F380965

General Info

Members Datasets Scaffolds Average Seq Length
276 203 252 242

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10235443|Ga0070681_102354432
Length 258
Sequence MSRAPLDRRTFTARLRNIGAASYHHKHPFHERMNSGELDPQALQTWVANRLYYQTSIPLKDAALISNCPVREVRRIWLHRIVDHDGTRGDEGGIGAWLRLGEACGLARKQLLGGSLIVPGVRFAVDAYVHFAATQPWPIAVASSLTELFAPNLMAQRLEAFKRFYPWVKPRGLEYFQNRLTQAPRDSGEALALTLKYCDTREMQDRAIAALQFKCDLLWAMLDSIHLACSPRNSSPANPVESRPGVADNKTAIRRARD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
6 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
7 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
8 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
9 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
10 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
11 2847085930 Erwinia persicina B64 Isolate Bulb
12 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
13 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
14 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
15 2904504865 Serratia marcescens 1822 Isolate Unclassified
16 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
17 2919150387 Rahnella aceris 1817 Isolate Unclassified
18 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
19 2927143783 Rahnella sp. 2050 Isolate Unclassified
20 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
21 2937967321 Serratia sp. YC16 Isolate Unclassified
22 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
23 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
24 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
25 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
30 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
31 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
32 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
128 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
129 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
159 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
165 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
183 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
199 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
202 8004592986 Serratia sp. S119 Isolate Unclassified
203 8018221730 Enterobacter sp. CM29 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.3
Metatranscriptomes 0
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.36
Endosphere 7.25
Nodule 1.09
Rhizoplane 4.71
Rhizosphere 71.74
Stem 0
Stem Tuber 0
Unclassified 14.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1115626 2162886012 Bacteria 1184
2 MBSR1b_contig_7140121 2162886012 Bacteria 1186
3 JGI25162J39368_1000010 3300002737 Bacteria 389629
4 JGI25163J39215_1000002 3300002771 Bacteria 152475
5 JGI25164J39214_1000003 3300002772 Bacteria 389390
6 JGI25152J39213_1003751 3300002773 Bacteria 5067
7 JGI25406J46586_10000023 3300003203 Bacteria 76640
8 rootH2_10063248 3300003320 Bacteria 18374
9 Ga0055538_1000009 3300003751 Bacteria 389629
10 Ga0055539_1000013 3300003752 Bacteria 389629
11 Ga0055533_1000017 3300003756 Bacteria 389629
12 Ga0055525_1000019 3300003759 Bacteria 389629
13 Ga0055541_1000010 3300003841 Bacteria 389629
14 Ga0058692_1000038 3300003856 Bacteria 140136
15 Ga0058692_1000152 3300003856 Bacteria 44110
16 Ga0058692_1000454 3300003856 Bacteria 18505
17 Ga0065704_10001592 3300005289 Bacteria 7202
18 Ga0065704_10086508 3300005289 Bacteria 3112
19 Ga0070690_100059151 3300005330 Unclassified 2463
20 Ga0070690_100109238 3300005330 Bacteria 1843
21 Ga0070661_100000480 3300005344 Bacteria 30486
22 Ga0070668_100588914 3300005347 Bacteria 972
23 Ga0070659_100454083 3300005366 Bacteria 1087
24 Ga0070703_10008335 3300005406 Bacteria 2914
25 Ga0070703_10021952 3300005406 Bacteria 1870
26 Ga0070714_100020474 3300005435 Bacteria 5402
27 Ga0070711_100616746 3300005439 Bacteria 906
28 Ga0070694_100027479 3300005444 Bacteria 3695
29 Ga0070708_100068085 3300005445 Bacteria 3199
30 Ga0070708_100204304 3300005445 Bacteria 1850
31 Ga0070678_100015574 3300005456 Bacteria 4836
32 Ga0070662_100098240 3300005457 Bacteria 2211
33 Ga0070681_10235443 3300005458 Bacteria 1745
34 Ga0070706_100065220 3300005467 Bacteria 3367
