F380782

General Info

Members Datasets Scaffolds Average Seq Length
275 176 257 225

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221593|2643973566
Length 249
Sequence EASAIGQAQTRCASMSRVELAKWSGALSFSDPQVVARYAQGPVRQVPGFHALQRMTALLLAEAVPGDGEVLVLGAGGGLELKVFAEAQPEWRFVGVDPSAEMLKLASETLGPLASRVDLCEGYIDTASVGPFDGATCLLTLHFLPAEERLRTLVELRRRLKPGAPLIVAHHSVPGDRKLQWLHRYAAFAVASGGIPAQDADKSVAALGSRLPMLSPEQDEALLREAGFETVELFFAAFTFKGWVAYNPS

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
3 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
4 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
5 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
6 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
7 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
8 2643221580 Devosia sp. Root635 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
12 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
13 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
14 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
15 2941471342 Luteibacter sp. 621 Isolate Unclassified
16 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
17 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
29 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
94 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
108 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
109 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
165 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
171 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
174 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
176 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.45
Metatranscriptomes 0
Isolates 6.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.82
Nodule 0.36
Rhizoplane 0.73
Rhizosphere 65.09
Stem 0
Stem Tuber 0
Unclassified 16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001627 3300001904 Bacteria 4080
2 JGI25158J39367_1000263 3300002739 Bacteria 11913
3 JGI25152J39213_1004694 3300002773 Plasmid 4227
4 JGI25159J45721_1000264 3300002987 Bacteria 24458
5 JGI25153J46596_10011771 3300003215 Plasmid 3840
6 rootL2_10066716 3300003322 Bacteria 4821
7 rootL2_10082513 3300003322 Bacteria 1702
8 JGI25160J50197_1010571 3300003354 Unclassified 3325
9 JGI25161J50226_1000338 3300003374 Bacteria 25195
10 JGI25404J52841_10021649 3300003659 Unclassified 1391
11 Ga0055526_1001333 3300003771 Bacteria 17671
12 Ga0055524_1015877 3300003775 Unclassified 2727
13 Ga0055524_1016719 3300003775 Plasmid 2617
14 Ga0055528_1018527 3300003790 Unclassified 2355
15 Ga0055540_1008594 3300003792 Unclassified 3661
16 Ga0055543_1000115 3300004625 Bacteria 68252
17 Ga0065165_1013361 3300005262 Bacteria 3270
18 Ga0070658_10005883 3300005327 Bacteria 9948
19 Ga0070658_10262039 3300005327 Bacteria 1468
20 Ga0070658_10313615 3300005327 Unclassified 1338
21 Ga0070682_100267023 3300005337 Bacteria 1241
22 Ga0070660_100003872 3300005339 Bacteria 10335
23 Ga0070660_100064302 3300005339 Bacteria 2854
24 Ga0070691_10010345 3300005341 Bacteria 4256
25 Ga0070661_100190315 3300005344 Bacteria 1565
26 Ga0070669_100004735 3300005353 Bacteria 9811
27 Ga0070659_100448297 3300005366 Bacteria 1094
28 Ga0070714_100026082 3300005435 Bacteria 4828
29 Ga0070714_100057861 3300005435 Bacteria 3319
30 Ga0070663_100014104 3300005455 Bacteria 5122
31 Ga0070663_100023688 3300005455 Bacteria 4119
32 Ga0070679_100049002 3300005530 Bacteria 4208
33 Ga0068853_100089371 3300005539 Bacteria 2705
34 Ga0070665_100084298 3300005548 Bacteria 3183
35 Ga0070665_100835188 3300005548 Bacteria 934
36 Ga0068855_100089698 3300005563 Bacteria 3549
37 Ga0068855_100783496 3300005563 Bacteria 1014
38 Ga0068852_100002597 3300005616 Bacteria 12479
39 Ga0068852_100003625 3300005616 Bacteria 10808
40 Ga0068858_100064771 3300005842 Bacteria 3383
41 Ga0068862_100155184 3300005844 Bacteria 2040
42 Ga0081540_1001232 3300005983 Bacteria 22326
43 Ga0081540_1005155 3300005983 Bacteria 9781
44 Ga0075365_10037735 3300006038 Bacteria 3138
45 Ga0075364_10004476 3300006051 Bacteria 8047
46 Ga0075364_10021617 3300006051 Bacteria 4055
47 Ga0075434_100456881 3300006871 Bacteria 1298
48 Ga0105240_10137870 3300009093 Bacteria 2920
49 Ga0111539_10014079 3300009094 Bacteria 9998
50 Ga0105238_10030168 3300009551 Bacteria 5518
51 Ga0105238_10185378 3300009551 Bacteria 2057
52 Ga0105249_10050827 3300009553 Bacteria 3779
53 Ga0157373_10028108 3300013100 Bacteria 4058
54 Ga0157371_10016479 3300013102 Bacteria 5513
55 Ga0157371_10212756 3300013102 Bacteria 1387
56 Ga0157370_10071391 3300013104 Bacteria 3276
57 Ga0157370_10080046 3300013104 Bacteria 3076
58 Ga0157370_10090085 3300013104 Bacteria 2880
59 Ga0157370_10363458 3300013104 Bacteria 1334
