGI24739J22299_100008426 | 395 |
| 182 | 3300001990 | JGI24737J22298_10000042 | JGI24737J22298_1000004220 | 395 |
| 183 | 3300002067 | JGI24735J21928_10000014 | JGI24735J21928_1000001462 | 395 |
| 184 | 3300002067 | JGI24735J21928_10005946 | JGI24735J21928_100059464 | 395 |
| 185 | 3300003316 | rootH1_10060934 | rootH1_100609344 | 395 |
| 186 | 3300003320 | rootH2_10063286 | rootH2_100632862 | 395 |
| 187 | 3300003322 | rootL2_10172002 | rootL2_101720021 | 395 |
| 188 | 3300005288 | Ga0065714_10075257 | Ga0065714_100752572 | 395 |
| 189 | 3300005327 | Ga0070658_10000047 | Ga0070658_1000004784 | 395 |
| 190 | 3300005327 | Ga0070658_10148872 | Ga0070658_101488722 | 395 |
| 191 | 3300005366 | Ga0070659_100001065 | Ga0070659_10000106510 | 395 |
| 192 | 3300005457 | Ga0070662_100205976 | Ga0070662_1002059762 | 395 |
| 193 | 3300005548 | Ga0070665_100000267 | Ga0070665_10000026779 | 395 |
| 194 | 3300005563 | Ga0068855_100009826 | Ga0068855_1000098263 | 395 |
| 195 | 3300005563 | Ga0068855_100029610 | Ga0068855_1000296103 | 395 |
| 196 | 3300005614 | Ga0068856_100022643 | Ga0068856_1000226434 | 395 |
| 197 | 3300005616 | Ga0068852_100215166 | Ga0068852_1002151662 | 395 |
| 198 | 3300006195 | Ga0075366_10000386 | Ga0075366_1000038611 | 395 |
| 199 | 3300006195 | Ga0075366_10002926 | Ga0075366_100029264 | 395 |
| 200 | 3300009093 | Ga0105240_10093164 | Ga0105240_100931643 | 395 |
| 201 | 3300009093 | Ga0105240_10209593 | Ga0105240_102095932 | 395 |
| 202 | 3300009098 | Ga0105245_10283654 | Ga0105245_102836542 | 395 |
| 203 | 3300009545 | Ga0105237_10004898 | Ga0105237_100048989 | 395 |
| 204 | 3300009545 | Ga0105237_10009042 | Ga0105237_100090426 | 395 |
| 205 | 3300009545 | Ga0105237_10095593 | Ga0105237_100955933 | 395 |
| 206 | 3300009545 | Ga0105237_10294604 | Ga0105237_102946041 | 395 |
| 207 | 3300010375 | Ga0105239_10000005 | Ga0105239_10000005144 | 395 |
| 208 | 3300010375 | Ga0105239_10000887 | Ga0105239_1000088710 | 395 |
| 209 | 3300010375 | Ga0105239_10003996 | Ga0105239_100039966 | 395 |
| 210 | 3300010375 | Ga0105239_10032964 | Ga0105239_100329645 | 395 |
| 211 | 3300010375 | Ga0105239_10053123 | Ga0105239_100531231 | 395 |
| 212 | 3300013100 | Ga0157373_10001208 | Ga0157373_1000120816 | 395 |
| 213 | 3300013102 | Ga0157371_10000216 | Ga0157371_1000021620 | 395 |
| 214 | 3300013102 | Ga0157371_10008303 | Ga0157371_100083034 | 395 |
| 215 | 3300013104 | Ga0157370_10036224 | Ga0157370_100362243 | 395 |
| 216 | 3300013105 | Ga0157369_10032683 | Ga0157369_100326831 | 395 |
| 217 | 3300013306 | Ga0163162_10000034 | Ga0163162_10000034113 | 395 |
| 218 | 3300013307 | Ga0157372_10002015 | Ga0157372_1000201511 | 395 |
| 219 | 3300013307 | Ga0157372_10004302 | Ga0157372_100043026 | 395 |
| 220 | 3300013307 | Ga0157372_10025438 | Ga0157372_100254386 | 395 |
| 221 | 3300013308 | Ga0157375_10172764 | Ga0157375_101727642 | 395 |
| 222 | 3300017792 | Ga0163161_10036304 | Ga0163161_100363041 | 395 |
| 223 | 3300021361 | Ga0213872_10003957 | Ga0213872_100039571 | 395 |
| 224 | 3300025233 | Ga0209437_100024 | Ga0209437_100024498 | 395 |
| 225 | 3300025250 | Ga0209026_1000595 | Ga0209026_100059526 | 395 |
| 226 | 3300025261 | Ga0209233_1010247 | Ga0209233_10102472 | 395 |
| 227 | 3300025904 | Ga0207647_10000104 | Ga0207647_1000010420 | 395 |
| 228 | 3300025904 | Ga0207647_10020568 | Ga0207647_100205682 | 395 |
| 229 | 3300025909 | Ga0207705_10000052 | Ga0207705_1000005285 | 395 |
| 230 | 3300025914 | Ga0207671_10003566 | Ga0207671_100035667 | 395 |
| 231 | 3300025914 | Ga0207671_10007561 | Ga0207671_1000756111 | 395 |
| 232 | 3300025914 | Ga0207671_10051689 | Ga0207671_100516893 | 395 |
| 233 | 3300025914 | Ga0207671_10205141 | Ga0207671_102051412 | 395 |
| 234 | 3300025932 | Ga0207690_10009292 | Ga0207690_100092925 | 395 |
| 235 | 3300025949 | Ga0207667_10002384 | Ga0207667_1000238413 | 395 |
| 236 | 3300025949 | Ga0207667_10041730 | Ga0207667_100417302 | 395 |
| 237 | 3300025949 | Ga0207667_10091894 | Ga0207667_100918943 | 395 |
| 238 | 3300026078 | Ga0207702_10002568 | Ga0207702_100025687 | 395 |
| 239 | 3300026078 | Ga0207702_10034792 | Ga0207702_100347922 | 395 |
| 240 | 3300028379 | Ga0268266_10000018 | Ga0268266_10000018483 | 395 |
| 241 | 3300028794 | Ga0307515_10005287 | Ga0307515_1000528711 | 395 |
| 242 | 3300028794 | Ga0307515_10017194 | Ga0307515_100171949 | 395 |
| 243 | 3300033179 | Ga0307507_10002030 | Ga0307507_1000203033 | 395 |
| 244 | 3300033180 | Ga0307510_10005272 | Ga0307510_100052723 | 395 |
| 245 | 3300039447 | Ga0436361_0199837 | Ga0436361_0199837_12354_13550 | 395 |
| 246 | 3300046471 | Ga0495650_0000003 | Ga0495650_0000003_119899_121086 | 395 |
| 247 | 3300046492 | Ga0495585_0001353 | Ga0495585_0001353_11433_12620 | 395 |
| 248 | 3300046507 | Ga0495606_0000145 | Ga0495606_0000145_66940_68127 | 395 |
| 249 | 3300046512 | Ga0495610_0002148 | Ga0495610_0002148_2945_4132 | 395 |
| 250 | 3300046513 | Ga0495616_0006043 | Ga0495616_0006043_5070_6257 | 395 |
| 251 | 3300046523 | Ga0495644_0011798 | Ga0495644_0011798_1845_3056 | 395 |
| 252 | 3300046524 | Ga0495648_0000813 | Ga0495648_0000813_7202_8389 | 395 |
| 253 | 3300046524 | Ga0495648_0106925 | Ga0495648_0106925_137_1324 | 395 |
| 254 | 3300046538 | Ga0495609_0009549 | Ga0495609_0009549_2254_3441 | 395 |
| 255 | 3300046558 | Ga0495633_0000069 | Ga0495633_0000069_121820_123007 | 395 |
| 256 | 3300046558 | Ga0495633_0014938 | Ga0495633_0014938_2838_4025 | 395 |
| 257 | 3300046616 | Ga0495668_0000044 | Ga0495668_0000044_425_1612 | 395 |
| 258 | 3300046660 | Ga0495625_0000005 | Ga0495625_0000005_236908_238095 | 395 |
| 259 | 3300046660 | Ga0495625_0000248 | Ga0495625_0000248_79719_80906 | 395 |
| 260 | 3300046660 | Ga0495625_0001880 | Ga0495625_0001880_8463_9650 | 395 |
| 261 | 3300046665 | Ga0495661_0016228 | Ga0495661_0016228_2096_3283 | 395 |
| 262 | 3300046692 | Ga0495671_0033456 | Ga0495671_0033456_860_2047 | 395 |
| 263 | 3300046694 | Ga0495649_0000003 | Ga0495649_0000003_236930_238117 | 395 |
| 264 | 3300046810 | Ga0495660_0012596 | Ga0495660_0012596_1899_3086 | 395 |
| 265 | 3300047323 | Ga0495683_0028934 | Ga0495683_0028934_1434_2621 | 395 |
