F380965
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 276 | 203 | 252 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10235443|Ga0070681_102354432 |
| Length | 258 |
| Sequence | MSRAPLDRRTFTARLRNIGAASYHHKHPFHERMNSGELDPQALQTWVANRLYYQTSIPLKDAALISNCPVREVRRIWLHRIVDHDGTRGDEGGIGAWLRLGEACGLARKQLLGGSLIVPGVRFAVDAYVHFAATQPWPIAVASSLTELFAPNLMAQRLEAFKRFYPWVKPRGLEYFQNRLTQAPRDSGEALALTLKYCDTREMQDRAIAALQFKCDLLWAMLDSIHLACSPRNSSPANPVESRPGVADNKTAIRRARD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2511231025 | Pantoea sp. YR343 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 6 | 2585427592 | Rahnella aquatilis OV588 | Isolate | Rhizosphere |
| 7 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 8 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 9 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 10 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 11 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 12 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 13 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 14 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 15 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 16 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 17 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 18 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 19 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 20 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 21 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 22 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 23 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 24 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 25 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 27 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 114 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 115 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 118 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 125 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 126 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 127 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 128 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 129 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 130 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 131 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 132 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 173 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 174 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 177 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 181 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 182 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 183 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 184 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 185 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 186 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 187 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 199 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 200 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 201 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 202 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 203 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.3 |
| Metatranscriptomes | 0 |
| Isolates | 8.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.36 |
| Endosphere | 7.25 |
| Nodule | 1.09 |
| Rhizoplane | 4.71 |
| Rhizosphere | 71.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_1115626 | 2162886012 | Bacteria | 1184 |
| 2 | MBSR1b_contig_7140121 | 2162886012 | Bacteria | 1186 |
| 3 | JGI25162J39368_1000010 | 3300002737 | Bacteria | 389629 |
| 4 | JGI25163J39215_1000002 | 3300002771 | Bacteria | 152475 |
| 5 | JGI25164J39214_1000003 | 3300002772 | Bacteria | 389390 |
| 6 | JGI25152J39213_1003751 | 3300002773 | Bacteria | 5067 |
| 7 | JGI25406J46586_10000023 | 3300003203 | Bacteria | 76640 |
| 8 | rootH2_10063248 | 3300003320 | Bacteria | 18374 |
| 9 | Ga0055538_1000009 | 3300003751 | Bacteria | 389629 |
| 10 | Ga0055539_1000013 | 3300003752 | Bacteria | 389629 |
| 11 | Ga0055533_1000017 | 3300003756 | Bacteria | 389629 |
| 12 | Ga0055525_1000019 | 3300003759 | Bacteria | 389629 |
| 13 | Ga0055541_1000010 | 3300003841 | Bacteria | 389629 |
| 14 | Ga0058692_1000038 | 3300003856 | Bacteria | 140136 |
| 15 | Ga0058692_1000152 | 3300003856 | Bacteria | 44110 |
| 16 | Ga0058692_1000454 | 3300003856 | Bacteria | 18505 |
| 17 | Ga0065704_10001592 | 3300005289 | Bacteria | 7202 |
| 18 | Ga0065704_10086508 | 3300005289 | Bacteria | 3112 |
| 19 | Ga0070690_100059151 | 3300005330 | Unclassified | 2463 |
| 20 | Ga0070690_100109238 | 3300005330 | Bacteria | 1843 |
| 21 | Ga0070661_100000480 | 3300005344 | Bacteria | 30486 |
| 22 | Ga0070668_100588914 | 3300005347 | Bacteria | 972 |
| 23 | Ga0070659_100454083 | 3300005366 | Bacteria | 1087 |
| 24 | Ga0070703_10008335 | 3300005406 | Bacteria | 2914 |
| 25 | Ga0070703_10021952 | 3300005406 | Bacteria | 1870 |
| 26 | Ga0070714_100020474 | 3300005435 | Bacteria | 5402 |