60 Ga0157370_10701004 3300013104 Bacteria 924
61 Ga0157369_10000333 3300013105 Bacteria 63083
62 Ga0157369_10004287 3300013105 Bacteria 16862
63 Ga0157372_10130155 3300013307 Bacteria 2895
64 Ga0157372_10467935 3300013307 Bacteria 1469
65 Ga0182008_10051722 3300014497 Bacteria 2037
66 Ga0182007_10005327 3300015262 Bacteria 5666
67 Ga0163161_10325148 3300017792 Bacteria 1217
68 Ga0209436_100936 3300025208 Bacteria 11542
69 Ga0209129_1001213 3300025258 Bacteria 14838
70 Ga0209673_1005710 3300025273 Bacteria 6203
71 Ga0209130_1000015 3300025284 Bacteria 409631
72 Ga0209564_1000195 3300025295 Bacteria 141460
73 Ga0209564_1001682 3300025295 Bacteria 21003
74 Ga0209564_1009425 3300025295 Bacteria 4648
75 Ga0209758_1005036 3300025297 Bacteria 10508
76 Ga0209256_1007537 3300025299 Bacteria 5327
77 Ga0209256_1026250 3300025299 Bacteria 1681
78 Ga0207426_1000122 3300025302 Bacteria 218307
79 Ga0209051_1019820 3300025303 Bacteria 2921
80 Ga0207647_10000010 3300025904 Bacteria 174219
81 Ga0207705_10088275 3300025909 Bacteria 2268
82 Ga0207705_10300480 3300025909 Unclassified 1231
83 Ga0207654_10418322 3300025911 Bacteria 935
84 Ga0207707_10237745 3300025912 Bacteria 1584
85 Ga0207695_10527104 3300025913 Bacteria 1063
86 Ga0207660_10213680 3300025917 Bacteria 1511
87 Ga0207657_10003379 3300025919 Bacteria 17066
88 Ga0207657_10125068 3300025919 Bacteria 2112
89 Ga0207657_10228408 3300025919 Bacteria 1489
90 Ga0207652_10068917 3300025921 Bacteria 3070
91 Ga0207694_10048057 3300025924 Bacteria 3301
92 Ga0207694_10099230 3300025924 Bacteria 2306
93 Ga0207694_10129036 3300025924 Bacteria 2025
94 Ga0207694_10286844 3300025924 Bacteria 1353
95 Ga0207664_10015511 3300025929 Bacteria 5533
96 Ga0207690_10364949 3300025932 Bacteria 1144
97 Ga0207667_10002226 3300025949 Bacteria 24349
98 Ga0207667_10098033 3300025949 Bacteria 3025
99 Ga0207639_10005707 3300026041 Bacteria 8426
100 Ga0207678_10020151 3300026067 Bacteria 5856
101 Ga0207678_10041261 3300026067 Bacteria 4001
102 Ga0207702_10695012 3300026078 Bacteria 1002
103 Ga0207674_10051397 3300026116 Bacteria 4206
104 Ga0207698_10009979 3300026142 Bacteria 6078
105 Ga0207428_10033336 3300027907 Unclassified 4231
106 Ga0268266_10113556 3300028379 Bacteria 2402
107 Ga0316183_1024862 3300030742 Bacteria 6181
108 Ga0316182_1385683 3300030745 Bacteria 2372
109 Ga0307513_10453152 3300031456 Bacteria 1007
110 Ga0307405_10048656 3300031731 Bacteria 2616
111 Ga0307413_10065729 3300031824 Bacteria 2259
112 Ga0307413_10259128 3300031824 Bacteria 1295
113 Ga0307410_10379168 3300031852 Unclassified 1137
114 Ga0307410_10479321 3300031852 Bacteria 1020
115 Ga0307409_100035746 3300031995 Bacteria 3644
116 Ga0307416_100803878 3300032002 Unclassified 1036
117 Ga0307414_10006035 3300032004 Bacteria 6717
118 Ga0307414_10026255 3300032004 Bacteria 3746
119 Ga0307414_10062927 3300032004 Bacteria 2635
120 Ga0307414_10082010 3300032004 Bacteria 2363
121 Ga0307414_10121266 3300032004 Bacteria 2010
122 Ga0307414_10131208 3300032004 Bacteria 1945
123 Ga0307414_10228323 3300032004 Bacteria 1533
124 Ga0307414_10579214 3300032004 Bacteria 1004
125 Ga0307414_10629254 3300032004 Bacteria 965
126 Ga0307411_10151266 3300032005 Bacteria 1725
127 Ga0307411_10461009 3300032005 Unclassified 1065
128 Ga0395899_0168660 3300037312 Bacteria 1542
129 Ga0395900_0001278 3300037418 Bacteria 30720
130 Ga0395898_0007601 3300037466 Bacteria 11507
131 Ga0395901_0000327 3300038443 Bacteria 58568
132 Ga0439461_0040233 3300041410 Bacteria 1008
133 Ga0450905_007198 3300042142 Bacteria 1513
134 Ga0466982_0000016 3300044672 Bacteria 120821
135 Ga0466957_0276486 3300044842 Unclassified 1123
136 Ga0495617_000697 3300046452 Bacteria 16773
137 Ga0495638_0000178 3300046460 Bacteria 98340
138 Ga0495638_0004100 3300046460 Bacteria 11146
139 Ga0495638_0127748 3300046460 Bacteria 1496
140 Ga0495638_0263334 3300046460 Bacteria 944
141 Ga0495584_0243567 3300046491 Bacteria 914
142 Ga0495607_0000370 3300046501 Bacteria 46319
143 Ga0495583_0006817 3300046506 Bacteria 7372
144 Ga0495610_0000097 3300046512 Bacteria 101920
145 Ga0495610_0108843 3300046512 Bacteria 1230
146 Ga0495610_0126485 3300046512 Bacteria 1114
147 Ga0495616_0178555 3300046513 Bacteria 945
148 Ga0495637_0008373 3300046520 Bacteria 5083
149 Ga0495643_0000113 3300046522 Bacteria 133604
150 Ga0495663_0004062 3300046525 Bacteria 4145
151 Ga0495654_0190500 3300046530 Bacteria 883
152 Ga0495633_0000426 3300046558 Bacteria 43843
153 Ga0495611_0000002 3300046648 Bacteria 705677
154 Ga0495625_0000002 3300046660 Bacteria 813323
155 Ga0495625_0014786 3300046660 Bacteria 6211
156 Ga0495625_0093818 3300046660 Bacteria 2071
157 Ga0495670_0029402 3300046691 Bacteria 2727
158 Ga0495649_0138322 3300046694 Bacteria 1283