35 Ga0070706_100113161 3300005467 Bacteria 2527
36 Ga0070707_100363281 3300005468 Bacteria 1406
37 Ga0070707_100434948 3300005468 Bacteria 1272
38 Ga0070698_100000130 3300005471 Bacteria 65522
39 Ga0070698_100074859 3300005471 Bacteria 3391
40 Ga0070698_100523292 3300005471 Bacteria 1124
41 Ga0070698_100793034 3300005471 Bacteria 891
42 Ga0070699_100224526 3300005518 Bacteria 1674
43 Ga0070684_100886478 3300005535 Bacteria 836
44 Ga0070697_100049253 3300005536 Bacteria 3419
45 Ga0070697_100056723 3300005536 Bacteria 3186
46 Ga0070697_100168556 3300005536 Bacteria 1852
47 Ga0070695_100001823 3300005545 Bacteria 12006
48 Ga0070696_100131630 3300005546 Bacteria 1820
49 Ga0070704_100003674 3300005549 Bacteria 8830
50 Ga0070704_100100775 3300005549 Bacteria 2175
51 Ga0068864_100079668 3300005618 Bacteria 2868
52 Ga0068863_100272478 3300005841 Unclassified 1639
53 Ga0081540_1004050 3300005983 Bacteria 11349
54 Ga0081539_10000014 3300005985 Bacteria 411270
55 Ga0070717_10000044 3300006028 Bacteria 108873
56 Ga0070717_10022802 3300006028 Bacteria 4952
57 Ga0070716_100201460 3300006173 Bacteria 1323
58 Ga0075428_100089720 3300006844 Bacteria 3353
59 Ga0075428_100190583 3300006844 Archaea 2218
60 Ga0075431_100796205 3300006847 Bacteria 919
61 Ga0075433_10017380 3300006852 Bacteria 5956
62 Ga0075434_100662988 3300006871 Bacteria 1061
63 Ga0075429_100214652 3300006880 Bacteria 1686
64 Ga0075436_100034093 3300006914 Bacteria 3509
65 Ga0075435_100189710 3300007076 Bacteria 1739
66 Ga0075435_100225666 3300007076 Bacteria 1591
67 Ga0105244_10000520 3300009036 Bacteria 34332
68 Ga0105244_10007954 3300009036 Bacteria 6678
69 Ga0105244_10040035 3300009036 Bacteria 2436
70 Ga0105244_10057713 3300009036 Bacteria 1961
71 Ga0105250_10000020 3300009092 Bacteria 242010
72 Ga0105250_10003801 3300009092 Bacteria 7087
73 Ga0105240_10003970 3300009093 Bacteria 22840
74 Ga0105240_10133955 3300009093 Bacteria 2968
75 Ga0111539_10182029 3300009094 Archaea 2454
76 Ga0114129_10095814 3300009147 Bacteria 4109
77 Ga0114129_10186999 3300009147 Bacteria 2814
78 Ga0105248_10149413 3300009177 Bacteria 2636
79 Ga0157373_10013192 3300013100 Bacteria 6065
80 Ga0157371_10000092 3300013102 Bacteria 141282
81 Ga0157371_10001662 3300013102 Bacteria 22693
82 Ga0157374_10000041 3300013296 Bacteria 150386
83 Ga0163162_10064373 3300013306 Bacteria 3711
84 Ga0163162_10143765 3300013306 Bacteria 2500
85 Ga0157372_10039284 3300013307 Bacteria 5222
86 Ga0157372_10226805 3300013307 Bacteria 2166
87 Ga0157372_10608934 3300013307 Bacteria 1273
88 Ga0163163_10000375 3300014325 Bacteria 42824
89 Ga0163163_10039469 3300014325 Bacteria 4607
90 Ga0163163_11266898 3300014325 Unclassified 799
91 Ga0157376_10000279 3300014969 Bacteria 34619
92 Ga0209760_100008 3300025207 Bacteria 211332
93 Ga0209784_100012 3300025224 Bacteria 535823
94 Ga0209566_100010 3300025225 Bacteria 535823
95 Ga0209674_100023 3300025226 Bacteria 535823
96 Ga0209563_100027 3300025230 Bacteria 535823
97 Ga0207427_100017 3300025231 Bacteria 535823
98 Ga0209437_100029 3300025233 Bacteria 535823
99 Ga0209677_100014 3300025253 Bacteria 535823
100 Ga0209051_1011251 3300025303 Bacteria 4436
101 Ga0207696_1001589 3300025711 Bacteria 12013
102 Ga0207655_1000698 3300025728 Bacteria 38934
103 Ga0207655_1019916 3300025728 Bacteria 3478
104 Ga0207653_10008042 3300025885 Bacteria 3287
105 Ga0207653_10009102 3300025885 Bacteria 3098
106 Ga0207692_10001201 3300025898 Bacteria 9613
107 Ga0207684_10062458 3300025910 Bacteria 3163
108 Ga0207684_10104899 3300025910 Bacteria 2417
109 Ga0207695_10039159 3300025913 Bacteria 5097
110 Ga0207663_10030955 3300025916 Bacteria 3162
111 Ga0207649_10003906 3300025920 Bacteria 8130
112 Ga0207652_10253514 3300025921 Unclassified 1587
113 Ga0207646_10026175 3300025922 Bacteria 5326
114 Ga0207646_10030593 3300025922 Bacteria 4877
115 Ga0207700_10000722 3300025928 Bacteria 19061
116 Ga0207664_10024663 3300025929 Bacteria 4521
117 Ga0207706_10135214 3300025933 Bacteria 2169
118 Ga0207712_10378185 3300025961 Bacteria 1184
119 Ga0207668_10454480 3300025972 Bacteria 1094
120 Ga0207648_10857032 3300026089 Unclassified 847
121 Ga0207676_10327930 3300026095 Bacteria 1408
122 Ga0207683_10215827 3300026121 Bacteria 1747
123 Ga0209371_1000005 3300027312 Bacteria 1061740
124 Ga0209371_1000322 3300027312 Bacteria 52608
125 Ga0209371_1002884 3300027312 Bacteria 9036
126 Ga0265338_10035376 3300028800 Bacteria 4803
127 Ga0265338_10066906 3300028800 Bacteria 3107
128 Ga0268256_1001754 3300030500 Bacteria 12253
129 Ga0307511_10026744 3300030521 Bacteria 5286
130 Ga0265340_10150587 3300031247 Bacteria 1060
131 Ga0373934_0004410 3300035086 Bacteria 5198
132 Ga0373955_0054900 3300035172 Bacteria 2180
133 Ga0373924_0099642 3300035410 Bacteria 1249
134 Ga0373937_0042574 3300036401 Bacteria 4143
135 Ga0373925_0002492 3300037068 Bacteria 14716
136 Ga0395905_0720631 3300037471 Bacteria 900
137 Ga0436364_1464490 3300037853 Bacteria 1340
138 Ga0395901_0168772 3300038443 Bacteria 2296
139 Ga0436365_0264674 3300039437 Bacteria 4682
140 Ga0436363_0656255 3300039450 Bacteria 1187
141 Ga0439438_000049 3300041405 Bacteria 57788
142 Ga0439438_004374 3300041405 Bacteria 5439
143 Ga0439447_000283 3300041407 Bacteria 18017
144 Ga0439447_004856 3300041407 Bacteria 4562
145 Ga0439447_062205 3300041407 Bacteria 877
146 Ga0439432_007289 3300042006 Bacteria 3924
147 Ga0439432_026715 3300042006 Bacteria 1889
148 Ga0439432_070088 3300042006 Bacteria 1070
149 Ga0439450_069214 3300042008 Bacteria 864
150 Ga0439452_000520 3300042010 Bacteria 20614
151 Ga0466965_0281047 3300044683 Unclassified 899
152 Ga0466963_0053859 3300044694 Bacteria 2673
153 Ga0466959_0244675 3300045049 Bacteria 1238
154 Ga0451576_0350852 3300045051 Bacteria 1545
155 Ga0495591_000850 3300046458 Bacteria 21477
156 Ga0495629_0267222 3300046459 Unclassified 1175
157 Ga0495651_0006632 3300046462 Bacteria 8843
158 Ga0495650_0000008 3300046471 Bacteria 688246
159 Ga0495650_0000052 3300046471 Bacteria 318176
160 Ga0495582_0027542 3300046473 Unclassified 3116
161 Ga0495605_0040675 3300046474 Bacteria 2319
162 Ga0495607_0010426 3300046501 Bacteria 6250
163 Ga0495606_0000289 3300046507 Bacteria 87270
164 Ga0495608_0130803 3300046511 Bacteria 1606
165 Ga0495630_0000061 3300046517 Bacteria 88178
166 Ga0495630_0012518 3300046517 Bacteria 6161
167 Ga0495637_0079969 3300046520 Bacteria 1305
168 Ga0495643_0029096 3300046522 Bacteria 3093
169 Ga0495648_0076525 3300046524 Bacteria 1921
170 Ga0495666_0008473 3300046526 Bacteria 5158
171 Ga0495654_0000091 3300046530 Bacteria 101543
172 Ga0495586_0000008 3300046535 Bacteria 148781
173 Ga0495609_0117374 3300046538 Bacteria 1145
174 Ga0495622_0014816 3300046557 Bacteria 3624
175 Ga0495667_0122335 3300046559 Bacteria 1680
176 Ga0495634_0003119 3300046642 Bacteria 13472
177 Ga0495657_0035503 3300046675 Bacteria 3454
178 Ga0495658_0036644 3300046683 Unclassified 2707
179 Ga0495671_0005950 3300046692 Bacteria 7093
180 Ga0495649_0007136 3300046694 Bacteria 6864
181 Ga0495589_0003210 3300046794 Bacteria 8926
182 Ga0495589_0053082 3300046794 Bacteria 2001
183 Ga0495660_0000006 3300046810 Bacteria 571713
184 Ga0495660_0000247 3300046810 Bacteria 52182
185 Ga0495674_0013326 3300047319 Bacteria 7731
186 Ga0495672_0000003 3300047320 Bacteria 728845
187 Ga0495676_0002193 3300047321 Bacteria 17298
188 Ga0495680_0200319 3300047322 Bacteria 1432
189 Ga0495673_0000011 3300047469 Bacteria 674140
190 Ga0495681_0003836 3300047470 Bacteria 10403
191 Ga0495602_0022995 3300048088 Bacteria 6084
192 Ga0496100_0020466 3300048903 Bacteria 3967
193 Ga0496101_0072543 3300048904 Bacteria 2527
194 Ga0496102_0359906 3300048905 Bacteria 1370
195 Ga0496103_0269300 3300048906 Bacteria 1096
196 Ga0496104_0001450 3300048907 Bacteria 20487
197 Ga0496106_0047034 3300048909 Bacteria 3245
198 Ga0496107_0096977 3300048910 Bacteria 2158
199 Ga0496110_0201327 3300048913 Bacteria 1809
200 Ga0496113_0122165 3300048916 Bacteria 2037
201 Ga0496115_0759730 3300048918 Bacteria 757
202 Ga0496116_0000020 3300048919 Bacteria 501307
203 Ga0496116_0000106 3300048919 Bacteria 188941
204 Ga0496116_0002167 3300048919 Bacteria 20906
205 Ga0496116_0015938 3300048919 Bacteria 5910
206 Ga0496117_0044916 3300048920 Bacteria 3196
207 Ga0496118_0000048 3300048921 Bacteria 253404
208 Ga0496118_0085625 3300048921 Bacteria 2193
209 Ga0496119_0000031 3300048922 Bacteria 239685
210 Ga0496119_0000907 3300048922 Bacteria 38493
211 Ga0496119_0001383 3300048922 Bacteria 29487
212 Ga0496119_0002629 3300048922 Bacteria 19489
213 Ga0496119_0034768 3300048922 Bacteria 3311
214 Ga0496120_0000051 3300048923 Bacteria 186239
215 Ga0496120_0000092 3300048923 Bacteria 148990
216 Ga0496120_0000123 3300048923 Bacteria 129989
217 Ga0496120_0000751 3300048923 Bacteria 47018
218 Ga0496120_0000990 3300048923 Bacteria 38462
219 Ga0496122_0000010 3300048925 Bacteria 547417
220 Ga0496122_0011558 3300048925 Bacteria 8919
221 Ga0496123_0000025 3300048926 Bacteria 323956
222 Ga0496123_0009292 3300048926 Bacteria 8873
223 Ga0496124_0000008 3300048927 Bacteria 864372
224 Ga0496124_0000042 3300048927 Bacteria 301126
225 Ga0496124_0008835 3300048927 Bacteria 10460
226 Ga0496125_0000054 3300048928 Bacteria 278377
227 Ga0496126_0008377 3300048929 Bacteria 11155
228 Ga0496126_0017706 3300048929 Bacteria 7096
229 Ga0496126_0805114 3300048929 Bacteria 720
230 Ga0495678_000260 3300049459 Bacteria 58774
231 Ga0501034_0019966 3300049571 Bacteria 6843
232 Ga0501034_0029620 3300049571 Bacteria 5566
233 Ga0501039_0723555 3300049575 Archaea 778
234 nmdc:mga05p37_122379_c1 3300050507 Bacteria 3195
235 nmdc:mga05p37_44976_c1 3300050507 Bacteria 5432
236 nmdc:mga05p37_471338_c1 3300050507 Bacteria 1449
237 nmdc:mga09592_293783_c1 3300050508 Bacteria 1409
238 nmdc:mga0qj67_57268_c1 3300050509 Bacteria 3089
239 nmdc:mga08y16_154444_c1 3300050511 Archaea 2385
240 nmdc:mga0n895_112746_c1 3300050512 Bacteria 2736
241 nmdc:mga0n895_324202_c1 3300050512 Bacteria 1561
242 nmdc:mga0n895_7814_c1 3300050512 Bacteria 9216
243 nmdc:mga0rr50_112579_c1 3300050513 Bacteria 2155
244 nmdc:mga0rr50_13055_c1 3300050513 Bacteria 5392
245 nmdc:mga0rr50_560622_c1 3300050513 Bacteria 973
246 nmdc:mga08x19_27362_c1 3300050514 Bacteria 3566
247 nmdc:mga0a205_46903_c1 3300050515 Bacteria 4168
248 nmdc:mga0a205_573118_c1 3300050515 Bacteria 983
249 nmdc:mga0a205_800009_c1 3300050515 Bacteria 791
250 Ga0500621_000004 3300053126 Bacteria 485792
251 Ga0500616_0003517 3300053153 Bacteria 11894
252 Ga0466962_0058213 3300061719 Bacteria 1845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049575 Ga0501039_0723555 Ga0501039_0723555_164_766 197
2 3300037068 Ga0373925_0002492 Ga0373925_0002492_8224_8964 203
3 3300035086 Ga0373934_0004410 Ga0373934_0004410_926_1633 205
4 3300035172 Ga0373955_0054900 Ga0373955_0054900_1004_1711 205
5 3300036401 Ga0373937_0042574 Ga0373937_0042574_2863_3570 205
6 3300046511 Ga0495608_0130803 Ga0495608_0130803_826_1533 205
7 3300046559 Ga0495667_0122335 Ga0495667_0122335_561_1268 205
8 3300046675 Ga0495657_0035503 Ga0495657_0035503_1117_1824 205
9 3300047322 Ga0495680_0200319 Ga0495680_0200319_222_929 205
10 3300048088 Ga0495602_0022995 Ga0495602_0022995_4713_5420 205
11 3300050515 nmdc:mga0a205_800009_c1 nmdc:mga0a205_800009_c1_14_634 206
12 3300047321 Ga0495676_0002193 Ga0495676_0002193_13_648 211
13 3300026089 Ga0207648_10857032 Ga0207648_108570321 213
14 3300044683 Ga0466965_0281047 Ga0466965_0281047_28_675 215
15 3300046462 Ga0495651_0006632 Ga0495651_0006632_6390_7058 216
16 3300041407 Ga0439447_062205 Ga0439447_062205_11_670 219
17 3300042006 Ga0439432_070088 Ga0439432_070088_385_1044 219
18 3300048919 Ga0496116_0015938 Ga0496116_0015938_41_700 219
19 3300048929 Ga0496126_0805114 Ga0496126_0805114_45_704 219
20 3300030521 Ga0307511_10026744 Ga0307511_100267443 220
21 3300005344 Ga0070661_100000480 Ga0070661_10000048016 221
22 3300005366 Ga0070659_100454083 Ga0070659_1004540831 221
23 3300005456 Ga0070678_100015574 Ga0070678_1000155742 221
24 3300025920 Ga0207649_10003906 Ga0207649_100039064 221
25 3300026121 Ga0207683_10215827 Ga0207683_102158272 221
26 3300003320 rootH2_10063248 rootH2_100632486 223
27 3300028800 Ga0265338_10066906 Ga0265338_100669062 226
28 iso_pu_bacteria 2513237150 2513952665 226
29 iso_pu_bacteria 2513237165 2514045181 226
30 iso_pu_bacteria 644736347 644750724 226
31 3300005535 Ga0070684_100886478 Ga0070684_1008864781 227
32 3300005618 Ga0068864_100079668 Ga0068864_1000796682 227
33 3300005841 Ga0068863_100272478 Ga0068863_1002724782 227
34 3300014325 Ga0163163_10039469 Ga0163163_100394694 227
35 3300026095 Ga0207676_10327930 Ga0207676_103279301 227
36 3300045051 Ga0451576_0350852 Ga0451576_0350852_532_1227 227
37 3300005406 Ga0070703_10008335 Ga0070703_100083353 228
38 3300005444 Ga0070694_100027479 Ga0070694_1000274794 228
39 3300005445 Ga0070708_100068085 Ga0070708_1000680854 228
40 3300005536 Ga0070697_100049253 Ga0070697_1000492532 228
41 3300006028 Ga0070717_10000044 Ga0070717_1000004454 228
42 3300009093 Ga0105240_10133955 Ga0105240_101339553 228
43 3300014325 Ga0163163_11266898 Ga0163163_112668981 228
44 3300025303 Ga0209051_1011251 Ga0209051_10112515 228
45 3300050515 nmdc:mga0a205_573118_c1 nmdc:mga0a205_573118_c1_91_789 228
46 3300007076 Ga0075435_100225666 Ga0075435_1002256661 229
47 3300046557 Ga0495622_0014816 Ga0495622_0014816_2241_2969 229
48 3300050513 nmdc:mga0rr50_112579_c1 nmdc:mga0rr50_112579_c1_1187_1876 229
49 iso_pu_bacteria 3006973921 3006978319 229
50 3300003203 JGI25406J46586_10000023 JGI25406J46586_1000002319 230
51 3300005985 Ga0081539_10000014 Ga0081539_1000001428 230
52 3300013296 Ga0157374_10000041 Ga0157374_10000041101 230
53 3300014969 Ga0157376_10000279 Ga0157376_1000027921 230
54 3300028800 Ga0265338_10035376 Ga0265338_100353763 230
55 3300031247 Ga0265340_10150587 Ga0265340_101505872 231
56 3300037471 Ga0395905_0720631 Ga0395905_0720631_108_824 231
57 3300050509 nmdc:mga0qj67_57268_c1 nmdc:mga0qj67_57268_c1_137_832 231
58 iso_pu_bacteria 2919414237 2919419061 232
59 3300005406 Ga0070703_10021952 Ga0070703_100219522 233
60 3300005445 Ga0070708_100204304 Ga0070708_1002043042 233
61 3300005467 Ga0070706_100065220 Ga0070706_1000652204 233
62 3300005467 Ga0070706_100113161 Ga0070706_1001131613 233
63 3300005468 Ga0070707_100363281 Ga0070707_1003632812 233
64 3300005471 Ga0070698_100074859 Ga0070698_1000748594 233
65 3300005471 Ga0070698_100523292 Ga0070698_1005232922 233
66 3300005518 Ga0070699_100224526 Ga0070699_1002245262 233
67 3300005536 Ga0070697_100168556 Ga0070697_1001685562 233
68 3300005545 Ga0070695_100001823 Ga0070695_1000018232 233
69 3300005546 Ga0070696_100131630 Ga0070696_1001316302 233
70 3300005549 Ga0070704_100003674 Ga0070704_10000367410 233
71 3300005549 Ga0070704_100100775 Ga0070704_1001007752 233
72 3300006844 Ga0075428_100190583 Ga0075428_1001905833 233
73 3300006852 Ga0075433_10017380 Ga0075433_100173806 233
74 3300006871 Ga0075434_100662988 Ga0075434_1006629882 233
75 3300006914 Ga0075436_100034093 Ga0075436_1000340932 233
76 3300007076 Ga0075435_100189710 Ga0075435_1001897102 233
77 3300009147 Ga0114129_10095814 Ga0114129_100958143 233
78 3300025885 Ga0207653_10008042 Ga0207653_100080422 233
79 3300025885 Ga0207653_10009102 Ga0207653_100091025 233
80 3300025910 Ga0207684_10062458 Ga0207684_100624584 233
81 3300025910 Ga0207684_10104899 Ga0207684_101048993 233
82 3300025922 Ga0207646_10026175 Ga0207646_100261756 233
83 3300025922 Ga0207646_10030593 Ga0207646_100305932 233
84 3300050507 nmdc:mga05p37_44976_c1 nmdc:mga05p37_44976_c1_1005_1718 233
85 3300050512 nmdc:mga0n895_7814_c1 nmdc:mga0n895_7814_c1_3981_4694 233
86 3300050513 nmdc:mga0rr50_13055_c1 nmdc:mga0rr50_13055_c1_3883_4596 233
87 3300050514 nmdc:mga08x19_27362_c1 nmdc:mga08x19_27362_c1_349_1062 233
88 3300050515 nmdc:mga0a205_46903_c1 nmdc:mga0a205_46903_c1_1810_2523 233
89 3300005468 Ga0070707_100434948 Ga0070707_1004349482 234
90 3300005471 Ga0070698_100000130 Ga0070698_10000013032 234
91 3300005536 Ga0070697_100056723 Ga0070697_1000567234 234
92 3300046517 Ga0495630_0012518 Ga0495630_0012518_290_1006 234
93 3300005330 Ga0070690_100059151 Ga0070690_1000591512 235
94 3300049571 Ga0501034_0019966 Ga0501034_0019966_948_1682 235
95 3300035410 Ga0373924_0099642 Ga0373924_0099642_511_1236 237
96 3300009094 Ga0111539_10182029 Ga0111539_101820293 239
97 3300039437 Ga0436365_0264674 Ga0436365_0264674_3544_4263 239
98 3300046459 Ga0495629_0267222 Ga0495629_0267222_174_905 239
99 3300046473 Ga0495582_0027542 Ga0495582_0027542_1854_2585 239
100 3300046517 Ga0495630_0000061 Ga0495630_0000061_78714_79445 239
101 3300046526 Ga0495666_0008473 Ga0495666_0008473_1497_2228 239
102 3300046535 Ga0495586_0000008 Ga0495586_0000008_138720_139451 239
103 3300046642 Ga0495634_0003119 Ga0495634_0003119_4021_4752 239
104 3300046683 Ga0495658_0036644 Ga0495658_0036644_589_1320 239
105 3300047319 Ga0495674_0013326 Ga0495674_0013326_4061_4792 239
106 3300050511 nmdc:mga08y16_154444_c1 nmdc:mga08y16_154444_c1_1442_2179 239
107 3300053153 Ga0500616_0003517 Ga0500616_0003517_1439_2161 240
108 iso_pu_bacteria 2667528173 2671107647 241
109 3300050512 nmdc:mga0n895_324202_c1 nmdc:mga0n895_324202_c1_664_1392 242
110 3300050513 nmdc:mga0rr50_560622_c1 nmdc:mga0rr50_560622_c1_139_867 242
111 3300005435 Ga0070714_100020474 Ga0070714_1000204748 243
112 3300005983 Ga0081540_1004050 Ga0081540_100405010 243
113 3300025929 Ga0207664_10024663 Ga0207664_100246632 243
114 3300038443 Ga0395901_0168772 Ga0395901_0168772_63_794 243
115 3300039450 Ga0436363_0656255 Ga0436363_0656255_124_855 243
116 3300042008 Ga0439450_069214 Ga0439450_069214_66_797 243
117 3300048903 Ga0496100_0020466 Ga0496100_0020466_2873_3604 243
118 3300048904 Ga0496101_0072543 Ga0496101_0072543_1215_1946 243
119 3300048905 Ga0496102_0359906 Ga0496102_0359906_198_929 243
120 3300048906 Ga0496103_0269300 Ga0496103_0269300_264_995 243
121 3300048909 Ga0496106_0047034 Ga0496106_0047034_2084_2815 243
122 3300048910 Ga0496107_0096977 Ga0496107_0096977_736_1467 243
123 3300048918 Ga0496115_0759730 Ga0496115_0759730_15_746 243
124 3300050507 nmdc:mga05p37_471338_c1 nmdc:mga05p37_471338_c1_338_1069 243
125 3300050512 nmdc:mga0n895_112746_c1 nmdc:mga0n895_112746_c1_1019_1750 243
126 3300005458 Ga0070681_10235443 Ga0070681_102354432 244
127 3300006880 Ga0075429_100214652 Ga0075429_1002146522 244
128 3300009093 Ga0105240_10003970 Ga0105240_100039707 244
129 3300025913 Ga0207695_10039159 Ga0207695_100391596 244
130 3300025921 Ga0207652_10253514 Ga0207652_102535143 244
131 3300044694 Ga0466963_0053859 Ga0466963_0053859_1751_2485 244
132 3300045049 Ga0466959_0244675 Ga0466959_0244675_148_882 244
133 3300050507 nmdc:mga05p37_122379_c1 nmdc:mga05p37_122379_c1_1660_2394 244
134 3300050508 nmdc:mga09592_293783_c1 nmdc:mga09592_293783_c1_111_845 244
135 3300061719 Ga0466962_0058213 Ga0466962_0058213_336_1070 244
136 iso_pu_bacteria 2929199973 2929205460 244
137 3300002737 JGI25162J39368_1000010 JGI25162J39368_1000010208 245
138 3300002771 JGI25163J39215_1000002 JGI25163J39215_1000002124 245
139 3300002772 JGI25164J39214_1000003 JGI25164J39214_1000003157 245
140 3300003751 Ga0055538_1000009 Ga0055538_1000009208 245
141 3300003752 Ga0055539_1000013 Ga0055539_1000013208 245
142 3300003756 Ga0055533_1000017 Ga0055533_1000017208 245
143 3300003759 Ga0055525_1000019 Ga0055525_1000019208 245
144 3300003841 Ga0055541_1000010 Ga0055541_1000010208 245
145 3300005289 Ga0065704_10001592 Ga0065704_100015924 245
146 3300005330 Ga0070690_100109238 Ga0070690_1001092382 245
147 3300009036 Ga0105244_10007954 Ga0105244_100079544 245
148 3300009092 Ga0105250_10003801 Ga0105250_100038014 245
149 3300009177 Ga0105248_10149413 Ga0105248_101494133 245
150 3300013102 Ga0157371_10000092 Ga0157371_10000092124 245
151 3300013306 Ga0163162_10064373 Ga0163162_100643734 245
152 3300013307 Ga0157372_10039284 Ga0157372_100392844 245
153 3300013307 Ga0157372_10608934 Ga0157372_106089343 245
154 3300025207 Ga0209760_100008 Ga0209760_10000861 245
155 3300025224 Ga0209784_100012 Ga0209784_100012205 245
156 3300025225 Ga0209566_100010 Ga0209566_100010205 245
157 3300025226 Ga0209674_100023 Ga0209674_100023205 245
158 3300025230 Ga0209563_100027 Ga0209563_100027205 245
159 3300025231 Ga0207427_100017 Ga0207427_100017205 245
160 3300025233 Ga0209437_100029 Ga0209437_100029205 245
161 3300025253 Ga0209677_100014 Ga0209677_100014205 245
162 3300025711 Ga0207696_1001589 Ga0207696_10015898 245
163 3300025728 Ga0207655_1000698 Ga0207655_100069825 245
164 3300025916 Ga0207663_10030955 Ga0207663_100309553 245
165 3300025928 Ga0207700_10000722 Ga0207700_1000072213 245
166 3300041407 Ga0439447_004856 Ga0439447_004856_1438_2175 245
167 3300046471 Ga0495650_0000052 Ga0495650_0000052_206999_207736 245
168 3300046538 Ga0495609_0117374 Ga0495609_0117374_386_1123 245
169 3300046810 Ga0495660_0000006 Ga0495660_0000006_200567_201304 245
170 3300048907 Ga0496104_0001450 Ga0496104_0001450_17384_18121 245
171 3300048919 Ga0496116_0000020 Ga0496116_0000020_215120_215857 245
172 3300048920 Ga0496117_0044916 Ga0496117_0044916_1077_1814 245
173 3300048921 Ga0496118_0000048 Ga0496118_0000048_37708_38445 245
174 3300048921 Ga0496118_0085625 Ga0496118_0085625_74_811 245
175 3300048925 Ga0496122_0000010 Ga0496122_0000010_442043_442780 245
176 3300048926 Ga0496123_0000025 Ga0496123_0000025_97727_98464 245
177 3300048927 Ga0496124_0000042 Ga0496124_0000042_230485_231222 245
178 3300048928 Ga0496125_0000054 Ga0496125_0000054_270722_271459 245
179 3300048929 Ga0496126_0008377 Ga0496126_0008377_3978_4715 245
180 3300005347 Ga0070668_100588914 Ga0070668_1005889142 246
181 3300005439 Ga0070711_100616746 Ga0070711_1006167461 246
182 3300005457 Ga0070662_100098240 Ga0070662_1000982402 246
183 3300006028 Ga0070717_10022802 Ga0070717_100228022 246
184 3300006173 Ga0070716_100201460 Ga0070716_1002014602 246
185 3300006844 Ga0075428_100089720 Ga0075428_1000897202 246
186 3300006847 Ga0075431_100796205 Ga0075431_1007962052 246
187 3300009147 Ga0114129_10186999 Ga0114129_101869993 246
188 3300013306 Ga0163162_10143765 Ga0163162_101437653 246
189 3300025898 Ga0207692_10001201 Ga0207692_1000120112 246
190 3300025933 Ga0207706_10135214 Ga0207706_101352142 246
191 3300025961 Ga0207712_10378185 Ga0207712_103781852 246
192 3300025972 Ga0207668_10454480 Ga0207668_104544801 246
193 3300037853 Ga0436364_1464490 Ga0436364_1464490_414_1154 246
194 3300046794 Ga0495589_0003210 Ga0495589_0003210_5070_5921 246
195 3300049571 Ga0501034_0029620 Ga0501034_0029620_2530_3279 246
196 3300002773 JGI25152J39213_1003751 JGI25152J39213_10037514 247
197 3300003856 Ga0058692_1000038 Ga0058692_1000038107 247
198 3300003856 Ga0058692_1000152 Ga0058692_100015225 247
199 3300003856 Ga0058692_1000454 Ga0058692_10004542 247
200 3300005289 Ga0065704_10086508 Ga0065704_100865082 247
201 3300005471 Ga0070698_100793034 Ga0070698_1007930342 247
202 3300009036 Ga0105244_10000520 Ga0105244_100005205 247
203 3300009036 Ga0105244_10040035 Ga0105244_100400353 247
204 3300009036 Ga0105244_10057713 Ga0105244_100577132 247
205 3300009092 Ga0105250_10000020 Ga0105250_1000002097 247
206 3300013100 Ga0157373_10013192 Ga0157373_100131924 247
207 3300013102 Ga0157371_10001662 Ga0157371_100016623 247
208 3300013307 Ga0157372_10226805 Ga0157372_102268053 247
209 3300025728 Ga0207655_1019916 Ga0207655_10199162 247
210 3300027312 Ga0209371_1000005 Ga0209371_100000589 247
211 3300027312 Ga0209371_1000322 Ga0209371_100032212 247
212 3300027312 Ga0209371_1002884 Ga0209371_10028844 247
213 3300030500 Ga0268256_1001754 Ga0268256_10017544 247
214 3300041405 Ga0439438_000049 Ga0439438_000049_3646_4401 247
215 3300041405 Ga0439438_004374 Ga0439438_004374_2953_3705 247
216 3300041407 Ga0439447_000283 Ga0439447_000283_14860_15615 247
217 3300042006 Ga0439432_007289 Ga0439432_007289_985_1740 247
218 3300042006 Ga0439432_026715 Ga0439432_026715_252_1004 247
219 3300042010 Ga0439452_000520 Ga0439452_000520_19316_20071 247
220 3300046458 Ga0495591_000850 Ga0495591_000850_6537_7304 247
221 3300046471 Ga0495650_0000008 Ga0495650_0000008_352039_352806 247
222 3300046474 Ga0495605_0040675 Ga0495605_0040675_412_1179 247
223 3300046501 Ga0495607_0010426 Ga0495607_0010426_2063_2830 247
224 3300046507 Ga0495606_0000289 Ga0495606_0000289_63429_64196 247
225 3300046520 Ga0495637_0079969 Ga0495637_0079969_39_806 247
226 3300046522 Ga0495643_0029096 Ga0495643_0029096_267_1034 247
227 3300046524 Ga0495648_0076525 Ga0495648_0076525_839_1606 247
228 3300046530 Ga0495654_0000091 Ga0495654_0000091_35843_36610 247
229 3300046692 Ga0495671_0005950 Ga0495671_0005950_1433_2200 247
230 3300046694 Ga0495649_0007136 Ga0495649_0007136_3129_3896 247
231 3300046794 Ga0495589_0053082 Ga0495589_0053082_927_1694 247
232 3300046810 Ga0495660_0000247 Ga0495660_0000247_8874_9641 247
233 3300047320 Ga0495672_0000003 Ga0495672_0000003_388741_389508 247
234 3300047469 Ga0495673_0000011 Ga0495673_0000011_331114_331881 247
235 3300047470 Ga0495681_0003836 Ga0495681_0003836_1087_1854 247
236 3300048919 Ga0496116_0000106 Ga0496116_0000106_49860_50615 247
237 3300048919 Ga0496116_0002167 Ga0496116_0002167_16530_17282 247
238 3300048922 Ga0496119_0000031 Ga0496119_0000031_201693_202448 247
239 3300048922 Ga0496119_0000907 Ga0496119_0000907_21528_22283 247
240 3300048922 Ga0496119_0001383 Ga0496119_0001383_22282_23037 247
241 3300048922 Ga0496119_0002629 Ga0496119_0002629_5424_6179 247
242 3300048922 Ga0496119_0034768 Ga0496119_0034768_875_1627 247
243 3300048923 Ga0496120_0000051 Ga0496120_0000051_5449_6204 247
244 3300048923 Ga0496120_0000092 Ga0496120_0000092_142794_143549 247
245 3300048923 Ga0496120_0000123 Ga0496120_0000123_109932_110684 247
246 3300048923 Ga0496120_0000751 Ga0496120_0000751_36967_37722 247
247 3300048923 Ga0496120_0000990 Ga0496120_0000990_21514_22269 247
248 3300048925 Ga0496122_0011558 Ga0496122_0011558_7257_8012 247
249 3300048926 Ga0496123_0009292 Ga0496123_0009292_5220_5975 247
250 3300048927 Ga0496124_0000008 Ga0496124_0000008_59925_60680 247
251 3300048927 Ga0496124_0008835 Ga0496124_0008835_3859_4611 247
252 3300048929 Ga0496126_0017706 Ga0496126_0017706_1579_2334 247
253 3300049459 Ga0495678_000260 Ga0495678_000260_929_1696 247
254 3300053126 Ga0500621_000004 Ga0500621_000004_325197_325964 247
255 iso_pu_bacteria 2511231025 2511382711 247
256 iso_pu_bacteria 2585427591 2585827214 247
257 iso_pu_bacteria 2585427592 2585833269 247
258 iso_pu_bacteria 2602042066 2603698375 247
259 iso_pu_bacteria 2602042109 2603866898 247
260 iso_pu_bacteria 2772190666 2772438994 247
261 iso_pu_bacteria 2847085930 2847089193 247
262 iso_pu_bacteria 2869551831 2869554444 247
263 iso_pu_bacteria 2888366609 2888369038 247
264 iso_pu_bacteria 2888373701 2888378225 247
265 iso_pu_bacteria 2904504865 2904508212 247
266 iso_pu_bacteria 2908669403 2908671819 247
267 iso_pu_bacteria 2919150387 2919152811 247
268 iso_pu_bacteria 2927143783 2927146772 247
269 iso_pu_bacteria 2937967321 2937967610 247
270 iso_pu_bacteria 8004592986 8004597358 247
271 iso_pu_bacteria 8018221730 8018225540 247
272 3300014325 Ga0163163_10000375 Ga0163163_1000037520 249
273 2162886012 MBSR1b_contig_1115626 MBSR1b_0507.00000590 256
274 2162886012 MBSR1b_contig_7140121 MBSR1b_0976.00000010 256
275 3300048913 Ga0496110_0201327 Ga0496110_0201327_543_1313 256
276 3300048916 Ga0496113_0122165 Ga0496113_0122165_160_930 256

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

12

224

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vrd-assembly1.cif.gz_B crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9882 5 236
5vrd-assembly1.cif.gz_B crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9832 5 236
5vrd-assembly2.cif.gz_A crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9725 4 239
5vrd-assembly2.cif.gz_C-2 crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9683 8 232
5vrd-assembly2.cif.gz_A crystal structure for methylobacterium extorquens pqqcd (natural fusion) 0.9679 4 239
ID Description Score Start End Superfamily
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9145 10 224 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.9021 10 224 1.20.910.10
3hmlA00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8689 1 243 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8653 5 227 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8507 5 227 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A7X5N256-F1-model_v4 Pyrroloquinoline-quinone synthase PqqC (EC 1.3.3.11) 0.9966 96 241 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A371XEM5-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9965 4 243 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A6N6SYR1-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9952 5 241 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615
AF-A0A2V9TBV9-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein PqqC 0.9943 63 242 GO:0006790
GO:0016491
GO:0018189
GO:0072527
GO:1901615
AF-A0A7W7KB19-F1-model_v4 Pyrroloquinoline-quinone synthase (EC 1.3.3.11) (Coenzyme PQQ synthesis protein C) (Pyrroloquinoline quinone biosynthesis protein C) 0.9939 65 241 GO:0006790
GO:0018189
GO:0033732
GO:0072527
GO:1901615

Feature Viewer

pLDDT pTM Quality
91.65 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map