| 27 | Ga0070711_100616746 | 3300005439 | Bacteria | 906 |
| 28 | Ga0070694_100027479 | 3300005444 | Bacteria | 3695 |
| 29 | Ga0070708_100068085 | 3300005445 | Bacteria | 3199 |
| 30 | Ga0070708_100204304 | 3300005445 | Bacteria | 1850 |
| 31 | Ga0070678_100015574 | 3300005456 | Bacteria | 4836 |
| 32 | Ga0070662_100098240 | 3300005457 | Bacteria | 2211 |
| 33 | Ga0070681_10235443 | 3300005458 | Bacteria | 1745 |
| 34 | Ga0070706_100065220 | 3300005467 | Bacteria | 3367 |
| 35 | Ga0070706_100113161 | 3300005467 | Bacteria | 2527 |
| 36 | Ga0070707_100363281 | 3300005468 | Bacteria | 1406 |
| 37 | Ga0070707_100434948 | 3300005468 | Bacteria | 1272 |
| 38 | Ga0070698_100000130 | 3300005471 | Bacteria | 65522 |
| 39 | Ga0070698_100074859 | 3300005471 | Bacteria | 3391 |
| 40 | Ga0070698_100523292 | 3300005471 | Bacteria | 1124 |
| 41 | Ga0070698_100793034 | 3300005471 | Bacteria | 891 |
| 42 | Ga0070699_100224526 | 3300005518 | Bacteria | 1674 |
| 43 | Ga0070684_100886478 | 3300005535 | Bacteria | 836 |
| 44 | Ga0070697_100049253 | 3300005536 | Bacteria | 3419 |
| 45 | Ga0070697_100056723 | 3300005536 | Bacteria | 3186 |
| 46 | Ga0070697_100168556 | 3300005536 | Bacteria | 1852 |
| 47 | Ga0070695_100001823 | 3300005545 | Bacteria | 12006 |
| 48 | Ga0070696_100131630 | 3300005546 | Bacteria | 1820 |
| 49 | Ga0070704_100003674 | 3300005549 | Bacteria | 8830 |
| 50 | Ga0070704_100100775 | 3300005549 | Bacteria | 2175 |
| 51 | Ga0068864_100079668 | 3300005618 | Bacteria | 2868 |
| 52 | Ga0068863_100272478 | 3300005841 | Unclassified | 1639 |
| 53 | Ga0081540_1004050 | 3300005983 | Bacteria | 11349 |
| 54 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 55 | Ga0070717_10000044 | 3300006028 | Bacteria | 108873 |
| 56 | Ga0070717_10022802 | 3300006028 | Bacteria | 4952 |
| 57 | Ga0070716_100201460 | 3300006173 | Bacteria | 1323 |
| 58 | Ga0075428_100089720 | 3300006844 | Bacteria | 3353 |
| 59 | Ga0075428_100190583 | 3300006844 | Archaea | 2218 |
| 60 | Ga0075431_100796205 | 3300006847 | Bacteria | 919 |
| 61 | Ga0075433_10017380 | 3300006852 | Bacteria | 5956 |
| 62 | Ga0075434_100662988 | 3300006871 | Bacteria | 1061 |
| 63 | Ga0075429_100214652 | 3300006880 | Bacteria | 1686 |
| 64 | Ga0075436_100034093 | 3300006914 | Bacteria | 3509 |
| 65 | Ga0075435_100189710 | 3300007076 | Bacteria | 1739 |
| 66 | Ga0075435_100225666 | 3300007076 | Bacteria | 1591 |
| 67 | Ga0105244_10000520 | 3300009036 | Bacteria | 34332 |
| 68 | Ga0105244_10007954 | 3300009036 | Bacteria | 6678 |
| 69 | Ga0105244_10040035 | 3300009036 | Bacteria | 2436 |
| 70 | Ga0105244_10057713 | 3300009036 | Bacteria | 1961 |
| 71 | Ga0105250_10000020 | 3300009092 | Bacteria | 242010 |
| 72 | Ga0105250_10003801 | 3300009092 | Bacteria | 7087 |
| 73 | Ga0105240_10003970 | 3300009093 | Bacteria | 22840 |
| 74 | Ga0105240_10133955 | 3300009093 | Bacteria | 2968 |
| 75 | Ga0111539_10182029 | 3300009094 | Archaea | 2454 |
| 76 | Ga0114129_10095814 | 3300009147 | Bacteria | 4109 |
| 77 | Ga0114129_10186999 | 3300009147 | Bacteria | 2814 |
| 78 | Ga0105248_10149413 | 3300009177 | Bacteria | 2636 |
| 79 | Ga0157373_10013192 | 3300013100 | Bacteria | 6065 |
| 80 | Ga0157371_10000092 | 3300013102 | Bacteria | 141282 |
| 81 | Ga0157371_10001662 | 3300013102 | Bacteria | 22693 |
| 82 | Ga0157374_10000041 | 3300013296 | Bacteria | 150386 |
| 83 | Ga0163162_10064373 | 3300013306 | Bacteria | 3711 |
| 84 | Ga0163162_10143765 | 3300013306 | Bacteria | 2500 |
| 85 | Ga0157372_10039284 | 3300013307 | Bacteria | 5222 |
| 86 | Ga0157372_10226805 | 3300013307 | Bacteria | 2166 |
| 87 | Ga0157372_10608934 | 3300013307 | Bacteria | 1273 |
| 88 | Ga0163163_10000375 | 3300014325 | Bacteria | 42824 |
| 89 | Ga0163163_10039469 | 3300014325 | Bacteria | 4607 |
| 90 | Ga0163163_11266898 | 3300014325 | Unclassified | 799 |
| 91 | Ga0157376_10000279 | 3300014969 | Bacteria | 34619 |
| 92 | Ga0209760_100008 | 3300025207 | Bacteria | 211332 |
| 93 | Ga0209784_100012 | 3300025224 | Bacteria | 535823 |
| 94 | Ga0209566_100010 | 3300025225 | Bacteria | 535823 |
| 95 | Ga0209674_100023 | 3300025226 | Bacteria | 535823 |
| 96 | Ga0209563_100027 | 3300025230 | Bacteria | 535823 |
| 97 | Ga0207427_100017 | 3300025231 | Bacteria | 535823 |
| 98 | Ga0209437_100029 | 3300025233 | Bacteria | 535823 |
| 99 | Ga0209677_100014 | 3300025253 | Bacteria | 535823 |
| 100 | Ga0209051_1011251 | 3300025303 | Bacteria | 4436 |
| 101 | Ga0207696_1001589 | 3300025711 | Bacteria | 12013 |
| 102 | Ga0207655_1000698 | 3300025728 | Bacteria | 38934 |
| 103 | Ga0207655_1019916 | 3300025728 | Bacteria | 3478 |
| 104 | Ga0207653_10008042 | 3300025885 | Bacteria | 3287 |
| 105 | Ga0207653_10009102 | 3300025885 | Bacteria | 3098 |
| 106 | Ga0207692_10001201 | 3300025898 | Bacteria | 9613 |
| 107 | Ga0207684_10062458 | 3300025910 | Bacteria | 3163 |
| 108 | Ga0207684_10104899 | 3300025910 | Bacteria | 2417 |
| 109 | Ga0207695_10039159 | 3300025913 | Bacteria | 5097 |
| 110 | Ga0207663_10030955 | 3300025916 | Bacteria | 3162 |
| 111 | Ga0207649_10003906 | 3300025920 | Bacteria | 8130 |
| 112 | Ga0207652_10253514 | 3300025921 | Unclassified | 1587 |
| 113 | Ga0207646_10026175 | 3300025922 | Bacteria | 5326 |
| 114 | Ga0207646_10030593 | 3300025922 | Bacteria | 4877 |
| 115 | Ga0207700_10000722 | 3300025928 | Bacteria | 19061 |
| 116 | Ga0207664_10024663 | 3300025929 | Bacteria | 4521 |
| 117 | Ga0207706_10135214 | 3300025933 | Bacteria | 2169 |
| 118 | Ga0207712_10378185 | 3300025961 | Bacteria | 1184 |
| 119 | Ga0207668_10454480 | 3300025972 | Bacteria | 1094 |
| 120 | Ga0207648_10857032 | 3300026089 | Unclassified | 847 |
| 121 | Ga0207676_10327930 | 3300026095 | Bacteria | 1408 |
| 122 | Ga0207683_10215827 | 3300026121 | Bacteria | 1747 |
| 123 | Ga0209371_1000005 | 3300027312 | Bacteria | 1061740 |
| 124 | Ga0209371_1000322 | 3300027312 | Bacteria | 52608 |
| 125 | Ga0209371_1002884 | 3300027312 | Bacteria | 9036 |
| 126 | Ga0265338_10035376 | 3300028800 | Bacteria | 4803 |
| 127 | Ga0265338_10066906 | 3300028800 | Bacteria | 3107 |
| 128 | Ga0268256_1001754 | 3300030500 | Bacteria | 12253 |
| 129 | Ga0307511_10026744 | 3300030521 | Bacteria | 5286 |
| 130 | Ga0265340_10150587 | 3300031247 | Bacteria | 1060 |
| 131 | Ga0373934_0004410 | 3300035086 | Bacteria | 5198 |
| 132 | Ga0373955_0054900 | 3300035172 | Bacteria | 2180 |
| 133 | Ga0373924_0099642 | 3300035410 | Bacteria | 1249 |
| 134 | Ga0373937_0042574 | 3300036401 | Bacteria | 4143 |
| 135 | Ga0373925_0002492 | 3300037068 | Bacteria | 14716 |
| 136 | Ga0395905_0720631 | 3300037471 | Bacteria | 900 |
| 137 | Ga0436364_1464490 | 3300037853 | Bacteria | 1340 |
| 138 | Ga0395901_0168772 | 3300038443 | Bacteria | 2296 |
| 139 | Ga0436365_0264674 | 3300039437 | Bacteria | 4682 |
| 140 | Ga0436363_0656255 | 3300039450 | Bacteria | 1187 |
| 141 | Ga0439438_000049 | 3300041405 | Bacteria | 57788 |
| 142 | Ga0439438_004374 | 3300041405 | Bacteria | 5439 |
| 143 | Ga0439447_000283 | 3300041407 | Bacteria | 18017 |
| 144 | Ga0439447_004856 | 3300041407 | Bacteria | 4562 |
| 145 | Ga0439447_062205 | 3300041407 | Bacteria | 877 |
| 146 | Ga0439432_007289 | 3300042006 | Bacteria | 3924 |
| 147 | Ga0439432_026715 | 3300042006 | Bacteria | 1889 |
| 148 | Ga0439432_070088 | 3300042006 | Bacteria | 1070 |
| 149 | Ga0439450_069214 | 3300042008 | Bacteria | 864 |
| 150 | Ga0439452_000520 | 3300042010 | Bacteria | 20614 |
| 151 | Ga0466965_0281047 | 3300044683 | Unclassified | 899 |
| 152 | Ga0466963_0053859 | 3300044694 | Bacteria | 2673 |
| 153 | Ga0466959_0244675 | 3300045049 | Bacteria | 1238 |
| 154 | Ga0451576_0350852 | 3300045051 | Bacteria | 1545 |
| 155 | Ga0495591_000850 | 3300046458 | Bacteria | 21477 |
| 156 | Ga0495629_0267222 | 3300046459 | Unclassified | 1175 |
| 157 | Ga0495651_0006632 | 3300046462 | Bacteria | 8843 |
| 158 | Ga0495650_0000008 | 3300046471 | Bacteria | 688246 |
| 159 | Ga0495650_0000052 | 3300046471 | Bacteria | 318176 |
| 160 | Ga0495582_0027542 | 3300046473 | Unclassified | 3116 |
| 161 | Ga0495605_0040675 | 3300046474 | Bacteria | 2319 |
| 162 | Ga0495607_0010426 | 3300046501 | Bacteria | 6250 |
| 163 | Ga0495606_0000289 | 3300046507 | Bacteria | 87270 |
| 164 | Ga0495608_0130803 | 3300046511 | Bacteria | 1606 |
| 165 | Ga0495630_0000061 | 3300046517 | Bacteria | 88178 |
| 166 | Ga0495630_0012518 | 3300046517 | Bacteria | 6161 |
| 167 | Ga0495637_0079969 | 3300046520 | Bacteria | 1305 |
| 168 | Ga0495643_0029096 | 3300046522 | Bacteria | 3093 |
| 169 | Ga0495648_0076525 | 3300046524 | Bacteria | 1921 |
| 170 | Ga0495666_0008473 | 3300046526 | Bacteria | 5158 |
| 171 | Ga0495654_0000091 | 3300046530 | Bacteria | 101543 |
| 172 | Ga0495586_0000008 | 3300046535 | Bacteria | 148781 |
| 173 | Ga0495609_0117374 | 3300046538 | Bacteria | 1145 |
| 174 | Ga0495622_0014816 | 3300046557 | Bacteria | 3624 |
| 175 | Ga0495667_0122335 | 3300046559 | Bacteria | 1680 |
| 176 | Ga0495634_0003119 | 3300046642 | Bacteria | 13472 |
| 177 | Ga0495657_0035503 | 3300046675 | Bacteria | 3454 |
| 178 | Ga0495658_0036644 | 3300046683 | Unclassified | 2707 |
| 179 | Ga0495671_0005950 | 3300046692 | Bacteria | 7093 |
| 180 | Ga0495649_0007136 | 3300046694 | Bacteria | 6864 |
| 181 | Ga0495589_0003210 | 3300046794 | Bacteria | 8926 |
| 182 | Ga0495589_0053082 | 3300046794 | Bacteria | 2001 |
| 183 | Ga0495660_0000006 | 3300046810 | Bacteria | 571713 |
| 184 | Ga0495660_0000247 | 3300046810 | Bacteria | 52182 |
| 185 | Ga0495674_0013326 | 3300047319 | Bacteria | 7731 |
| 186 | Ga0495672_0000003 | 3300047320 | Bacteria | 728845 |
| 187 | Ga0495676_0002193 | 3300047321 | Bacteria | 17298 |
| 188 | Ga0495680_0200319 | 3300047322 | Bacteria | 1432 |
| 189 | Ga0495673_0000011 | 3300047469 | Bacteria | 674140 |
| 190 | Ga0495681_0003836 | 3300047470 | Bacteria | 10403 |
| 191 | Ga0495602_0022995 | 3300048088 | Bacteria | 6084 |
| 192 | Ga0496100_0020466 | 3300048903 | Bacteria | 3967 |
| 193 | Ga0496101_0072543 | 3300048904 | Bacteria | 2527 |
| 194 | Ga0496102_0359906 | 3300048905 | Bacteria | 1370 |
| 195 | Ga0496103_0269300 | 3300048906 | Bacteria | 1096 |
| 196 | Ga0496104_0001450 | 3300048907 | Bacteria | 20487 |
| 197 | Ga0496106_0047034 | 3300048909 | Bacteria | 3245 |
| 198 | Ga0496107_0096977 | 3300048910 | Bacteria | 2158 |
| 199 | Ga0496110_0201327 | 3300048913 | Bacteria | 1809 |
| 200 | Ga0496113_0122165 | 3300048916 | Bacteria | 2037 |
| 201 | Ga0496115_0759730 | 3300048918 | Bacteria | 757 |
| 202 | Ga0496116_0000020 | 3300048919 | Bacteria | 501307 |
| 203 | Ga0496116_0000106 | 3300048919 | Bacteria | 188941 |
| 204 | Ga0496116_0002167 | 3300048919 | Bacteria | 20906 |
| 205 | Ga0496116_0015938 | 3300048919 | Bacteria | 5910 |
| 206 | Ga0496117_0044916 | 3300048920 | Bacteria | 3196 |
| 207 | Ga0496118_0000048 | 3300048921 | Bacteria | 253404 |
| 208 | Ga0496118_0085625 | 3300048921 | Bacteria | 2193 |
| 209 | Ga0496119_0000031 | 3300048922 | Bacteria | 239685 |
| 210 | Ga0496119_0000907 | 3300048922 | Bacteria | 38493 |
| 211 | Ga0496119_0001383 | 3300048922 | Bacteria | 29487 |
| 212 | Ga0496119_0002629 | 3300048922 | Bacteria | 19489 |
| 213 | Ga0496119_0034768 | 3300048922 | Bacteria | 3311 |
| 214 | Ga0496120_0000051 | 3300048923 | Bacteria | 186239 |
| 215 | Ga0496120_0000092 | 3300048923 | Bacteria | 148990 |
| 216 | Ga0496120_0000123 | 3300048923 | Bacteria | 129989 |
| 217 | Ga0496120_0000751 | 3300048923 | Bacteria | 47018 |
| 218 | Ga0496120_0000990 | 3300048923 | Bacteria | 38462 |
| 219 | Ga0496122_0000010 | 3300048925 | Bacteria | 547417 |
| 220 | Ga0496122_0011558 | 3300048925 | Bacteria | 8919 |
| 221 | Ga0496123_0000025 | 3300048926 | Bacteria | 323956 |
| 222 | Ga0496123_0009292 | 3300048926 | Bacteria | 8873 |
| 223 | Ga0496124_0000008 | 3300048927 | Bacteria | 864372 |
| 224 | Ga0496124_0000042 | 3300048927 | Bacteria | 301126 |
| 225 | Ga0496124_0008835 | 3300048927 | Bacteria | 10460 |
| 226 | Ga0496125_0000054 | 3300048928 | Bacteria | 278377 |
| 227 | Ga0496126_0008377 | 3300048929 | Bacteria | 11155 |
| 228 | Ga0496126_0017706 | 3300048929 | Bacteria | 7096 |
| 229 | Ga0496126_0805114 | 3300048929 | Bacteria | 720 |
| 230 | Ga0495678_000260 | 3300049459 | Bacteria | 58774 |
| 231 | Ga0501034_0019966 | 3300049571 | Bacteria | 6843 |
| 232 | Ga0501034_0029620 | 3300049571 | Bacteria | 5566 |
| 233 | Ga0501039_0723555 | 3300049575 | Archaea | 778 |
| 234 | nmdc:mga05p37_122379_c1 | 3300050507 | Bacteria | 3195 |
| 235 | nmdc:mga05p37_44976_c1 | 3300050507 | Bacteria | 5432 |
| 236 | nmdc:mga05p37_471338_c1 | 3300050507 | Bacteria | 1449 |
| 237 | nmdc:mga09592_293783_c1 | 3300050508 | Bacteria | 1409 |
| 238 | nmdc:mga0qj67_57268_c1 | 3300050509 | Bacteria | 3089 |
| 239 | nmdc:mga08y16_154444_c1 | 3300050511 | Archaea | 2385 |
| 240 | nmdc:mga0n895_112746_c1 | 3300050512 | Bacteria | 2736 |
| 241 | nmdc:mga0n895_324202_c1 | 3300050512 | Bacteria | 1561 |
| 242 | nmdc:mga0n895_7814_c1 | 3300050512 | Bacteria | 9216 |
| 243 | nmdc:mga0rr50_112579_c1 | 3300050513 | Bacteria | 2155 |
| 244 | nmdc:mga0rr50_13055_c1 | 3300050513 | Bacteria | 5392 |
| 245 | nmdc:mga0rr50_560622_c1 | 3300050513 | Bacteria | 973 |
| 246 | nmdc:mga08x19_27362_c1 | 3300050514 | Bacteria | 3566 |
| 247 | nmdc:mga0a205_46903_c1 | 3300050515 | Bacteria | 4168 |
| 248 | nmdc:mga0a205_573118_c1 | 3300050515 | Bacteria | 983 |
| 249 | nmdc:mga0a205_800009_c1 | 3300050515 | Bacteria | 791 |
| 250 | Ga0500621_000004 | 3300053126 | Bacteria | 485792 |
| 251 | Ga0500616_0003517 | 3300053153 | Bacteria | 11894 |
| 252 | Ga0466962_0058213 | 3300061719 | Bacteria | 1845 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049575 | Ga0501039_0723555 | Ga0501039_0723555_164_766 | 197 |
| 2 | 3300037068 | Ga0373925_0002492 | Ga0373925_0002492_8224_8964 | 203 |
| 3 | 3300035086 | Ga0373934_0004410 | Ga0373934_0004410_926_1633 | 205 |
| 4 | 3300035172 | Ga0373955_0054900 | Ga0373955_0054900_1004_1711 | 205 |
| 5 | 3300036401 | Ga0373937_0042574 | Ga0373937_0042574_2863_3570 | 205 |
| 6 | 3300046511 | Ga0495608_0130803 | Ga0495608_0130803_826_1533 | 205 |
| 7 | 3300046559 | Ga0495667_0122335 | Ga0495667_0122335_561_1268 | 205 |
| 8 | 3300046675 | Ga0495657_0035503 | Ga0495657_0035503_1117_1824 | 205 |
| 9 | 3300047322 | Ga0495680_0200319 | Ga0495680_0200319_222_929 | 205 |
| 10 | 3300048088 | Ga0495602_0022995 | Ga0495602_0022995_4713_5420 | 205 |
| 11 | 3300050515 | nmdc:mga0a205_800009_c1 | nmdc:mga0a205_800009_c1_14_634 | 206 |
| 12 | 3300047321 | Ga0495676_0002193 | Ga0495676_0002193_13_648 | 211 |
| 13 | 3300026089 | Ga0207648_10857032 | Ga0207648_108570321 | 213 |
| 14 | 3300044683 | Ga0466965_0281047 | Ga0466965_0281047_28_675 | 215 |
| 15 | 3300046462 | Ga0495651_0006632 | Ga0495651_0006632_6390_7058 | 216 |
| 16 | 3300041407 | Ga0439447_062205 | Ga0439447_062205_11_670 | 219 |
| 17 | 3300042006 | Ga0439432_070088 | Ga0439432_070088_385_1044 | 219 |
| 18 | 3300048919 | Ga0496116_0015938 | Ga0496116_0015938_41_700 | 219 |
| 19 | 3300048929 | Ga0496126_0805114 | Ga0496126_0805114_45_704 | 219 |
| 20 | 3300030521 | Ga0307511_10026744 | Ga0307511_100267443 | 220 |
| 21 | 3300005344 | Ga0070661_100000480 | Ga0070661_10000048016 | 221 |
| 22 | 3300005366 | Ga0070659_100454083 | Ga0070659_1004540831 | 221 |
| 23 | 3300005456 | Ga0070678_100015574 | Ga0070678_1000155742 | 221 |
| 24 | 3300025920 | Ga0207649_10003906 | Ga0207649_100039064 | 221 |
| 25 | 3300026121 | Ga0207683_10215827 | Ga0207683_102158272 | 221 |
| 26 | 3300003320 | rootH2_10063248 | rootH2_100632486 | 223 |
| 27 | 3300028800 | Ga0265338_10066906 | Ga0265338_100669062 | 226 |
| 28 | iso_pu_bacteria | 2513237150 | 2513952665 | 226 |
| 29 | iso_pu_bacteria | 2513237165 | 2514045181 | 226 |
| 30 | iso_pu_bacteria | 644736347 | 644750724 | 226 |
| 31 | 3300005535 | Ga0070684_100886478 | Ga0070684_1008864781 | 227 |
| 32 | 3300005618 | Ga0068864_100079668 | Ga0068864_1000796682 | 227 |
| 33 | 3300005841 | Ga0068863_100272478 | Ga0068863_1002724782 | 227 |
| 34 | 3300014325 | Ga0163163_10039469 | Ga0163163_100394694 | 227 |
| 35 | 3300026095 | Ga0207676_10327930 | Ga0207676_103279301 | 227 |
| 36 | 3300045051 | Ga0451576_0350852 | Ga0451576_0350852_532_1227 | 227 |
| 37 | 3300005406 | Ga0070703_10008335 | Ga0070703_100083353 | 228 |
| 38 | 3300005444 | Ga0070694_100027479 | Ga0070694_1000274794 | 228 |
| 39 | 3300005445 | Ga0070708_100068085 | Ga0070708_1000680854 | 228 |
| 40 | 3300005536 | Ga0070697_100049253 | Ga0070697_1000492532 | 228 |
| 41 | 3300006028 | Ga0070717_10000044 | Ga0070717_1000004454 | 228 |
| 42 | 3300009093 | Ga0105240_10133955 | Ga0105240_101339553 | 228 |
| 43 | 3300014325 | Ga0163163_11266898 | Ga0163163_112668981 | 228 |
| 44 | 3300025303 | Ga0209051_1011251 | Ga0209051_10112515 | 228 |
| 45 | 3300050515 | nmdc:mga0a205_573118_c1 | nmdc:mga0a205_573118_c1_91_789 | 228 |
| 46 | 3300007076 | Ga0075435_100225666 | Ga0075435_1002256661 | 229 |
| 47 | 3300046557 | Ga0495622_0014816 | Ga0495622_0014816_2241_2969 | 229 |
| 48 | 3300050513 | nmdc:mga0rr50_112579_c1 | nmdc:mga0rr50_112579_c1_1187_1876 | 229 |
| 49 | iso_pu_bacteria | 3006973921 | 3006978319 | 229 |
| 50 | 3300003203 | JGI25406J46586_10000023 | JGI25406J46586_1000002319 | 230 |
| 51 | 3300005985 | Ga0081539_10000014 | Ga0081539_1000001428 | 230 |
| 52 | 3300013296 | Ga0157374_10000041 | Ga0157374_10000041101 | 230 |
| 53 | 3300014969 | Ga0157376_10000279 | Ga0157376_1000027921 | 230 |
| 54 | 3300028800 | Ga0265338_10035376 | Ga0265338_100353763 | 230 |
| 55 | 3300031247 | Ga0265340_10150587 | Ga0265340_101505872 | 231 |
| 56 | 3300037471 | Ga0395905_0720631 | Ga0395905_0720631_108_824 | 231 |
| 57 | 3300050509 | nmdc:mga0qj67_57268_c1 | nmdc:mga0qj67_57268_c1_137_832 | 231 |
| 58 | iso_pu_bacteria | 2919414237 | 2919419061 | 232 |
| 59 | 3300005406 | Ga0070703_10021952 | Ga0070703_100219522 | 233 |
| 60 | 3300005445 | Ga0070708_100204304 | Ga0070708_1002043042 | 233 |
| 61 | 3300005467 | Ga0070706_100065220 | Ga0070706_1000652204 | 233 |
| 62 | 3300005467 | Ga0070706_100113161 | Ga0070706_1001131613 | 233 |
| 63 | 3300005468 | Ga0070707_100363281 | Ga0070707_1003632812 | 233 |
| 64 | 3300005471 | Ga0070698_100074859 | Ga0070698_1000748594 | 233 |
| 65 | 3300005471 | Ga0070698_100523292 | Ga0070698_1005232922 | 233 |
| 66 | 3300005518 | Ga0070699_100224526 | Ga0070699_1002245262 | 233 |
| 67 | 3300005536 | Ga0070697_100168556 | Ga0070697_1001685562 | 233 |
| 68 | 3300005545 | Ga0070695_100001823 | Ga0070695_1000018232 | 233 |
| 69 | 3300005546 | Ga0070696_100131630 | Ga0070696_1001316302 | 233 |
| 70 | 3300005549 | Ga0070704_100003674 | Ga0070704_10000367410 | 233 |
| 71 | 3300005549 | Ga0070704_100100775 | Ga0070704_1001007752 | 233 |
| 72 | 3300006844 | Ga0075428_100190583 | Ga0075428_1001905833 | 233 |
| 73 | 3300006852 | Ga0075433_10017380 | Ga0075433_100173806 | 233 |
| 74 | 3300006871 | Ga0075434_100662988 | Ga0075434_1006629882 | 233 |
| 75 | 3300006914 | Ga0075436_100034093 | Ga0075436_1000340932 | 233 |
| 76 | 3300007076 | Ga0075435_100189710 | Ga0075435_1001897102 | 233 |
| 77 | 3300009147 | Ga0114129_10095814 | Ga0114129_100958143 | 233 |
| 78 | 3300025885 | Ga0207653_10008042 | Ga0207653_100080422 | 233 |
| 79 | 3300025885 | Ga0207653_10009102 | Ga0207653_100091025 | 233 |
| 80 | 3300025910 | Ga0207684_10062458 | Ga0207684_100624584 | 233 |
| 81 | 3300025910 | Ga0207684_10104899 | Ga0207684_101048993 | 233 |
| 82 | 3300025922 | Ga0207646_10026175 | Ga0207646_100261756 | 233 |
| 83 | 3300025922 | Ga0207646_10030593 | Ga0207646_100305932 | 233 |
| 84 | 3300050507 | nmdc:mga05p37_44976_c1 | nmdc:mga05p37_44976_c1_1005_1718 | 233 |
| 85 | 3300050512 | nmdc:mga0n895_7814_c1 | nmdc:mga0n895_7814_c1_3981_4694 | 233 |
| 86 | 3300050513 | nmdc:mga0rr50_13055_c1 | nmdc:mga0rr50_13055_c1_3883_4596 | 233 |
| 87 | 3300050514 | nmdc:mga08x19_27362_c1 | nmdc:mga08x19_27362_c1_349_1062 | 233 |
| 88 | 3300050515 | nmdc:mga0a205_46903_c1 | nmdc:mga0a205_46903_c1_1810_2523 | 233 |
| 89 | 3300005468 | Ga0070707_100434948 | Ga0070707_1004349482 | 234 |
| 90 | 3300005471 | Ga0070698_100000130 | Ga0070698_10000013032 | 234 |
| 91 | 3300005536 | Ga0070697_100056723 | Ga0070697_1000567234 | 234 |
| 92 | 3300046517 | Ga0495630_0012518 | Ga0495630_0012518_290_1006 | 234 |
| 93 | 3300005330 | Ga0070690_100059151 | Ga0070690_1000591512 | 235 |
| 94 | 3300049571 | Ga0501034_0019966 | Ga0501034_0019966_948_1682 | 235 |
| 95 | 3300035410 | Ga0373924_0099642 | Ga0373924_0099642_511_1236 | 237 |
| 96 | 3300009094 | Ga0111539_10182029 | Ga0111539_101820293 | 239 |
| 97 | 3300039437 | Ga0436365_0264674 | Ga0436365_0264674_3544_4263 | 239 |
| 98 | 3300046459 | Ga0495629_0267222 | Ga0495629_0267222_174_905 | 239 |
| 99 | 3300046473 | Ga0495582_0027542 | Ga0495582_0027542_1854_2585 | 239 |
| 100 | 3300046517 | Ga0495630_0000061 | Ga0495630_0000061_78714_79445 | 239 |
| 101 | 3300046526 | Ga0495666_0008473 | Ga0495666_0008473_1497_2228 | 239 |
| 102 | 3300046535 | Ga0495586_0000008 | Ga0495586_0000008_138720_139451 | 239 |
| 103 | 3300046642 | Ga0495634_0003119 | Ga0495634_0003119_4021_4752 | 239 |
| 104 | 3300046683 | Ga0495658_0036644 | Ga0495658_0036644_589_1320 | 239 |
| 105 | 3300047319 | Ga0495674_0013326 | Ga0495674_0013326_4061_4792 | 239 |
| 106 | 3300050511 | nmdc:mga08y16_154444_c1 | nmdc:mga08y16_154444_c1_1442_2179 | 239 |
| 107 | 3300053153 | Ga0500616_0003517 | Ga0500616_0003517_1439_2161 | 240 |
| 108 | iso_pu_bacteria | 2667528173 | 2671107647 | 241 |
| 109 | 3300050512 | nmdc:mga0n895_324202_c1 | nmdc:mga0n895_324202_c1_664_1392 | 242 |
| 110 | 3300050513 | nmdc:mga0rr50_560622_c1 | nmdc:mga0rr50_560622_c1_139_867 | 242 |
| 111 | 3300005435 | Ga0070714_100020474 | Ga0070714_1000204748 | 243 |
| 112 | 3300005983 | Ga0081540_1004050 | Ga0081540_100405010 | 243 |
| 113 | 3300025929 | Ga0207664_10024663 | Ga0207664_100246632 | 243 |
| 114 | 3300038443 | Ga0395901_0168772 | Ga0395901_0168772_63_794 | 243 |
| 115 | 3300039450 | Ga0436363_0656255 | Ga0436363_0656255_124_855 | 243 |
| 116 | 3300042008 | Ga0439450_069214 | Ga0439450_069214_66_797 | 243 |
| 117 | 3300048903 | Ga0496100_0020466 | Ga0496100_0020466_2873_3604 | 243 |
| 118 | 3300048904 | Ga0496101_0072543 | Ga0496101_0072543_1215_1946 | 243 |
| 119 | 3300048905 | Ga0496102_0359906 | Ga0496102_0359906_198_929 | 243 |
| 120 | 3300048906 | Ga0496103_0269300 | Ga0496103_0269300_264_995 | 243 |
| 121 | 3300048909 | Ga0496106_0047034 | Ga0496106_0047034_2084_2815 | 243 |
| 122 | 3300048910 | Ga0496107_0096977 | Ga0496107_0096977_736_1467 | 243 |
| 123 | 3300048918 | Ga0496115_0759730 | Ga0496115_0759730_15_746 | 243 |
| 124 | 3300050507 | nmdc:mga05p37_471338_c1 | nmdc:mga05p37_471338_c1_338_1069 | 243 |
| 125 | 3300050512 | nmdc:mga0n895_112746_c1 | nmdc:mga0n895_112746_c1_1019_1750 | 243 |
| 126 | 3300005458 | Ga0070681_10235443 | Ga0070681_102354432 | 244 |
| 127 | 3300006880 | Ga0075429_100214652 | Ga0075429_1002146522 | 244 |
| 128 | 3300009093 | Ga0105240_10003970 | Ga0105240_100039707 | 244 |
| 129 | 3300025913 | Ga0207695_10039159 | Ga0207695_100391596 | 244 |
| 130 | 3300025921 | Ga0207652_10253514 | Ga0207652_102535143 | 244 |
| 131 | 3300044694 | Ga0466963_0053859 | Ga0466963_0053859_1751_2485 | 244 |
| 132 | 3300045049 | Ga0466959_0244675 | Ga0466959_0244675_148_882 | 244 |
| 133 | 3300050507 | nmdc:mga05p37_122379_c1 | nmdc:mga05p37_122379_c1_1660_2394 | 244 |
| 134 | 3300050508 | nmdc:mga09592_293783_c1 | nmdc:mga09592_293783_c1_111_845 | 244 |
| 135 | 3300061719 | Ga0466962_0058213 | Ga0466962_0058213_336_1070 | 244 |
| 136 | iso_pu_bacteria | 2929199973 | 2929205460 | 244 |
| 137 | 3300002737 | JGI25162J39368_1000010 | JGI25162J39368_1000010208 | 245 |
| 138 | 3300002771 | JGI25163J39215_1000002 | JGI25163J39215_1000002124 | 245 |
| 139 | 3300002772 | JGI25164J39214_1000003 | JGI25164J39214_1000003157 | 245 |
| 140 | 3300003751 | Ga0055538_1000009 | Ga0055538_1000009208 | 245 |
| 141 | 3300003752 | Ga0055539_1000013 | Ga0055539_1000013208 | 245 |
| 142 | 3300003756 | Ga0055533_1000017 | Ga0055533_1000017208 | 245 |
| 143 | 3300003759 | Ga0055525_1000019 | Ga0055525_1000019208 | 245 |
| 144 | 3300003841 | Ga0055541_1000010 | Ga0055541_1000010208 | 245 |
| 145 | 3300005289 | Ga0065704_10001592 | Ga0065704_100015924 | 245 |
| 146 | 3300005330 | Ga0070690_100109238 | Ga0070690_1001092382 | 245 |
| 147 | 3300009036 | Ga0105244_10007954 | Ga0105244_100079544 | 245 |
| 148 | 3300009092 | Ga0105250_10003801 | Ga0105250_100038014 | 245 |
| 149 | 3300009177 | Ga0105248_10149413 | Ga0105248_101494133 | 245 |
| 150 | 3300013102 | Ga0157371_10000092 | Ga0157371_10000092124 | 245 |
| 151 | 3300013306 | Ga0163162_10064373 | Ga0163162_100643734 | 245 |
| 152 | 3300013307 | Ga0157372_10039284 | Ga0157372_100392844 | 245 |
| 153 | 3300013307 | Ga0157372_10608934 | Ga0157372_106089343 | 245 |
| 154 | 3300025207 | Ga0209760_100008 | Ga0209760_10000861 | 245 |
| 155 | 3300025224 | Ga0209784_100012 | Ga0209784_100012205 | 245 |
| 156 | 3300025225 | Ga0209566_100010 | Ga0209566_100010205 | 245 |
| 157 | 3300025226 | Ga0209674_100023 | Ga0209674_100023205 | 245 |
| 158 | 3300025230 | Ga0209563_100027 | Ga0209563_100027205 | 245 |
| 159 | 3300025231 | Ga0207427_100017 | Ga0207427_100017205 | 245 |
| 160 | 3300025233 | Ga0209437_100029 | Ga0209437_100029205 | 245 |
| 161 | 3300025253 | Ga0209677_100014 | Ga0209677_100014205 | 245 |
| 162 | 3300025711 | Ga0207696_1001589 | Ga0207696_10015898 | 245 |
| 163 | 3300025728 | Ga0207655_1000698 | Ga0207655_100069825 | 245 |
| 164 | 3300025916 | Ga0207663_10030955 | Ga0207663_100309553 | 245 |