159 Ga0495589_0000014 3300046794 Bacteria 246197
160 Ga0495660_0000105 3300046810 Bacteria 90404
161 Ga0495672_0000006 3300047320 Bacteria 589807
162 Ga0495672_0000700 3300047320 Bacteria 36903
163 Ga0495679_000003 3300047446 Bacteria 787868
164 Ga0495673_0000474 3300047469 Bacteria 43418
165 Ga0495686_0001843 3300047472 Bacteria 21277
166 Ga0496106_0580505 3300048909 Bacteria 898
167 Ga0496116_0003213 3300048919 Bacteria 16315
168 Ga0496116_0056064 3300048919 Bacteria 2585
169 Ga0496117_0033849 3300048920 Bacteria 3859
170 Ga0496117_0048789 3300048920 Bacteria 3019
171 Ga0496118_0001194 3300048921 Bacteria 40021
172 Ga0496118_0063653 3300048921 Bacteria 2712
173 Ga0496118_0194621 3300048921 Bacteria 1208
174 Ga0496121_0000071 3300048924 Bacteria 247039
175 Ga0496121_0005011 3300048924 Bacteria 17327
176 Ga0496121_0068058 3300048924 Bacteria 2883
177 Ga0496121_0129521 3300048924 Bacteria 1891
178 Ga0496122_0009232 3300048925 Bacteria 10435
179 Ga0496122_0035726 3300048925 Bacteria 4036
180 Ga0496122_0076295 3300048925 Bacteria 2359
181 Ga0496122_0129627 3300048925 Bacteria 1606
182 Ga0496122_0142497 3300048925 Bacteria 1496
183 Ga0496122_0233408 3300048925 Bacteria 1044
184 Ga0496123_0107522 3300048926 Bacteria 1604
185 Ga0496123_0134878 3300048926 Bacteria 1360
186 Ga0496123_0190497 3300048926 Bacteria 1061
187 Ga0496124_0123176 3300048927 Bacteria 2069
188 Ga0496124_0130323 3300048927 Bacteria 1999
189 Ga0496124_0207459 3300048927 Bacteria 1485
190 Ga0496124_0275108 3300048927 Bacteria 1231
191 Ga0496125_0007749 3300048928 Bacteria 11365
192 Ga0496125_0048499 3300048928 Bacteria 3540
193 Ga0496126_0089782 3300048929 Bacteria 2704
194 Ga0495678_001321 3300049459 Bacteria 19875
195 Ga0501032_0064472 3300049569 Bacteria 2452
196 Ga0501032_0223686 3300049569 Bacteria 1224
197 Ga0501033_0031870 3300049570 Bacteria 3957
198 Ga0501033_0068370 3300049570 Bacteria 2612
199 Ga0501033_0086023 3300049570 Unclassified 2302
200 Ga0501033_0093227 3300049570 Bacteria 2202
201 Ga0501033_0152247 3300049570 Bacteria 1668
202 Ga0501033_0164952 3300049570 Bacteria 1593
203 Ga0501034_0076285 3300049571 Unclassified 3359
204 Ga0501034_0138270 3300049571 Bacteria 2416
205 Ga0501034_0245221 3300049571 Bacteria 1737
206 Ga0501036_0133398 3300049572 Bacteria 2096
207 Ga0501036_0197606 3300049572 Bacteria 1692
208 Ga0501037_0008903 3300049573 Bacteria 7350
209 Ga0501037_0278767 3300049573 Bacteria 1165
210 Ga0501038_0124707 3300049574 Bacteria 2120
211 Ga0501038_0180177 3300049574 Bacteria 1705
212 Ga0501038_0314075 3300049574 Bacteria 1227
213 Ga0501043_0303757 3300049579 Bacteria 1219
214 Ga0501046_0241201 3300049580 Bacteria 1333
215 Ga0501047_0049188 3300049581 Bacteria 4071
216 Ga0501047_0162691 3300049581 Bacteria 2103
217 Ga0501047_0296083 3300049581 Bacteria 1461
218 Ga0501047_0680091 3300049581 Bacteria 847
219 Ga0501048_0763915 3300049582 Bacteria 694
220 Ga0501067_0159269 3300049583 Bacteria 1257
221 Ga0501070_0017603 3300049586 Bacteria 5999
222 Ga0501070_0498287 3300049586 Bacteria 979
223 Ga0501080_0185209 3300049742 Unclassified 1915
224 Ga0501035_0025195 3300049822 Bacteria 5453
225 Ga0501035_0053350 3300049822 Unclassified 3616
226 Ga0501035_0158383 3300049822 Bacteria 1961
227 Ga0501035_0260097 3300049822 Bacteria 1471
228 Ga0501035_0544373 3300049822 Bacteria 951
229 Ga0501035_0825288 3300049822 Bacteria 739
230 Ga0501044_0021056 3300049823 Bacteria 6961
231 Ga0501044_0028616 3300049823 Bacteria 5881
232 Ga0501044_0206334 3300049823 Bacteria 1921
233 Ga0501044_0276611 3300049823 Bacteria 1613
234 Ga0501044_0364198 3300049823 Bacteria 1363
235 Ga0501044_0465841 3300049823 Bacteria 1168
236 nmdc:mga00v17_1619_c1 3300050491 Bacteria 11776
237 nmdc:mga08y16_12649_c1 3300050511 Bacteria 8878
238 Ga0500644_0105015 3300053088 Unclassified 1079
239 Ga0500583_0000718 3300053092 Bacteria 9636
240 Ga0500583_0002320 3300053092 Bacteria 5688
241 Ga0500651_0000822 3300053093 Bacteria 15216
242 Ga0500651_0182393 3300053093 Bacteria 1246
243 Ga0500650_0009558 3300053098 Bacteria 3901
244 Ga0500555_000227 3300053103 Bacteria 25228
245 Ga0500556_0000948 3300053104 Bacteria 15688
246 Ga0500642_0000186 3300053130 Bacteria 25633
247 Ga0500658_0009243 3300053134 Bacteria 3635
248 Ga0500658_0039451 3300053134 Bacteria 1887
249 Ga0500568_0001430 3300053139 Bacteria 15482
250 Ga0500586_004477 3300053145 Bacteria 3428
251 Ga0500604_0009718 3300053151 Bacteria 2562
252 Ga0500622_0000618 3300053156 Bacteria 32174
253 Ga0500636_0002202 3300053177 Bacteria 10776
254 Ga0500611_034977 3300053727 Bacteria 1067
255 Ga0500645_000860 3300053730 Bacteria 17792
256 Ga0500645_016496 3300053730 Bacteria 2325
257 Ga0500645_086632 3300053730 Bacteria 890

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003790 Ga0055528_1018527 Ga0055528_10185273 191
2 3300049570 Ga0501033_0152247 Ga0501033_0152247_29_604 191
3 iso_pu_bacteria 2537561836 2538833219 192
4 3300025911 Ga0207654_10418322 Ga0207654_104183221 194
5 3300046512 Ga0495610_0126485 Ga0495610_0126485_484_1068 194
6 3300048925 Ga0496122_0233408 Ga0496122_0233408_433_1017 194
7 3300005327 Ga0070658_10262039 Ga0070658_102620392 195
8 3300025919 Ga0207657_10228408 Ga0207657_102284082 195
9 3300005366 Ga0070659_100448297 Ga0070659_1004482972 196
10 3300015262 Ga0182007_10005327 Ga0182007_100053275 196
11 3300025932 Ga0207690_10364949 Ga0207690_103649492 196
12 3300049571 Ga0501034_0076285 Ga0501034_0076285_2712_3302 196
13 3300053727 Ga0500611_034977 Ga0500611_034977_406_996 196
14 3300046460 Ga0495638_0263334 Ga0495638_0263334_152_751 197
15 3300049823 Ga0501044_0364198 Ga0501044_0364198_293_895 200
16 3300030742 Ga0316183_1024862 Ga0316183_10248627 201
17 3300046522 Ga0495643_0000113 Ga0495643_0000113_98685_99356 201
18 3300047320 Ga0495672_0000006 Ga0495672_0000006_410638_411309 201
19 3300047472 Ga0495686_0001843 Ga0495686_0001843_5779_6450 201
20 3300049582 Ga0501048_0763915 Ga0501048_0763915_58_663 201
21 3300046691 Ga0495670_0029402 Ga0495670_0029402_1342_2043 203
22 3300031456 Ga0307513_10453152 Ga0307513_104531521 204
23 3300046530 Ga0495654_0190500 Ga0495654_0190500_25_639 204
24 3300044842 Ga0466957_0276486 Ga0466957_0276486_464_1081 205
25 3300048924 Ga0496121_0068058 Ga0496121_0068058_278_973 205
26 3300053093 Ga0500651_0000822 Ga0500651_0000822_13631_14305 205
27 3300032004 Ga0307414_10629254 Ga0307414_106292542 206
28 3300046525 Ga0495663_0004062 Ga0495663_0004062_946_1566 206
29 3300049822 Ga0501035_0825288 Ga0501035_0825288_31_708 206
30 3300053177 Ga0500636_0002202 Ga0500636_0002202_784_1458 206
31 3300006051 Ga0075364_10004476 Ga0075364_100044768 207
32 3300025909 Ga0207705_10088275 Ga0207705_100882752 207
33 3300050491 nmdc:mga00v17_1619_c1 nmdc:mga00v17_1619_c1_6627_7298 207
34 3300042142 Ga0450905_007198 Ga0450905_007198_786_1457 208
35 iso_pu_bacteria 2893066018 2893070435 211
36 3300003659 JGI25404J52841_10021649 JGI25404J52841_100216491 216
37 3300005983 Ga0081540_1005155 Ga0081540_10051556 216
38 iso_pu_bacteria 2842757796 2842760530 217
39 iso_pu_bacteria 2643221580 2643912723 218
40 3300005327 Ga0070658_10005883 Ga0070658_1000588314 219
41 3300005339 Ga0070660_100064302 Ga0070660_1000643023 219
42 3300005344 Ga0070661_100190315 Ga0070661_1001903151 219
43 3300005539 Ga0068853_100089371 Ga0068853_1000893713 219
44 3300005616 Ga0068852_100003625 Ga0068852_1000036255 219
45 3300009093 Ga0105240_10137870 Ga0105240_101378702 219
46 3300013102 Ga0157371_10212756 Ga0157371_102127562 219
47 3300013105 Ga0157369_10004287 Ga0157369_1000428720 219
48 3300025919 Ga0207657_10125068 Ga0207657_101250683 219
49 3300025924 Ga0207694_10286844 Ga0207694_102868442 219
50 3300025949 Ga0207667_10002226 Ga0207667_1000222612 219
51 3300026041 Ga0207639_10005707 Ga0207639_100057073 219
52 3300026078 Ga0207702_10695012 Ga0207702_106950121 219
53 3300032002 Ga0307416_100803878 Ga0307416_1008038782 219
54 3300049569 Ga0501032_0223686 Ga0501032_0223686_132_833 219
55 3300049570 Ga0501033_0031870 Ga0501033_0031870_2917_3591 219
56 3300049570 Ga0501033_0093227 Ga0501033_0093227_874_1575 219
57 3300049570 Ga0501033_0164952 Ga0501033_0164952_775_1476 219
58 3300049571 Ga0501034_0245221 Ga0501034_0245221_103_804 219
59 3300049572 Ga0501036_0133398 Ga0501036_0133398_1112_1786 219
60 3300049574 Ga0501038_0124707 Ga0501038_0124707_205_906 219
61 3300049574 Ga0501038_0314075 Ga0501038_0314075_213_887 219
62 3300049581 Ga0501047_0162691 Ga0501047_0162691_888_1589 219
63 3300049581 Ga0501047_0296083 Ga0501047_0296083_385_1059 219
64 3300049586 Ga0501070_0498287 Ga0501070_0498287_163_837 219
65 3300049822 Ga0501035_0158383 Ga0501035_0158383_829_1503 219
66 3300049822 Ga0501035_0260097 Ga0501035_0260097_325_1026 219
67 3300049822 Ga0501035_0544373 Ga0501035_0544373_140_841 219
68 3300049823 Ga0501044_0028616 Ga0501044_0028616_2872_3573 219
69 3300049823 Ga0501044_0276611 Ga0501044_0276611_623_1324 219
70 3300049823 Ga0501044_0465841 Ga0501044_0465841_263_964 219
71 iso_pu_bacteria 2839993093 2839994340 219
72 iso_pu_bacteria 2996310559 2996315481 219
73 iso_pu_bacteria 3002141150 3002144218 219
74 3300005327 Ga0070658_10313615 Ga0070658_103136152 220
75 3300005339 Ga0070660_100003872 Ga0070660_1000038726 220
76 3300005455 Ga0070663_100014104 Ga0070663_1000141041 220
77 3300005530 Ga0070679_100049002 Ga0070679_1000490021 220
78 3300005563 Ga0068855_100089698 Ga0068855_1000896982 220
79 3300017792 Ga0163161_10325148 Ga0163161_103251482 220
80 3300025909 Ga0207705_10300480 Ga0207705_103004802 220
81 3300025919 Ga0207657_10003379 Ga0207657_1000337915 220
82 3300025949 Ga0207667_10098033 Ga0207667_100980332 220
83 3300026067 Ga0207678_10020151 Ga0207678_100201515 220
84 3300030745 Ga0316182_1385683 Ga0316182_13856833 220
85 3300032004 Ga0307414_10228323 Ga0307414_102283232 220
86 3300032004 Ga0307414_10579214 Ga0307414_105792142 220
87 3300046558 Ga0495633_0000426 Ga0495633_0000426_8359_9024 220
88 3300046694 Ga0495649_0138322 Ga0495649_0138322_312_1022 220
89 3300049570 Ga0501033_0086023 Ga0501033_0086023_1385_2050 220
90 3300049572 Ga0501036_0197606 Ga0501036_0197606_615_1280 220
91 3300049574 Ga0501038_0180177 Ga0501038_0180177_174_839 220
92 3300049579 Ga0501043_0303757 Ga0501043_0303757_115_780 220
93 3300049581 Ga0501047_0049188 Ga0501047_0049188_1470_2135 220
94 3300049742 Ga0501080_0185209 Ga0501080_0185209_284_949 220
95 3300049822 Ga0501035_0053350 Ga0501035_0053350_1763_2428 220
96 3300049823 Ga0501044_0206334 Ga0501044_0206334_352_1017 220
97 3300053156 Ga0500622_0000618 Ga0500622_0000618_22458_23168 220
98 iso_pu_bacteria 2643221586 2643939172 220
99 iso_pu_bacteria 8056673599 8056675315 220
100 3300005842 Ga0068858_100064771 Ga0068858_1000647713 221
101 iso_pu_bacteria 2602042107 2603859615 221
102 iso_pu_bacteria 2643221562 2643831685 221
103 iso_pu_bacteria 2643221577 2643893873 221
104 iso_pu_bacteria 2643221685 2644476098 221
105 3300002739 JGI25158J39367_1000263 JGI25158J39367_10002638 222
106 3300002773 JGI25152J39213_1004694 JGI25152J39213_10046943 222
107 3300002987 JGI25159J45721_1000264 JGI25159J45721_100026413 222
108 3300003215 JGI25153J46596_10011771 JGI25153J46596_100117713 222
109 3300003322 rootL2_10066716 rootL2_100667163 222
110 3300003354 JGI25160J50197_1010571 JGI25160J50197_10105713 222
111 3300003374 JGI25161J50226_1000338 JGI25161J50226_100033821 222
112 3300003771 Ga0055526_1001333 Ga0055526_10013338 222
113 3300003775 Ga0055524_1015877 Ga0055524_10158772 222
114 3300003775 Ga0055524_1016719 Ga0055524_10167192 222
115 3300003792 Ga0055540_1008594 Ga0055540_10085941 222
116 3300004625 Ga0055543_1000115 Ga0055543_100011557 222
117 3300005262 Ga0065165_1013361 Ga0065165_10133615 222
118 3300005337 Ga0070682_100267023 Ga0070682_1002670231 222
119 3300009551 Ga0105238_10030168 Ga0105238_100301682 222
120 3300025208 Ga0209436_100936 Ga0209436_10093613 222
121 3300025258 Ga0209129_1001213 Ga0209129_10012139 222
122 3300025273 Ga0209673_1005710 Ga0209673_10057102 222
123 3300025284 Ga0209130_1000015 Ga0209130_100001521 222
124 3300025295 Ga0209564_1000195 Ga0209564_1000195148 222
125 3300025295 Ga0209564_1001682 Ga0209564_10016827 222
126 3300025297 Ga0209758_1005036 Ga0209758_100503613 222
127 3300025299 Ga0209256_1007537 Ga0209256_10075374 222
128 3300025299 Ga0209256_1026250 Ga0209256_10262502 222
129 3300025302 Ga0207426_1000122 Ga0207426_1000122211 222
130 3300025303 Ga0209051_1019820 Ga0209051_10198203 222
131 3300025924 Ga0207694_10099230 Ga0207694_100992302 222
132 3300026116 Ga0207674_10051397 Ga0207674_100513975 222
133 3300032004 Ga0307414_10026255 Ga0307414_100262553 222
134 3300032004 Ga0307414_10121266 Ga0307414_101212662 222
135 3300032004 Ga0307414_10131208 Ga0307414_101312083 222
136 3300048921 Ga0496118_0063653 Ga0496118_0063653_1449_2165 222
137 3300048924 Ga0496121_0129521 Ga0496121_0129521_728_1405 222
138 3300048925 Ga0496122_0009232 Ga0496122_0009232_7972_8688 222
139 3300048926 Ga0496123_0107522 Ga0496123_0107522_837_1553 222
140 3300048926 Ga0496123_0134878 Ga0496123_0134878_365_1042 222
141 3300048927 Ga0496124_0123176 Ga0496124_0123176_1259_1936 222
142 3300048927 Ga0496124_0207459 Ga0496124_0207459_489_1166 222
143 iso_pu_bacteria 2510917030 2511197892 222
144 iso_pu_bacteria 2582581298 2585225417 222
145 iso_pu_bacteria 2585427529 2585548308 222
146 iso_pu_bacteria 2643221593 2643973566 222
147 iso_pu_bacteria 2941471342 2941473235 222
148 3300005548 Ga0070665_100835188 Ga0070665_1008351881 223
149 3300014497 Ga0182008_10051722 Ga0182008_100517222 223
150 3300025913 Ga0207695_10527104 Ga0207695_105271042 223
151 3300032004 Ga0307414_10082010 Ga0307414_100820103 223
152 3300048927 Ga0496124_0275108 Ga0496124_0275108_326_1042 223
153 3300003322 rootL2_10082513 rootL2_100825132 224
154 3300005341 Ga0070691_10010345 Ga0070691_100103455 224
155 3300005353 Ga0070669_100004735 Ga0070669_1000047353 224
156 3300005455 Ga0070663_100023688 Ga0070663_1000236882 224
157 3300005548 Ga0070665_100084298 Ga0070665_1000842982 224
158 3300005563 Ga0068855_100783496 Ga0068855_1007834962 224
159 3300005983 Ga0081540_1001232 Ga0081540_100123212 224
160 3300006038 Ga0075365_10037735 Ga0075365_100377353 224
161 3300006051 Ga0075364_10021617 Ga0075364_100216174 224
162 3300009551 Ga0105238_10185378 Ga0105238_101853783 224
163 3300013104 Ga0157370_10363458 Ga0157370_103634581 224
164 3300013104 Ga0157370_10701004 Ga0157370_107010042 224
165 3300013307 Ga0157372_10130155 Ga0157372_101301554 224
166 3300025295 Ga0209564_1009425 Ga0209564_10094254 224
167 3300025912 Ga0207707_10237745 Ga0207707_102377452 224
168 3300025917 Ga0207660_10213680 Ga0207660_102136802 224
169 3300025921 Ga0207652_10068917 Ga0207652_100689172 224
170 3300025924 Ga0207694_10048057 Ga0207694_100480573 224
171 3300026067 Ga0207678_10041261 Ga0207678_100412612 224
172 3300028379 Ga0268266_10113556 Ga0268266_101135563 224
173 3300031731 Ga0307405_10048656 Ga0307405_100486562 224
174 3300031824 Ga0307413_10065729 Ga0307413_100657293 224
175 3300031824 Ga0307413_10259128 Ga0307413_102591282 224
176 3300031852 Ga0307410_10379168 Ga0307410_103791681 224
177 3300031852 Ga0307410_10479321 Ga0307410_104793211 224
178 3300031995 Ga0307409_100035746 Ga0307409_1000357464 224
179 3300032004 Ga0307414_10006035 Ga0307414_100060353 224
180 3300032004 Ga0307414_10062927 Ga0307414_100629273 224
181 3300032005 Ga0307411_10151266 Ga0307411_101512663 224
182 3300032005 Ga0307411_10461009 Ga0307411_104610091 224
183 3300046460 Ga0495638_0127748 Ga0495638_0127748_386_1060 224
184 3300046512 Ga0495610_0108843 Ga0495610_0108843_144_818 224
185 3300046660 Ga0495625_0093818 Ga0495625_0093818_672_1346 224
186 3300048919 Ga0496116_0003213 Ga0496116_0003213_15183_15860 224
187 3300048920 Ga0496117_0048789 Ga0496117_0048789_2176_2850 224
188 3300048921 Ga0496118_0194621 Ga0496118_0194621_133_807 224
189 3300048924 Ga0496121_0005011 Ga0496121_0005011_692_1366 224
190 3300048925 Ga0496122_0129627 Ga0496122_0129627_892_1569 224
191 3300048927 Ga0496124_0130323 Ga0496124_0130323_459_1136 224
192 3300048928 Ga0496125_0048499 Ga0496125_0048499_950_1627 224
193 3300049583 Ga0501067_0159269 Ga0501067_0159269_236_916 224
194 3300053093 Ga0500651_0182393 Ga0500651_0182393_537_1211 224
195 3300053098 Ga0500650_0009558 Ga0500650_0009558_400_1074 224
196 3300053130 Ga0500642_0000186 Ga0500642_0000186_15135_15809 224
197 3300053134 Ga0500658_0039451 Ga0500658_0039451_300_974 224
198 3300053139 Ga0500568_0001430 Ga0500568_0001430_1553_2227 224
199 3300053145 Ga0500586_004477 Ga0500586_004477_2524_3198 224
200 3300053151 Ga0500604_0009718 Ga0500604_0009718_1238_1912 224
201 3300053730 Ga0500645_086632 Ga0500645_086632_89_763 224
202 3300005435 Ga0070714_100026082 Ga0070714_1000260824 225
203 3300005616 Ga0068852_100002597 Ga0068852_1000025976 225
204 3300009553 Ga0105249_10050827 Ga0105249_100508275 225
205 3300013100 Ga0157373_10028108 Ga0157373_100281082 225
206 3300013102 Ga0157371_10016479 Ga0157371_100164796 225
207 3300013104 Ga0157370_10080046 Ga0157370_100800462 225
208 3300013104 Ga0157370_10090085 Ga0157370_100900852 225
209 3300013307 Ga0157372_10467935 Ga0157372_104679353 225
210 3300025924 Ga0207694_10129036 Ga0207694_101290363 225
211 3300025929 Ga0207664_10015511 Ga0207664_100155115 225
212 3300026142 Ga0207698_10009979 Ga0207698_100099796 225
213 3300041410 Ga0439461_0040233 Ga0439461_0040233_148_858 225
214 3300044672 Ga0466982_0000016 Ga0466982_0000016_99888_100580 225
215 3300046452 Ga0495617_000697 Ga0495617_000697_6049_6726 225
216 3300046460 Ga0495638_0000178 Ga0495638_0000178_72342_73019 225
217 3300046491 Ga0495584_0243567 Ga0495584_0243567_210_887 225
218 3300046501 Ga0495607_0000370 Ga0495607_0000370_24981_25658 225
219 3300046506 Ga0495583_0006817 Ga0495583_0006817_6029_6706 225
220 3300046512 Ga0495610_0000097 Ga0495610_0000097_44025_44711 225
221 3300046513 Ga0495616_0178555 Ga0495616_0178555_152_838 225
222 3300046520 Ga0495637_0008373 Ga0495637_0008373_3385_4062 225
223 3300046648 Ga0495611_0000002 Ga0495611_0000002_6927_7604 225
224 3300046660 Ga0495625_0000002 Ga0495625_0000002_6927_7604 225
225 3300046660 Ga0495625_0014786 Ga0495625_0014786_1352_2038 225
226 3300046794 Ga0495589_0000014 Ga0495589_0000014_6927_7604 225
227 3300046810 Ga0495660_0000105 Ga0495660_0000105_38273_38950 225
228 3300047446 Ga0495679_000003 Ga0495679_000003_780216_780893 225
229 3300047469 Ga0495673_0000474 Ga0495673_0000474_35815_36492 225
230 3300049459 Ga0495678_001321 Ga0495678_001321_12272_12949 225
231 3300049569 Ga0501032_0064472 Ga0501032_0064472_1571_2269 225
232 3300049570 Ga0501033_0068370 Ga0501033_0068370_925_1623 225
233 3300049571 Ga0501034_0138270 Ga0501034_0138270_659_1357 225
234 3300049573 Ga0501037_0008903 Ga0501037_0008903_4524_5222 225
235 3300049573 Ga0501037_0278767 Ga0501037_0278767_250_948 225
236 3300049580 Ga0501046_0241201 Ga0501046_0241201_159_857 225
237 3300049581 Ga0501047_0680091 Ga0501047_0680091_20_718 225
238 3300049586 Ga0501070_0017603 Ga0501070_0017603_377_1075 225
239 3300049822 Ga0501035_0025195 Ga0501035_0025195_1363_2061 225
240 3300049823 Ga0501044_0021056 Ga0501044_0021056_4720_5418 225
241 3300053088 Ga0500644_0105015 Ga0500644_0105015_312_1004 225
242 3300053092 Ga0500583_0000718 Ga0500583_0000718_1269_1961 225
243 3300053092 Ga0500583_0002320 Ga0500583_0002320_4135_4827 225
244 3300053103 Ga0500555_000227 Ga0500555_000227_7028_7705 225
245 3300001904 JGI24736J21556_1001627 JGI24736J21556_10016275 226
246 3300005435 Ga0070714_100057861 Ga0070714_1000578612 226
247 3300005844 Ga0068862_100155184 Ga0068862_1001551843 226
248 3300006871 Ga0075434_100456881 Ga0075434_1004568812 226
249 3300009094 Ga0111539_10014079 Ga0111539_100140795 226
250 3300013104 Ga0157370_10071391 Ga0157370_100713913 226
251 3300013105 Ga0157369_10000333 Ga0157369_1000033347 226
252 3300025904 Ga0207647_10000010 Ga0207647_1000001047 226
253 3300027907 Ga0207428_10033336 Ga0207428_100333366 226
254 3300037312 Ga0395899_0168660 Ga0395899_0168660_649_1335 226
255 3300037418 Ga0395900_0001278 Ga0395900_0001278_7520_8206 226
256 3300037466 Ga0395898_0007601 Ga0395898_0007601_3750_4436 226
257 3300038443 Ga0395901_0000327 Ga0395901_0000327_29856_30542 226
258 3300046460 Ga0495638_0004100 Ga0495638_0004100_8156_8845 226
259 3300047320 Ga0495672_0000700 Ga0495672_0000700_31245_31934 226
260 3300048909 Ga0496106_0580505 Ga0496106_0580505_45_737 226
261 3300048919 Ga0496116_0056064 Ga0496116_0056064_83_763 226
262 3300048920 Ga0496117_0033849 Ga0496117_0033849_62_754 226
263 3300048921 Ga0496118_0001194 Ga0496118_0001194_26582_27274 226
264 3300048924 Ga0496121_0000071 Ga0496121_0000071_88803_89495 226
265 3300048925 Ga0496122_0035726 Ga0496122_0035726_2012_2704 226
266 3300048925 Ga0496122_0076295 Ga0496122_0076295_1432_2124 226
267 3300048925 Ga0496122_0142497 Ga0496122_0142497_148_828 226
268 3300048926 Ga0496123_0190497 Ga0496123_0190497_329_1021 226
269 3300048928 Ga0496125_0007749 Ga0496125_0007749_7761_8453 226
270 3300048929 Ga0496126_0089782 Ga0496126_0089782_434_1126 226
271 3300050511 nmdc:mga08y16_12649_c1 nmdc:mga08y16_12649_c1_2884_3576 226
272 3300053104 Ga0500556_0000948 Ga0500556_0000948_10773_11462 226
273 3300053134 Ga0500658_0009243 Ga0500658_0009243_468_1157 226
274 3300053730 Ga0500645_000860 Ga0500645_000860_3943_4632 226
275 3300053730 Ga0500645_016496 Ga0500645_016496_782_1471 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

70

163

0.94

PF08241

Methyltransf_11

Methyltransferase domain

71

168

0.91

PF08242

Methyltransf_12

Methyltransferase domain

71

166

0.87

PF13847

Methyltransf_31

Methyltransferase domain

66

227

0.83

PF13489

Methyltransf_23

Methyltransferase domain

44

233

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1im8-assembly2.cif.gz_B crystal structure of yeco from haemophilus influenzae (hi0319), a methyltransferase with a bound s-adenosylhomocysteine 0.8821 6 222
3dtn-assembly1.cif.gz_A crystal structure of putative methyltransferase-mm_2633 from methanosarcina mazei . 0.8812 11 223
4iwn-assembly1.cif.gz_B crystal structure of a putative methyltransferase cmoa in complex with a novel sam derivative 0.8699 7 225
4gek-assembly1.cif.gz_A crystal structure of wild-type cmoa from e.coli 0.8691 6 224
8k5l-assembly2.cif.gz_C structure of trna (cmo5u34)-methyltransferase from fusobacterium nucleatum 0.8658 18 222
ID Description Score Start End Superfamily
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8668 11 223 3.40.50.150
1im8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8581 6 221 3.40.50.150
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8531 11 223 3.40.50.150
3hnrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8524 24 225 3.40.50.150
1im8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8472 6 221 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A059X5T3-F1-model_v4 Methyltransferase domain protein 0.9903 1 134 GO:0008168
GO:0032259
AF-A0A850PXZ3-F1-model_v4 SAM-dependent methyltransferase 0.9833 3 222 GO:0008168
GO:0032259
AF-A0A059X5T3-F1-model_v4 Methyltransferase domain protein 0.9758 1 134 GO:0008168
GO:0032259
AF-A0A850PXZ3-F1-model_v4 SAM-dependent methyltransferase 0.9533 3 222 GO:0008168
GO:0032259
AF-A0A1I2TNF1-F1-model_v4 deleted 0.9477 1 211

Feature Viewer

pLDDT pTM Quality
90.28 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map