| 266 | 3300047443 | Ga0495687_000672 | Ga0495687_000672_121_1308 | 395 |
| 267 | 3300047472 | Ga0495686_0000367 | Ga0495686_0000367_53771_54958 | 395 |
| 268 | 3300047472 | Ga0495686_0033041 | Ga0495686_0033041_1231_2418 | 395 |
| 269 | 3300050493 | nmdc:mga0k408_342_c1 | nmdc:mga0k408_342_c1_17588_18775 | 395 |
| 270 | 3300050493 | nmdc:mga0k408_4661_c1 | nmdc:mga0k408_4661_c1_2589_3776 | 395 |
| 271 | 3300053080 | Ga0500635_0000424 | Ga0500635_0000424_10762_11952 | 395 |
| 272 | 3300053122 | Ga0500608_000736 | Ga0500608_000736_1179_2366 | 395 |
| 273 | 3300053125 | Ga0500618_000002 | Ga0500618_000002_102492_103679 | 395 |
| 274 | 3300053157 | Ga0500624_000271 | Ga0500624_000271_1702_2889 | 395 |
| 275 | iso_pu_bacteria | 2884933994 | 2884937302 | 395 |
| 276 | iso_pu_bacteria | 2977232053 | 2977235793 | 395 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF08436
DXP_redisom_C
1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
166
249
0.99
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mh5-assembly1.cif.gz_A | crystal structure of 1-deoxy-d-xylulose-5-phosphate reductoisomerase from staphylococcus schleiferi in complex with fosmidomycin (fom) | 0.9669 | 5 | 378 |
| 1q0h-assembly1.cif.gz_A | crystal structure of selenomethionine-labelled dxr in complex with fosmidomycin | 0.9641 | 5 | 390 |
| 1r0k-assembly2.cif.gz_D | crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis | 0.9631 | 4 | 387 |
| 7s04-assembly1.cif.gz_A-2 | 1-deoxy-d-xylulose 5-phosphate reductoisomerase (ispc) from acinetobacter baumannii in complex with fr900098, nadph, and a magnesium ion | 0.9615 | 6 | 389 |
| 1r0k-assembly2.cif.gz_C | crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis | 0.9609 | 4 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5kqoA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9695 | 4 | 152 | 3.40.50.720 |
| 4zn6B03 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9665 | 310 | 386 | 1.10.1740.10 |
| af_A0A1D6MNI9_107_243_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9649 | 21 | 152 | 3.40.50.720 |
| af_I1MM97_67_222_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9638 | 6 | 152 | 3.40.50.720 |
| 4zqhB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9575 | 5 | 152 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J6HIP4-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | 0.9965 | 296 | 388 |
GO:0016853
GO:0030145 GO:0030604 GO:0051484 GO:0070402 |
| AF-W2CC69-F1-model_v4 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXP reductoisomerase) (EC 1.1.1.267) (1-deoxyxylulose-5-phosphate reductoisomerase) (2-C-methyl-D-erythritol 4-phosphate synthase) | 0.9941 | 4 | 389 |
GO:0016853
GO:0030145 GO:0030604 GO:0051484 GO:0070402 |
| AF-A0A418XPW4-F1-model_v4 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | 0.9938 | 4 | 142 |
GO:0016853
GO:0030145 GO:0030604 GO:0051484 GO:0070402 |
| AF-A0A4Q8S3C4-F1-model_v4 | deleted | 0.9937 | 4 | 389 |
|
| AF-A0A660WYM9-F1-model_v4 | deleted | 0.9924 | 188 | 384 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar