F380856

General Info

Members Datasets Scaffolds Average Seq Length
276 167 552 313

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10003650|JGI25405J52794_100036502
Length 355
Sequence MNKAKPRQSRAGVARIGDRGSSNXTNAGIAQRRKKENASTVRKLIMDKSDKIFVAGHEGMVGSALVRRLESGGFRNLLVRGKSKLDLRDKSAVDEFFAQEEPAVVILAAAKVGGIKANNDYPVEFLLENLQVQNNVIQTAYEKRVRKLLFLGSSCIYPKLAPQPIPETALLSGPLEPTNEAYAIAKIAGIKLCQAYAREYGANFISVMPTNXYGPNDNFDLETSHVLAALLRKAHDAKTRKDRKLIVWGSGKPRREFLHVDDLASACVLLLEKYDSPEIINIGCGEDISIQELAELICDVVGFDGELAWDITKPDGTPRKLLDVTKLKALGWKPSIQLREGISQTYAWFVANHDR

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
164 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
165 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
166 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
167 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 6.16
Rhizosphere 90.58
Stem 0
Stem Tuber 0
Unclassified 17.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10003650 3300003911 Bacteria 2711
2 SwRhRL3b_contig_955947 2162886006 Unclassified 2230
3 JGI24737J22298_10008935 3300001990 Bacteria 3344
4 JGI24035J26624_1002949 3300002126 Unclassified 1591
5 JGI24035J26624_1006106 3300002126 Bacteria 1159
6 JGI25406J46586_10000090 3300003203 Bacteria 41533
7 JGI25404J52841_10001415 3300003659 Bacteria 4212
8 JGI25405J52794_10000379 3300003911 Bacteria 6269
9 Ga0065704_10003712 3300005289 Bacteria 5961
10 Ga0065704_10143399 3300005289 Bacteria 1495
11 Ga0065712_10001096 3300005290 Bacteria 12954
12 Ga0065712_10007205 3300005290 Bacteria 2789
13 Ga0065712_10011221 3300005290 Bacteria 1872
14 Ga0065712_10080141 3300005290 Unclassified 3135
15 Ga0065712_10085551 3300005290 Bacteria 2690
16 Ga0065712_10108491 3300005290 Unclassified 1874
17 Ga0065715_10011641 3300005293 Unclassified 3476
18 Ga0065715_10089345 3300005293 Bacteria 11017
19 Ga0065715_10153171 3300005293 Bacteria 1705
20 Ga0065707_10002579 3300005295 Bacteria 5614
21 Ga0065707_10013839 3300005295 Bacteria 3364
22 Ga0070676_10001331 3300005328 Bacteria 12414
23 Ga0070676_10054181 3300005328 Bacteria 2364
24 Ga0070683_100095388 3300005329 Bacteria 2797
25 Ga0070690_100125640 3300005330 Unclassified 1726
26 Ga0068869_100067716 3300005334 Bacteria 2635
27 Ga0068869_100385092 3300005334 Unclassified 1150
28 Ga0070666_10031304 3300005335 Bacteria 3512
29 Ga0070666_10035399 3300005335 Unclassified 3311
30 Ga0070680_100428588 3300005336 Unclassified 1128
31 Ga0070682_100424312 3300005337 Unclassified 1012
32 Ga0068868_100389990 3300005338 Unclassified 1200
33 Ga0070660_100063472 3300005339 Bacteria 2872
34 Ga0070660_100274468 3300005339 Bacteria 1379
35 Ga0070689_100004352 3300005340 Bacteria 9555
36 Ga0070689_100007020 3300005340 Bacteria 7840
37 Ga0070689_100024335 3300005340 Bacteria 4542
38 Ga0070687_100000749 3300005343 Bacteria 10778
39 Ga0070661_100125192 3300005344 Bacteria 1927
40 Ga0070668_100015646 3300005347 Bacteria 5672
41 Ga0070668_100049371 3300005347 Bacteria 3238
42 Ga0070668_100109686 3300005347 Unclassified 2196
43 Ga0070668_100206131 3300005347 Bacteria 1616
44 Ga0070668_100402225 3300005347 Bacteria 1169
45 Ga0070669_100001053 3300005353 Bacteria 20176
46 Ga0070669_100398146 3300005353 Bacteria 1126
47 Ga0070675_100000362 3300005354 Bacteria 30738
48 Ga0070675_100001449 3300005354 Bacteria 17457
49 Ga0070671_100031232 3300005355 Bacteria 4399
50 Ga0070671_100071389 3300005355 Bacteria 2898
51 Ga0070673_100019538 3300005364 Bacteria 4865
52 Ga0070688_100018987 3300005365 Unclassified 3977
53 Ga0070688_100037151 3300005365 Bacteria 2967
54 Ga0070688_100086024 3300005365 Unclassified 2044
55 Ga0070688_100148508 3300005365 Bacteria 1600
56 Ga0070659_100001954 3300005366 Bacteria 14726
57 Ga0070659_100072800 3300005366 Bacteria 2735
58 Ga0070667_100003731 3300005367 Bacteria 12934
59 Ga0070667_100035093 3300005367 Bacteria 4201
60 Ga0070713_100171270 3300005436 Unclassified 1945
61 Ga0070701_10117618 3300005438 Bacteria 1493
62 Ga0070711_100038444 3300005439 Bacteria 3218
63 Ga0070711_100225298 3300005439 Bacteria 1459
64 Ga0070705_100018285 3300005440 Bacteria 3672
65 Ga0070700_100038048 3300005441 Bacteria 2930
66 Ga0070694_100046950 3300005444 Bacteria 2901
67 Ga0070694_100047930 3300005444 Bacteria 2873
68 Ga0070694_100240523 3300005444 Bacteria 1365
69 Ga0070708_100124791 3300005445 Bacteria 2378
70 Ga0070708_100158066 3300005445 Bacteria 2111
71 Ga0070678_100030617 3300005456 Bacteria 3702
72 Ga0070662_100000681 3300005457 Bacteria 20752
73 Ga0070662_100008182 3300005457 Bacteria 6812
74 Ga0070662_100020518 3300005457 Bacteria 4500
75 Ga0070662_100116454 3300005457 Unclassified 2043
76 Ga0070681_10046669 3300005458 Bacteria 4330
77 Ga0070706_100001357 3300005467 Bacteria 26038
78 Ga0070706_100079575 3300005467 Bacteria 3034
79 Ga0070707_100025360 3300005468 Bacteria 5623
80 Ga0070699_100457944 3300005518 Bacteria 1157
81 Ga0070679_100007552 3300005530 Bacteria 10169
82 Ga0070684_100001145 3300005535 Bacteria 19062
83 Ga0070684_100005125 3300005535 Bacteria 10015
84 Ga0070697_100048646 3300005536 Bacteria 3438
85 Ga0070697_100081017 3300005536 Unclassified 2675
86 Ga0070697_100138727 3300005536 Bacteria 2044
87 Ga0070697_100344046 3300005536 Bacteria 1287
88 Ga0070672_100034285 3300005543 Bacteria 3852
89 Ga0070665_100162675 3300005548 Bacteria 2234
90 Ga0070665_100167629 3300005548 Unclassified 2198
91 Ga0070665_100280094 3300005548 Unclassified 1669
92 Ga0070704_100000333 3300005549 Bacteria 21361
93 Ga0070664_100095555 3300005564 Bacteria 2577
94 Ga0068859_100013067 3300005617 Bacteria 8343
95 Ga0068861_100079385 3300005719 Bacteria 2565
96 Ga0068863_100048535 3300005841 Bacteria 4026
97 Ga0068858_100008919 3300005842 Bacteria 9613
98 Ga0068860_100101249 3300005843 Bacteria 2748
99 Ga0081455_10000171 3300005937 Bacteria 80763
100 Ga0081455_10014905 3300005937 Bacteria 7577
101 Ga0081455_10055834 3300005937 Unclassified 3356
102 Ga0081455_10058664 3300005937 Bacteria 3254
103 Ga0081455_10070730 3300005937 Bacteria 2896
104 Ga0081455_10086964 3300005937 Bacteria 2545
105 Ga0081540_1000225 3300005983 Bacteria 59402
106 Ga0081540_1003692 3300005983 Bacteria 12002
107 Ga0081540_1016660 3300005983 Bacteria 4586
108 Ga0081539_10001036 3300005985 Bacteria 51273
109 Ga0081539_10057433 3300005985 Bacteria 2153
110 Ga0070717_10005147 3300006028 Bacteria 9534
111 Ga0070717_10259644 3300006028 Bacteria 1537
112 Ga0070715_10034426 3300006163 Bacteria 2076
113 Ga0070712_100144089 3300006175 Bacteria 1821
114 Ga0075433_10202615 3300006852 Bacteria 1764
115 Ga0068865_100151233 3300006881 Bacteria 1761
116 Ga0097620_100013066 3300006931 Bacteria 8343
117 Ga0105240_10049536 3300009093 Bacteria 5301
118 Ga0105245_10015213 3300009098 Bacteria 6704
119 Ga0105245_10335281 3300009098 Bacteria 1494
120 Ga0105247_10024637 3300009101 Bacteria 3627
121 Ga0114129_10002187 3300009147 Bacteria 26922
122 Ga0105242_10153274 3300009176 Bacteria 2011
123 Ga0105248_10205345 3300009177 Bacteria 2220
124 Ga0105249_10006502 3300009553 Bacteria 10166
125 Ga0105239_10004991 3300010375 Bacteria 15667
126 Ga0105239_10405702 3300010375 Bacteria 1543
127 Ga0105239_10593891 3300010375 Bacteria 1263
128 Ga0105239_10752660 3300010375 Bacteria 1115
129 Ga0105246_10237960 3300011119 Unclassified 1438
130 Ga0157369_10104083 3300013105 Unclassified 3023
131 Ga0157374_10042393 3300013296 Bacteria 4198
132 Ga0157374_10166722 3300013296 Bacteria 2147
133 Ga0157374_10208180 3300013296 Bacteria 1917
134 Ga0157374_10233956 3300013296 Unclassified 1805
135 Ga0157374_10552667 3300013296 Bacteria 1159
136 Ga0157378_10013338 3300013297 Bacteria 7183
137 Ga0157378_10130312 3300013297 Bacteria 2327
138 Ga0157378_10260029 3300013297 Unclassified 1665
139 Ga0163162_10001659 3300013306 Bacteria 20860
140 Ga0163162_10176906 3300013306 Unclassified 2259
141 Ga0163162_10424133 3300013306 Unclassified 1462
142 Ga0157375_10016426 3300013308 Bacteria 6651
143 Ga0157375_10109721 3300013308 Bacteria 2855
144 Ga0163163_10129966 3300014325 Bacteria 2558
145 Ga0157377_10006172 3300014745 Bacteria 5695
146 Ga0157376_10011314 3300014969 Bacteria 6572
147 Ga0213872_10074076 3300021361 Unclassified 1533
148 Ga0213872_10108171 3300021361 Unclassified 1236
149 Ga0213875_10030335 3300021388 Bacteria 2560
150 Ga0213871_10004774 3300021441 Bacteria 2742
151 Ga0213871_10011986 3300021441 Unclassified 2001
152 Ga0207666_1012786 3300025271 Bacteria 1173
153 Ga0207673_1003318 3300025290 Bacteria 1877
154 Ga0207697_10000084 3300025315 Bacteria 41551
155 Ga0207697_10000178 3300025315 Bacteria 32657
156 Ga0207697_10004047 3300025315 Bacteria 7094
157 Ga0207697_10004199 3300025315 Bacteria 6929
158 Ga0207697_10016355 3300025315 Bacteria 3055
159 Ga0207697_10028417 3300025315 Bacteria 2287
160 Ga0207680_10240054 3300025903 Bacteria 1248
161 Ga0207647_10008354 3300025904 Bacteria 7426
162 Ga0207647_10148083 3300025904 Bacteria 1373
163 Ga0207699_10175927 3300025906 Bacteria 1435
164 Ga0207699_10258028 3300025906 Bacteria 1204
165 Ga0207645_10000107 3300025907 Bacteria 61800
166 Ga0207645_10119259 3300025907 Bacteria 1712
167 Ga0207684_10002013 3300025910 Bacteria 20941
168 Ga0207684_10050294 3300025910 Bacteria 3535
169 Ga0207695_10233029 3300025913 Bacteria 1745
170 Ga0207693_10073077 3300025915 Bacteria 2685
171 Ga0207693_10158161 3300025915 Bacteria 1783
172 Ga0207662_10000513 3300025918 Bacteria 17267
173 Ga0207662_10171218 3300025918 Unclassified 1392
174 Ga0207657_10059147 3300025919 Bacteria 3295
175 Ga0207649_10165164 3300025920 Bacteria 1537
176 Ga0207681_10013553 3300025923 Bacteria 5049
177 Ga0207659_10006057 3300025926 Bacteria 7383
178 Ga0207659_10055571 3300025926 Bacteria 2832
179 Ga0207659_10064704 3300025926 Bacteria 2647
180 Ga0207659_10219999 3300025926 Bacteria 1526
181 Ga0207659_10308837 3300025926 Bacteria 1301
182 Ga0207687_10107935 3300025927 Bacteria 2060
183 Ga0207687_10112435 3300025927 Bacteria 2024
184 Ga0207700_10063699 3300025928 Bacteria 2805
185 Ga0207700_10311002 3300025928 Unclassified 1363
186 Ga0207644_10085723 3300025931 Unclassified 2337
187 Ga0207690_10013793 3300025932 Bacteria 4867
188 Ga0207690_10115132 3300025932 Bacteria 1943
189 Ga0207690_10311653 3300025932 Bacteria 1234
190 Ga0207706_10000823 3300025933 Bacteria 32168
191 Ga0207706_10033804 3300025933 Bacteria 4551
192 Ga0207706_10071653 3300025933 Bacteria 3048
193 Ga0207706_10075778 3300025933 Bacteria 2959
194 Ga0207670_10008593 3300025936 Bacteria 5773
195 Ga0207670_10107342 3300025936 Bacteria 2004
196 Ga0207669_10261779 3300025937 Bacteria 1294
197 Ga0207704_10121289 3300025938 Bacteria 1790
198 Ga0207665_10023053 3300025939 Unclassified 4100
199 Ga0207665_10074187 3300025939 Bacteria 2328
200 Ga0207691_10032050 3300025940 Bacteria 4903
201 Ga0207691_10065316 3300025940 Bacteria 3294
202 Ga0207711_10080058 3300025941 Bacteria 2853
203 Ga0207689_10033513 3300025942 Bacteria 4268
204 Ga0207689_10348136 3300025942 Unclassified 1231
205 Ga0207661_10052998 3300025944 Bacteria 3244
206 Ga0207679_10172309 3300025945 Bacteria 1783
207 Ga0207679_10344965 3300025945 Unclassified 1296
208 Ga0207651_10119668 3300025960 Unclassified 1994
209 Ga0207712_10011631 3300025961 Bacteria 5609
210 Ga0207668_10004341 3300025972 Bacteria 8324
211 Ga0207668_10011938 3300025972 Bacteria 5301
212 Ga0207668_10170075 3300025972 Bacteria 1708
213 Ga0207640_10223333 3300025981 Unclassified 1444
214 Ga0207658_10158980 3300025986 Bacteria 1850
215 Ga0207703_10019855 3300026035 Bacteria 5253
216 Ga0207678_10067423 3300026067 Unclassified 3072
217 Ga0207641_10248146 3300026088 Bacteria 1661
218 Ga0207675_100112096 3300026118 Bacteria 2574
219 Ga0207683_10025088 3300026121 Bacteria 5141
220 Ga0268266_10088598 3300028379 Unclassified 2708
221 Ga0268266_10121724 3300028379 Unclassified 2322
222 Ga0268266_10144289 3300028379 Unclassified 2139
223 Ga0268265_10051451 3300028380 Bacteria 3109
224 Ga0268264_10063892 3300028381 Bacteria 3097
225 Ga0307517_10034764 3300028786 Bacteria 5727
226 Ga0307515_10129025 3300028794 Bacteria 2799
227 Ga0265327_10059396 3300031251 Bacteria 1959
228 Ga0265314_10044096 3300031711 Bacteria 3164
229 Ga0373935_0092686 3300035692 Bacteria 1980
230 Ga0373925_0076588 3300037068 Bacteria 2537
231 Ga0373925_0354797 3300037068 Bacteria 1191
232 Ga0436364_0559955 3300037853 Bacteria 2798
233 Ga0400483_028180 3300039062 Bacteria 30548
234 Ga0400483_164582 3300039062 Bacteria 4843
235 Ga0436360_0312439 3300039438 Unclassified 2048
236 Ga0436360_0523368 3300039438 Bacteria 3580
237 Ga0436360_0674537 3300039438 Bacteria 2628
238 Ga0436361_0116584 3300039447 Unclassified 1364
239 Ga0436361_0339088 3300039447 Bacteria 3038
240 Ga0436363_0766831 3300039450 Bacteria 10974
241 Ga0439441_024901 3300042001 Bacteria 1127
242 Ga0466966_0104845 3300044684 Bacteria 1746
243 Ga0451576_0098220 3300045051 Bacteria 3045
244 Ga0495653_0095072 3300046463 Bacteria 2170
245 Ga0495653_0177457 3300046463 Bacteria 1465
246 Ga0495628_0076480 3300046516 Unclassified 2605
247 Ga0495630_0132178 3300046517 Unclassified 1896
248 Ga0495630_0157088 3300046517 Bacteria 1731
249 Ga0495669_0077647 3300046684 Bacteria 1521
250 Ga0495624_0249698 3300046690 Bacteria 1073
251 Ga0495675_0197344 3300047444 Bacteria 1226
252 Ga0495684_0002940 3300047471 Bacteria 13419
253 Ga0496100_0235181 3300048903 Unclassified 1350
254 Ga0496101_0476142 3300048904 Bacteria 986
255 Ga0496102_0036755 3300048905 Bacteria 4414
256 Ga0496103_0087807 3300048906 Bacteria 1961
257 Ga0496104_0076323 3300048907 Bacteria 3192
258 Ga0496104_0140212 3300048907 Bacteria 2323
259 Ga0496104_0435351 3300048907 Bacteria 1223
260 Ga0496105_0343057 3300048908 Bacteria 1194
261 Ga0496106_0060045 3300048909 Bacteria 2882
262 Ga0496107_0110526 3300048910 Bacteria 2020
263 Ga0496108_0047765 3300048911 Bacteria 3578
264 Ga0496109_0017267 3300048912 Bacteria 6322
265 Ga0496109_0538451 3300048912 Bacteria 1102
266 Ga0496111_0162324 3300048914 Bacteria 1659
267 Ga0496112_0079704 3300048915 Bacteria 3239
268 Ga0496112_0189607 3300048915 Bacteria 2018
269 Ga0496115_0034786 3300048918 Unclassified 3982
270 nmdc:mga05p37_11029_c1 3300050507 Bacteria 10736
271 Ga0495612_0046194 3300053078 Unclassified 1783
272 Ga0495619_0270010 3300053085 Bacteria 1179
273 Ga0500642_0004824 3300053130 Bacteria 4270
274 Ga0500616_0002888 3300053153 Bacteria 13777
275 Ga0590071_005272 3300059421 Bacteria 3116
276 2917558677 2917554339 Bacteria 4987857
277 JGI25405J52794_10003650
278 SwRhRL3b_contig_955947
279 JGI24737J22298_10008935
280 JGI24035J26624_1002949
281 JGI24035J26624_1006106
282 JGI25406J46586_10000090
283 JGI25404J52841_10001415
284 JGI25405J52794_10000379
285 Ga0065704_10003712
286 Ga0065704_10143399
287 Ga0065712_10001096
288 Ga0065712_10007205
289 Ga0065712_10011221
290 Ga0065712_10080141
291 Ga0065712_10085551
292 Ga0065712_10108491
293 Ga0065715_10011641
294 Ga0065715_10089345
295 Ga0065715_10153171
296 Ga0065707_10002579
297 Ga0065707_10013839
298 Ga0070676_10001331
299 Ga0070676_10054181
300 Ga0070683_100095388
301 Ga0070690_100125640
302 Ga0068869_100067716
303 Ga0068869_100385092
304 Ga0070666_10031304
305 Ga0070666_10035399
306 Ga0070680_100428588
307 Ga0070682_100424312
308 Ga0068868_100389990
309 Ga0070660_100063472
310 Ga0070660_100274468
311 Ga0070689_100004352
312 Ga0070689_100007020
313 Ga0070689_100024335
314 Ga0070687_100000749
315 Ga0070661_100125192
316 Ga0070668_100015646
317 Ga0070668_100049371
318 Ga0070668_100109686
319 Ga0070668_100206131
320 Ga0070668_100402225
321 Ga0070669_100001053
322 Ga0070669_100398146
323 Ga0070675_100000362
324 Ga0070675_100001449
325 Ga0070671_100031232
326 Ga0070671_100071389
327 Ga0070673_100019538
328 Ga0070688_100018987
329 Ga0070688_100037151
330 Ga0070688_100086024
331 Ga0070688_100148508
332 Ga0070659_100001954
333 Ga0070659_100072800
334 Ga0070667_100003731
335 Ga0070667_100035093
336 Ga0070713_100171270
337 Ga0070701_10117618
338 Ga0070711_100038444
339 Ga0070711_100225298
340 Ga0070705_100018285
341 Ga0070700_100038048
342 Ga0070694_100046950
343 Ga0070694_100047930
344 Ga0070694_100240523
345 Ga0070708_100124791
346 Ga0070708_100158066
347 Ga0070678_100030617
348 Ga0070662_100000681
349 Ga0070662_100008182
350 Ga0070662_100020518
351 Ga0070662_100116454
352 Ga0070681_10046669
353 Ga0070706_100001357
354 Ga0070706_100079575
355 Ga0070707_100025360
356 Ga0070699_100457944
357 Ga0070679_100007552
358 Ga0070684_100001145
359 Ga0070684_100005125
360 Ga0070697_100048646
361 Ga0070697_100081017
362 Ga0070697_100138727
363 Ga0070697_100344046
364 Ga0070672_100034285
365 Ga0070665_100162675
366 Ga0070665_100167629
367 Ga0070665_100280094
368 Ga0070704_100000333
369 Ga0070664_100095555
370 Ga0068859_100013067
371 Ga0068861_100079385
372 Ga0068863_100048535
373 Ga0068858_100008919
374 Ga0068860_100101249
375 Ga0081455_10000171
376 Ga0081455_10014905
377 Ga0081455_10055834
378 Ga0081455_10058664
379 Ga0081455_10070730
380 Ga0081455_10086964
381 Ga0081540_1000225
382 Ga0081540_1003692
383 Ga0081540_1016660
384 Ga0081539_10001036
385 Ga0081539_10057433
386 Ga0070717_10005147
387 Ga0070717_10259644
388 Ga0070715_10034426
389 Ga0070712_100144089
390 Ga0075433_10202615
391 Ga0068865_100151233
392 Ga0097620_100013066
393 Ga0105240_10049536
394 Ga0105245_10015213
395 Ga0105245_10335281
396 Ga0105247_10024637
397 Ga0114129_10002187
398 Ga0105242_10153274
399 Ga0105248_10205345
400 Ga0105249_10006502
401 Ga0105239_10004991
402 Ga0105239_10405702
403 Ga0105239_10593891
404 Ga0105239_10752660
405 Ga0105246_10237960
406 Ga0157369_10104083
407 Ga0157374_10042393
408 Ga0157374_10166722
409 Ga0157374_10208180
410 Ga0157374_10233956
411 Ga0157374_10552667
412 Ga0157378_10013338
413 Ga0157378_10130312
414 Ga0157378_10260029
415 Ga0163162_10001659
416 Ga0163162_10176906
417 Ga0163162_10424133
418 Ga0157375_10016426
419 Ga0157375_10109721
420 Ga0163163_10129966
421 Ga0157377_10006172
422 Ga0157376_10011314
423 Ga0213872_10074076
424 Ga0213872_10108171
425 Ga0213875_10030335
426 Ga0213871_10004774
427 Ga0213871_10011986
428 Ga0207666_1012786
429 Ga0207673_1003318
430 Ga0207697_10000084
431 Ga0207697_10000178
432 Ga0207697_10004047
433 Ga0207697_10004199
434 Ga0207697_10016355
435 Ga0207697_10028417
436 Ga0207680_10240054
437 Ga0207647_10008354
438 Ga0207647_10148083
439 Ga0207699_10175927
440 Ga0207699_10258028
441 Ga0207645_10000107
442 Ga0207645_10119259
443 Ga0207684_10002013
444 Ga0207684_10050294
445 Ga0207695_10233029
446 Ga0207693_10073077
447 Ga0207693_10158161
448 Ga0207662_10000513
449 Ga0207662_10171218
450 Ga0207657_10059147
451 Ga0207649_10165164
452 Ga0207681_10013553
453 Ga0207659_10006057
454 Ga0207659_10055571
455 Ga0207659_10064704
456 Ga0207659_10219999
457 Ga0207659_10308837
458 Ga0207687_10107935
459 Ga0207687_10112435
460 Ga0207700_10063699
461 Ga0207700_10311002
462 Ga0207644_10085723
463 Ga0207690_10013793
464 Ga0207690_10115132
465 Ga0207690_10311653
466 Ga0207706_10000823
467 Ga0207706_10033804
468 Ga0207706_10071653
469 Ga0207706_10075778
470 Ga0207670_10008593
471 Ga0207670_10107342
472 Ga0207669_10261779
473 Ga0207704_10121289
474 Ga0207665_10023053
475 Ga0207665_10074187
476 Ga0207691_10032050
477 Ga0207691_10065316
478 Ga0207711_10080058
479 Ga0207689_10033513
480 Ga0207689_10348136
481 Ga0207661_10052998
482 Ga0207679_10172309
483 Ga0207679_10344965
484 Ga0207651_10119668
485 Ga0207712_10011631
486 Ga0207668_10004341
487 Ga0207668_10011938
488 Ga0207668_10170075
489 Ga0207640_10223333
490 Ga0207658_10158980
491 Ga0207703_10019855
492 Ga0207678_10067423
493 Ga0207641_10248146
494 Ga0207675_100112096
495 Ga0207683_10025088
496 Ga0268266_10088598
497 Ga0268266_10121724
498 Ga0268266_10144289
499 Ga0268265_10051451
500 Ga0268264_10063892
501 Ga0307517_10034764
502 Ga0307515_10129025
503 Ga0265327_10059396
504 Ga0265314_10044096
505 Ga0373935_0092686
506 Ga0373925_0076588
507 Ga0373925_0354797
508 Ga0436364_0559955
509 Ga0400483_028180
510 Ga0400483_164582
511 Ga0436360_0312439
512 Ga0436360_0523368
513 Ga0436360_0674537
514 Ga0436361_0116584
515 Ga0436361_0339088
516 Ga0436363_0766831
517 Ga0439441_024901
518 Ga0466966_0104845
519 Ga0451576_0098220
520 Ga0495653_0095072
521 Ga0495653_0177457
522 Ga0495628_0076480
523 Ga0495630_0132178
524 Ga0495630_0157088
525 Ga0495669_0077647
526 Ga0495624_0249698
527 Ga0495675_0197344
528 Ga0495684_0002940
529 Ga0496100_0235181
530 Ga0496101_0476142
531 Ga0496102_0036755
532 Ga0496103_0087807
533 Ga0496104_0076323
534 Ga0496104_0140212
535 Ga0496104_0435351
536 Ga0496105_0343057
537 Ga0496106_0060045
538 Ga0496107_0110526
539 Ga0496108_0047765
540 Ga0496109_0017267
541 Ga0496109_0538451
542 Ga0496111_0162324
543 Ga0496112_0079704
544 Ga0496112_0189607
545 Ga0496115_0034786
546 nmdc:mga05p37_11029_c1
547 Ga0495612_0046194
548 Ga0495619_0270010
549 Ga0500642_0004824
550 Ga0500616_0002888
551 Ga0590071_005272
552 2917558677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

52

283

0.96

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

82

345

0.84

PF04321

RmlD_sub_bind

RmlD substrate binding domain

50

347

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
1e7q-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a 0.9725 4 307
1e7r-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase y136e 0.9711 4 307
1e7s-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r 0.9647 4 307
8ewu-assembly1.cif.gz_A x-ray structure of the gdp-6-deoxy-4-keto-d-lyxo-heptose-4-reductase from campylobacter jejuni hs:15 0.9539 1 307
1e6u-assembly1.cif.gz_A-2 gdp 4-keto-6-deoxy-d-mannose epimerase reductase 0.9501 4 307
ID Description Score Start End Superfamily
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9329 169 307 3.90.25.10
1e6uA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9138 169 307 3.90.25.10
4bkpC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9135 4 240 3.40.50.720
1vl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9108 6 239 3.40.50.720
6aqyC02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.907 169 308 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A644ZS02-F1-model_v4 GDP-L-fucose synthase (EC 1.1.1.271) 0.9918 163 307 GO:0050577
AF-A0A2V5QUW2-F1-model_v4 GDP-L-fucose synthase (EC 1.1.1.271) (GDP-4-keto-6-deoxy-D-mannose-3,5-epimerase-4-reductase) 0.9915 1 309 GO:0016853
GO:0042351
GO:0050577
GO:0070401
AF-R6WGU0-F1-model_v4 NAD dependent epimerase/dehydratase family protein 0.9913 199 307 GO:0050577
AF-A0A2V6HJ05-F1-model_v4 GDP-fucose synthetase 0.9884 93 307 GO:0016853
GO:0050577
AF-A0A7J9JMZ7-F1-model_v4 GDP-L-fucose synthase (EC 1.1.1.271) 0.9883 3 307 GO:0016853
GO:0042351
GO:0050577

Map