| 165 | 3300025928 | Ga0207700_10000722 | Ga0207700_1000072213 | 245 |
| 166 | 3300041407 | Ga0439447_004856 | Ga0439447_004856_1438_2175 | 245 |
| 167 | 3300046471 | Ga0495650_0000052 | Ga0495650_0000052_206999_207736 | 245 |
| 168 | 3300046538 | Ga0495609_0117374 | Ga0495609_0117374_386_1123 | 245 |
| 169 | 3300046810 | Ga0495660_0000006 | Ga0495660_0000006_200567_201304 | 245 |
| 170 | 3300048907 | Ga0496104_0001450 | Ga0496104_0001450_17384_18121 | 245 |
| 171 | 3300048919 | Ga0496116_0000020 | Ga0496116_0000020_215120_215857 | 245 |
| 172 | 3300048920 | Ga0496117_0044916 | Ga0496117_0044916_1077_1814 | 245 |
| 173 | 3300048921 | Ga0496118_0000048 | Ga0496118_0000048_37708_38445 | 245 |
| 174 | 3300048921 | Ga0496118_0085625 | Ga0496118_0085625_74_811 | 245 |
| 175 | 3300048925 | Ga0496122_0000010 | Ga0496122_0000010_442043_442780 | 245 |
| 176 | 3300048926 | Ga0496123_0000025 | Ga0496123_0000025_97727_98464 | 245 |
| 177 | 3300048927 | Ga0496124_0000042 | Ga0496124_0000042_230485_231222 | 245 |
| 178 | 3300048928 | Ga0496125_0000054 | Ga0496125_0000054_270722_271459 | 245 |
| 179 | 3300048929 | Ga0496126_0008377 | Ga0496126_0008377_3978_4715 | 245 |
| 180 | 3300005347 | Ga0070668_100588914 | Ga0070668_1005889142 | 246 |
| 181 | 3300005439 | Ga0070711_100616746 | Ga0070711_1006167461 | 246 |
| 182 | 3300005457 | Ga0070662_100098240 | Ga0070662_1000982402 | 246 |
| 183 | 3300006028 | Ga0070717_10022802 | Ga0070717_100228022 | 246 |
| 184 | 3300006173 | Ga0070716_100201460 | Ga0070716_1002014602 | 246 |
| 185 | 3300006844 | Ga0075428_100089720 | Ga0075428_1000897202 | 246 |
| 186 | 3300006847 | Ga0075431_100796205 | Ga0075431_1007962052 | 246 |
| 187 | 3300009147 | Ga0114129_10186999 | Ga0114129_101869993 | 246 |
| 188 | 3300013306 | Ga0163162_10143765 | Ga0163162_101437653 | 246 |
| 189 | 3300025898 | Ga0207692_10001201 | Ga0207692_1000120112 | 246 |
| 190 | 3300025933 | Ga0207706_10135214 | Ga0207706_101352142 | 246 |
| 191 | 3300025961 | Ga0207712_10378185 | Ga0207712_103781852 | 246 |
| 192 | 3300025972 | Ga0207668_10454480 | Ga0207668_104544801 | 246 |
| 193 | 3300037853 | Ga0436364_1464490 | Ga0436364_1464490_414_1154 | 246 |
| 194 | 3300046794 | Ga0495589_0003210 | Ga0495589_0003210_5070_5921 | 246 |
| 195 | 3300049571 | Ga0501034_0029620 | Ga0501034_0029620_2530_3279 | 246 |
| 196 | 3300002773 | JGI25152J39213_1003751 | JGI25152J39213_10037514 | 247 |
| 197 | 3300003856 | Ga0058692_1000038 | Ga0058692_1000038107 | 247 |
| 198 | 3300003856 | Ga0058692_1000152 | Ga0058692_100015225 | 247 |
| 199 | 3300003856 | Ga0058692_1000454 | Ga0058692_10004542 | 247 |
| 200 | 3300005289 | Ga0065704_10086508 | Ga0065704_100865082 | 247 |
| 201 | 3300005471 | Ga0070698_100793034 | Ga0070698_1007930342 | 247 |
| 202 | 3300009036 | Ga0105244_10000520 | Ga0105244_100005205 | 247 |
| 203 | 3300009036 | Ga0105244_10040035 | Ga0105244_100400353 | 247 |
| 204 | 3300009036 | Ga0105244_10057713 | Ga0105244_100577132 | 247 |
| 205 | 3300009092 | Ga0105250_10000020 | Ga0105250_1000002097 | 247 |
| 206 | 3300013100 | Ga0157373_10013192 | Ga0157373_100131924 | 247 |
| 207 | 3300013102 | Ga0157371_10001662 | Ga0157371_100016623 | 247 |
| 208 | 3300013307 | Ga0157372_10226805 | Ga0157372_102268053 | 247 |
| 209 | 3300025728 | Ga0207655_1019916 | Ga0207655_10199162 | 247 |
| 210 | 3300027312 | Ga0209371_1000005 | Ga0209371_100000589 | 247 |
| 211 | 3300027312 | Ga0209371_1000322 | Ga0209371_100032212 | 247 |
| 212 | 3300027312 | Ga0209371_1002884 | Ga0209371_10028844 | 247 |
| 213 | 3300030500 | Ga0268256_1001754 | Ga0268256_10017544 | 247 |
| 214 | 3300041405 | Ga0439438_000049 | Ga0439438_000049_3646_4401 | 247 |
| 215 | 3300041405 | Ga0439438_004374 | Ga0439438_004374_2953_3705 | 247 |
| 216 | 3300041407 | Ga0439447_000283 | Ga0439447_000283_14860_15615 | 247 |
| 217 | 3300042006 | Ga0439432_007289 | Ga0439432_007289_985_1740 | 247 |
| 218 | 3300042006 | Ga0439432_026715 | Ga0439432_026715_252_1004 | 247 |
| 219 | 3300042010 | Ga0439452_000520 | Ga0439452_000520_19316_20071 | 247 |
| 220 | 3300046458 | Ga0495591_000850 | Ga0495591_000850_6537_7304 | 247 |
| 221 | 3300046471 | Ga0495650_0000008 | Ga0495650_0000008_352039_352806 | 247 |
| 222 | 3300046474 | Ga0495605_0040675 | Ga0495605_0040675_412_1179 | 247 |
| 223 | 3300046501 | Ga0495607_0010426 | Ga0495607_0010426_2063_2830 | 247 |
| 224 | 3300046507 | Ga0495606_0000289 | Ga0495606_0000289_63429_64196 | 247 |
| 225 | 3300046520 | Ga0495637_0079969 | Ga0495637_0079969_39_806 | 247 |
| 226 | 3300046522 | Ga0495643_0029096 | Ga0495643_0029096_267_1034 | 247 |
| 227 | 3300046524 | Ga0495648_0076525 | Ga0495648_0076525_839_1606 | 247 |
| 228 | 3300046530 | Ga0495654_0000091 | Ga0495654_0000091_35843_36610 | 247 |
| 229 | 3300046692 | Ga0495671_0005950 | Ga0495671_0005950_1433_2200 | 247 |
| 230 | 3300046694 | Ga0495649_0007136 | Ga0495649_0007136_3129_3896 | 247 |
| 231 | 3300046794 | Ga0495589_0053082 | Ga0495589_0053082_927_1694 | 247 |
| 232 | 3300046810 | Ga0495660_0000247 | Ga0495660_0000247_8874_9641 | 247 |
| 233 | 3300047320 | Ga0495672_0000003 | Ga0495672_0000003_388741_389508 | 247 |
| 234 | 3300047469 | Ga0495673_0000011 | Ga0495673_0000011_331114_331881 | 247 |
| 235 | 3300047470 | Ga0495681_0003836 | Ga0495681_0003836_1087_1854 | 247 |
| 236 | 3300048919 | Ga0496116_0000106 | Ga0496116_0000106_49860_50615 | 247 |
| 237 | 3300048919 | Ga0496116_0002167 | Ga0496116_0002167_16530_17282 | 247 |
| 238 | 3300048922 | Ga0496119_0000031 | Ga0496119_0000031_201693_202448 | 247 |
| 239 | 3300048922 | Ga0496119_0000907 | Ga0496119_0000907_21528_22283 | 247 |
| 240 | 3300048922 | Ga0496119_0001383 | Ga0496119_0001383_22282_23037 | 247 |
| 241 | 3300048922 | Ga0496119_0002629 | Ga0496119_0002629_5424_6179 | 247 |
| 242 | 3300048922 | Ga0496119_0034768 | Ga0496119_0034768_875_1627 | 247 |
| 243 | 3300048923 | Ga0496120_0000051 | Ga0496120_0000051_5449_6204 | 247 |
| 244 | 3300048923 | Ga0496120_0000092 | Ga0496120_0000092_142794_143549 | 247 |
| 245 | 3300048923 | Ga0496120_0000123 | Ga0496120_0000123_109932_110684 | 247 |
| 246 | 3300048923 | Ga0496120_0000751 | Ga0496120_0000751_36967_37722 | 247 |
| 247 | 3300048923 | Ga0496120_0000990 | Ga0496120_0000990_21514_22269 | 247 |
| 248 | 3300048925 | Ga0496122_0011558 | Ga0496122_0011558_7257_8012 | 247 |
| 249 | 3300048926 | Ga0496123_0009292 | Ga0496123_0009292_5220_5975 | 247 |
| 250 | 3300048927 | Ga0496124_0000008 | Ga0496124_0000008_59925_60680 | 247 |
| 251 | 3300048927 | Ga0496124_0008835 | Ga0496124_0008835_3859_4611 | 247 |
| 252 | 3300048929 | Ga0496126_0017706 | Ga0496126_0017706_1579_2334 | 247 |
| 253 | 3300049459 | Ga0495678_000260 | Ga0495678_000260_929_1696 | 247 |
| 254 | 3300053126 | Ga0500621_000004 | Ga0500621_000004_325197_325964 | 247 |
| 255 | iso_pu_bacteria | 2511231025 | 2511382711 | 247 |
| 256 | iso_pu_bacteria | 2585427591 | 2585827214 | 247 |
| 257 | iso_pu_bacteria | 2585427592 | 2585833269 | 247 |
| 258 | iso_pu_bacteria | 2602042066 | 2603698375 | 247 |
| 259 | iso_pu_bacteria | 2602042109 | 2603866898 | 247 |
| 260 | iso_pu_bacteria | 2772190666 | 2772438994 | 247 |
| 261 | iso_pu_bacteria | 2847085930 | 2847089193 | 247 |
| 262 | iso_pu_bacteria | 2869551831 | 2869554444 | 247 |
| 263 | iso_pu_bacteria | 2888366609 | 2888369038 | 247 |
| 264 | iso_pu_bacteria | 2888373701 | 2888378225 | 247 |
| 265 | iso_pu_bacteria | 2904504865 | 2904508212 | 247 |
| 266 | iso_pu_bacteria | 2908669403 | 2908671819 | 247 |
| 267 | iso_pu_bacteria | 2919150387 | 2919152811 | 247 |
| 268 | iso_pu_bacteria | 2927143783 | 2927146772 | 247 |
| 269 | iso_pu_bacteria | 2937967321 | 2937967610 | 247 |
| 270 | iso_pu_bacteria | 8004592986 | 8004597358 | 247 |
| 271 | iso_pu_bacteria | 8018221730 | 8018225540 | 247 |
| 272 | 3300014325 | Ga0163163_10000375 | Ga0163163_1000037520 | 249 |
| 273 | 2162886012 | MBSR1b_contig_1115626 | MBSR1b_0507.00000590 | 256 |
| 274 | 2162886012 | MBSR1b_contig_7140121 | MBSR1b_0976.00000010 | 256 |
| 275 | 3300048913 | Ga0496110_0201327 | Ga0496110_0201327_543_1313 | 256 |
| 276 | 3300048916 | Ga0496113_0122165 | Ga0496113_0122165_160_930 | 256 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vrd-assembly1.cif.gz_B | crystal structure for methylobacterium extorquens pqqcd (natural fusion) | 0.9882 | 5 | 236 |
| 5vrd-assembly1.cif.gz_B | crystal structure for methylobacterium extorquens pqqcd (natural fusion) | 0.9832 | 5 | 236 |
| 5vrd-assembly2.cif.gz_A | crystal structure for methylobacterium extorquens pqqcd (natural fusion) | 0.9725 | 4 | 239 |
| 5vrd-assembly2.cif.gz_C-2 | crystal structure for methylobacterium extorquens pqqcd (natural fusion) | 0.9683 | 8 | 232 |
| 5vrd-assembly2.cif.gz_A | crystal structure for methylobacterium extorquens pqqcd (natural fusion) | 0.9679 | 4 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rcwC00 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.9145 | 10 | 224 | 1.20.910.10 |
| 1rcwC00 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.9021 | 10 | 224 | 1.20.910.10 |
| 3hmlA00 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.8689 | 1 | 243 | 1.20.910.10 |
| 3bjdA02 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.8653 | 5 | 227 | 1.20.910.10 |
| 3bjdA02 | Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like | 0.8507 | 5 | 227 | 1.20.910.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5N256-F1-model_v4 | Pyrroloquinoline-quinone synthase PqqC (EC 1.3.3.11) | 0.9966 | 96 | 241 |
GO:0006790
GO:0018189 GO:0033732 GO:0072527 GO:1901615 |
| AF-A0A371XEM5-F1-model_v4 | Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) | 0.9965 | 4 | 243 |
GO:0006790
GO:0018189 GO:0033732 GO:0072527 GO:1901615 |
| AF-A0A6N6SYR1-F1-model_v4 | Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) | 0.9952 | 5 | 241 |
GO:0006790
GO:0018189 GO:0033732 GO:0072527 GO:1901615 |
| AF-A0A2V9TBV9-F1-model_v4 | Pyrroloquinoline quinone biosynthesis protein PqqC | 0.9943 | 63 | 242 |
GO:0006790
GO:0016491 GO:0018189 GO:0072527 GO:1901615 |
| AF-A0A7W7KB19-F1-model_v4 | Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) | 0.9939 | 65 | 241 |
GO:0006790
GO:0018189 GO:0033732 GO:0072527 GO:1901615 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar