F380759

General Info

Members Datasets Scaffolds Average Seq Length
275 168 550 187

Family's Representative Sequence

Representative Sequence 3300053148|Ga0500590_000337|Ga0500590_000337_2758_3381
Length 207
Sequence MLAAAHFVPQHSPTGESMAKFFGNLHLVLVVGLIAAVAVMFGFRASVIPDVNAIFHWLHVFFGILWIGLLYYLNFVQVPTMPKVPAELKKGVTGYIAPKVFFFFRWSALLTVLTGLAIAGQAHFLMPALTFSGSGAVNMIGLGMWLALIMAFNVWFIIWPAQKKILGIIEATDAEKAAATPRALYASRTNLLLSLPMLYCMASANLS

Samples

Sample ID Description Type Environment
1 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
88 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
101 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
133 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
134 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
135 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
142 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
146 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
147 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
150 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
151 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
154 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
157 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
160 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
161 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
162 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
163 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
164 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
165 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
166 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
167 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
168 2739367865 Novosphingobium sp. GV013 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.36
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.27
Nodule 0.73
Rhizoplane 5.82
Rhizosphere 61.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500590_000337 3300053148 Bacteria 15301
2 SwRhRL2b_contig_3638825 2162886007 Bacteria 1347
3 JGI24752J21851_1007849 3300001976 Bacteria 1393
4 JGI24751J29686_10000113 3300002459 Bacteria 42221
5 Ga0065704_10090184 3300005289 Bacteria 2787
6 Ga0065704_10152552 3300005289 Bacteria 1417
7 Ga0065704_10205669 3300005289 Bacteria 1128
8 Ga0065712_10118116 3300005290 Bacteria 1702
9 Ga0065707_10170465 3300005295 Bacteria 1488
10 Ga0065707_10237149 3300005295 Bacteria 1168
11 Ga0070658_10000652 3300005327 Bacteria 29975
12 Ga0070658_10028316 3300005327 Bacteria 4497
13 Ga0070670_100000792 3300005331 Bacteria 24611
14 Ga0070670_100575210 3300005331 Bacteria 1006
15 Ga0070666_10003756 3300005335 Bacteria 9205
16 Ga0070668_100162808 3300005347 Bacteria 1811
17 Ga0070669_100000062 3300005353 Bacteria 107705
18 Ga0070669_100054170 3300005353 Bacteria 2938
19 Ga0070669_100361691 3300005353 Bacteria 1180
20 Ga0070671_100000914 3300005355 Bacteria 21551
21 Ga0070671_100105440 3300005355 Bacteria 2366
22 Ga0070667_100000290 3300005367 Bacteria 56841
23 Ga0070667_100006105 3300005367 Bacteria 10004
24 Ga0070705_100029724 3300005440 Bacteria 3010
25 Ga0070694_100546591 3300005444 Bacteria 927
26 Ga0070707_100825527 3300005468 Bacteria 891
27 Ga0070679_100036990 3300005530 Bacteria 4846
28 Ga0068853_100112753 3300005539 Bacteria 2417
29 Ga0070686_100138244 3300005544 Bacteria 1693
30 Ga0070695_100046117 3300005545 Bacteria 2781
31 Ga0070665_100013049 3300005548 Bacteria 8367
32 Ga0070665_100136275 3300005548 Bacteria 2458
33 Ga0070665_100362895 3300005548 Bacteria 1455
34 Ga0070665_100687804 3300005548 Bacteria 1036
35 Ga0068855_100063327 3300005563 Bacteria 4315
36 Ga0068854_100000819 3300005578 Bacteria 18592
37 Ga0068854_100001393 3300005578 Bacteria 14568
38 Ga0068856_100259152 3300005614 Bacteria 1754
39 Ga0068852_100000761 3300005616 Bacteria 21244
40 Ga0068852_100248903 3300005616 Bacteria 1702
41 Ga0068859_100003919 3300005617 Bacteria 15197
42 Ga0068859_100634134 3300005617 Bacteria 1161
43 Ga0068864_100000063 3300005618 Bacteria 119845
44 Ga0068864_100131506 3300005618 Bacteria 2248
45 Ga0068863_100000058 3300005841 Bacteria 123096
46 Ga0068863_100000062 3300005841 Bacteria 119845
47 Ga0068863_100385009 3300005841 Bacteria 1370
48 Ga0068858_100002064 3300005842 Bacteria 20445
49 Ga0068858_100021087 3300005842 Bacteria 6086
50 Ga0068858_100128864 3300005842 Bacteria 2371
51 Ga0068858_100304899 3300005842 Bacteria 1520
52 Ga0068860_100000057 3300005843 Bacteria 201847
53 Ga0068860_100021733 3300005843 Bacteria 6209
54 Ga0068860_100034885 3300005843 Bacteria 4826
55 Ga0068862_100000069 3300005844 Bacteria 122535
56 Ga0068862_100023927 3300005844 Bacteria 5120
57 Ga0068862_100436329 3300005844 Bacteria 1232
58 Ga0075368_10000096 3300006042 Bacteria 22180
59 Ga0075363_100000143 3300006048 Bacteria 17595
60 Ga0075363_100011386 3300006048 Bacteria 4257
61 Ga0075364_10030671 3300006051 Bacteria 3451
62 Ga0075364_10040695 3300006051 Bacteria 3015
63 Ga0075432_10033388 3300006058 Bacteria 1785
64 Ga0075362_10000021 3300006177 Bacteria 62684
65 Ga0075362_10002589 3300006177 Bacteria 6116
66 Ga0075362_10087322 3300006177 Bacteria 1444
67 Ga0075367_10019730 3300006178 Bacteria 3742
68 Ga0075369_10001961 3300006186 Bacteria 7231
69 Ga0075369_10004788 3300006186 Bacteria 5032
70 Ga0075369_10067133 3300006186 Bacteria 1574
71 Ga0075366_10000127 3300006195 Bacteria 31623
72 Ga0075366_10015094 3300006195 Bacteria 4419
73 Ga0075366_10035967 3300006195 Bacteria 2919
74 Ga0075366_10059215 3300006195 Bacteria 2275
75 Ga0075370_10000068 3300006353 Bacteria 31378
76 Ga0075370_10016901 3300006353 Bacteria 3934
77 Ga0075430_100304144 3300006846 Bacteria 1319
78 Ga0097620_100003919 3300006931 Bacteria 15197
79 Ga0097620_100634055 3300006931 Bacteria 1161
80 Ga0079104_1020089 3300006946 Bacteria 1850
81 Ga0079104_1043883 3300006946 Bacteria 1027
82 Ga0105251_10003021 3300009011 Bacteria 12550
83 Ga0105240_10187116 3300009093 Bacteria 2438
84 Ga0105240_10887178 3300009093 Bacteria 960
85 Ga0105247_10007366 3300009101 Bacteria 6760
86 Ga0105247_10413200 3300009101 Bacteria 964
87 Ga0105248_10000536 3300009177 Bacteria 43208
88 Ga0105248_10161428 3300009177 Bacteria 2528
89 Ga0105248_10202507 3300009177 Bacteria 2236
90 Ga0105249_10000160 3300009553 Bacteria 81883
91 Ga0105249_10022643 3300009553 Bacteria 5630
92 Ga0163162_10016721 3300013306 Bacteria 7170
93 Ga0163162_10064701 3300013306 Bacteria 3702
94 Ga0163163_10394537 3300014325 Bacteria 1442
95 Ga0163163_10624132 3300014325 Bacteria 1141
96 Ga0157380_10443860 3300014326 Bacteria 1244
97 Ga0157379_10308027 3300014968 Bacteria 1444
98 Ga0207656_10126129 3300025321 Bacteria 1196
99 Ga0207713_1002174 3300025735 Bacteria 14541
100 Ga0207710_10056547 3300025900 Bacteria 1770
101 Ga0207710_10300637 3300025900 Bacteria 811
102 Ga0207647_10021662 3300025904 Bacteria 4286
103 Ga0207647_10279321 3300025904 Bacteria 953
104 Ga0207705_10000023 3300025909 Bacteria 301755
105 Ga0207705_10121681 3300025909 Bacteria 1937
106 Ga0207695_10122380 3300025913 Bacteria 2568
107 Ga0207695_10376646 3300025913 Bacteria 1305
108 Ga0207657_10671974 3300025919 Bacteria 806
109 Ga0207652_10100477 3300025921 Bacteria 2554
110 Ga0207646_10374605 3300025922 Bacteria 1286
111 Ga0207681_10492691 3300025923 Bacteria 1002
112 Ga0207650_10000986 3300025925 Bacteria 21395
113 Ga0207650_10212472 3300025925 Bacteria 1554
114 Ga0207650_10655618 3300025925 Bacteria 885
115 Ga0207644_10000003 3300025931 Bacteria 585905
116 Ga0207711_10000017 3300025941 Bacteria 441730
117 Ga0207711_10395673 3300025941 Bacteria 1283
118 Ga0207711_10610398 3300025941 Bacteria 1018
119 Ga0207667_10007877 3300025949 Bacteria 12718
120 Ga0207667_10027058 3300025949 Bacteria 6254
121 Ga0207712_10000222 3300025961 Bacteria 56073
122 Ga0207712_10105145 3300025961 Bacteria 2106
123 Ga0207640_10000394 3300025981 Bacteria 27805
124 Ga0207640_10151113 3300025981 Bacteria 1706
125 Ga0207640_10573424 3300025981 Bacteria 951
126 Ga0207658_10000133 3300025986 Bacteria 78402
127 Ga0207658_10020195 3300025986 Bacteria 4614
128 Ga0207658_10080733 3300025986 Bacteria 2492
129 Ga0207703_10001872 3300026035 Bacteria 18718
130 Ga0207703_10014902 3300026035 Bacteria 6066
131 Ga0207703_10051383 3300026035 Bacteria 3340
132 Ga0207703_10106464 3300026035 Bacteria 2385
133 Ga0207639_10043456 3300026041 Bacteria 3374
134 Ga0207702_10032993 3300026078 Bacteria 4323
135 Ga0207641_10000022 3300026088 Bacteria 279334
136 Ga0207641_10000338 3300026088 Bacteria 56937
137 Ga0207676_10000056 3300026095 Bacteria 124484
138 Ga0207676_10009602 3300026095 Bacteria 6887
139 Ga0207676_10034270 3300026095 Bacteria 3844
140 Ga0207676_10285912 3300026095 Bacteria 1499
141 Ga0207674_10138565 3300026116 Bacteria 2394
142 Ga0207698_10000141 3300026142 Bacteria 45510
143 Ga0207698_10662339 3300026142 Bacteria 1035
144 Ga0209984_1033500 3300027424 Bacteria 730
145 Ga0209813_10000013 3300027866 Bacteria 89768
146 Ga0209974_10003563 3300027876 Bacteria 5605
147 Ga0207428_10039937 3300027907 Bacteria 3809
148 Ga0268266_10005666 3300028379 Bacteria 11582
149 Ga0268266_10134871 3300028379 Bacteria 2210
150 Ga0268265_10000044 3300028380 Bacteria 182545
151 Ga0268265_10015867 3300028380 Bacteria 5166
152 Ga0268264_10000078 3300028381 Bacteria 249595
153 Ga0268264_10045468 3300028381 Bacteria 3645
154 Ga0268264_10244186 3300028381 Bacteria 1665
155 Ga0265331_10149618 3300031250 Bacteria 1060
156 Ga0307408_101081247 3300031548 Bacteria 743
157 Ga0316575_10009101 3300031665 Bacteria 3631
158 Ga0307413_10074869 3300031824 Bacteria 2146
159 Ga0307410_10031686 3300031852 Bacteria 3396
160 Ga0307406_10190107 3300031901 Bacteria 1502
161 Ga0307407_10081816 3300031903 Bacteria 1955
162 Ga0307412_10276500 3300031911 Bacteria 1316
163 Ga0307409_100048419 3300031995 Bacteria 3234
164 Ga0307416_100659048 3300032002 Bacteria 1132
165 Ga0307414_10391550 3300032004 Bacteria 1204
166 Ga0307414_10640635 3300032004 Bacteria 957
167 Ga0307411_10143976 3300032005 Bacteria 1761
168 Ga0307415_100566449 3300032126 Bacteria 1005
169 Ga0307415_100631633 3300032126 Bacteria 957
170 Ga0373943_0360165 3300035170 Bacteria 835
171 Ga0436364_0323187 3300037853 Bacteria 1547
172 Ga0451807_2691360 3300041486 Bacteria 664
173 Ga0451841_0265881 3300041498 Bacteria 929
174 Ga0451853_1261340 3300041512 Bacteria 2030
175 Ga0439449_0090972 3300042007 Bacteria 1127
176 Ga0451577_0174541 3300042876 Bacteria 1937
177 Ga0453684_0274345 3300044712 Bacteria 1926
178 Ga0495643_0044969 3300046522 Bacteria 2398
179 Ga0495643_0061141 3300046522 Bacteria 1998
180 Ga0495648_0235843 3300046524 Bacteria 892
181 Ga0495597_0004884 3300046542 Bacteria 7219
182 Ga0495668_0026948 3300046616 Bacteria 3258
183 Ga0495668_0112414 3300046616 Bacteria 1490
184 Ga0495625_0039651 3300046660 Bacteria 3438
185 Ga0495625_0085542 3300046660 Bacteria 2189
186 Ga0495669_0007355 3300046684 Bacteria 4614
187 Ga0495686_0125800 3300047472 Bacteria 1524
188 Ga0495686_0364714 3300047472 Bacteria 782
189 Ga0496100_0035892 3300048903 Bacteria 3122
190 Ga0496101_0098529 3300048904 Bacteria 2184
191 Ga0496102_0022193 3300048905 Bacteria 5622
192 Ga0496103_0041614 3300048906 Bacteria 2825
193 Ga0496103_0292779 3300048906 Bacteria 1047
194 Ga0496104_0063192 3300048907 Bacteria 3511
195 Ga0496104_0188322 3300048907 Bacteria 1974
196 Ga0496105_0000751 3300048908 Bacteria 22003
197 Ga0496106_0000675 3300048909 Bacteria 24457
198 Ga0496107_0084944 3300048910 Bacteria 2309
199 Ga0496108_0218428 3300048911 Bacteria 1656
200 Ga0496109_0844860 3300048912 Bacteria 853
201 Ga0496110_0763441 3300048913 Bacteria 870
202 Ga0496113_0007065 3300048916 Bacteria 7186
203 Ga0496114_0278297 3300048917 Bacteria 1475
204 Ga0496117_0010298 3300048920 Bacteria 8550
205 Ga0496118_0121287 3300048921 Bacteria 1703
206 Ga0496121_0000312 3300048924 Bacteria 101230
207 Ga0496121_0273269 3300048924 Bacteria 1160
208 Ga0496121_0424653 3300048924 Bacteria 864
209 Ga0496124_0193885 3300048927 Bacteria 1552
210 Ga0496126_0006683 3300048929 Bacteria 12816
211 Ga0496126_0252343 3300048929 Bacteria 1470
212 Ga0501306_036647 3300049127 Bacteria 748
213 Ga0495682_0034100 3300049460 Bacteria 1878
214 Ga0501224_043861 3300049664 Bacteria 678
215 Ga0501249_004939 3300049679 Bacteria 2721
216 nmdc:mga03683_21552_c1 3300050489 Bacteria 2486
217 nmdc:mga03683_27484_c1 3300050489 Bacteria 2254
218 nmdc:mga03683_69_c1 3300050489 Bacteria 38507
219 nmdc:mga03n38_191967_c1 3300050490 Bacteria 1053
220 nmdc:mga03n38_4399_c1 3300050490 Bacteria 4664
221 nmdc:mga00v17_51167_c1 3300050491 Bacteria 2512
222 nmdc:mga00v17_5572_c1 3300050491 Bacteria 6638
223 nmdc:mga00v17_83730_c1 3300050491 Bacteria 1995
224 nmdc:mga0yw44_204881_c1 3300050492 Bacteria 1304
225 nmdc:mga0k408_161310_c1 3300050493 Bacteria 1336
226 nmdc:mga0k408_173706_c1 3300050493 Bacteria 1285
227 nmdc:mga0k408_29073_c1 3300050493 Bacteria 3144
228 nmdc:mga0k408_427700_c1 3300050493 Bacteria 787
229 nmdc:mga0k408_45_c1 3300050493 Bacteria 63055
230 nmdc:mga0k408_78863_c1 3300050493 Bacteria 1927
231 nmdc:mga06z11_49_c1 3300050494 Bacteria 50406
232 nmdc:mga06z11_50141_c1 3300050494 Bacteria 2132
233 nmdc:mga04h51_144_c1 3300050495 Bacteria 17815
234 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
235 nmdc:mga07m45_2530_c1 3300050496 Bacteria 8586
236 nmdc:mga07m45_39_c1 3300050496 Bacteria 63381
237 nmdc:mga07m45_457601_c1 3300050496 Bacteria 740
238 nmdc:mga05p37_903506_c1 3300050507 Bacteria 952
239 nmdc:mga08x19_59191_c1 3300050514 Bacteria 2479
240 nmdc:mga0sz30_1654_c1 3300050516 Bacteria 7926
241 nmdc:mga0sz30_28070_c1 3300050516 Bacteria 2314
242 nmdc:mga0sz30_638_c1 3300050516 Bacteria 12975
243 Ga0500643_000001 3300053087 Bacteria 1440111
244 Ga0500643_018506 3300053087 Bacteria 2310
245 Ga0500647_0085432 3300053091 Bacteria 1513
246 Ga0500647_0224771 3300053091 Bacteria 838
247 Ga0500651_0003043 3300053093 Bacteria 9065
248 Ga0500555_058458 3300053103 Bacteria 1042
249 Ga0500592_003033 3300053116 Plasmid 2685
250 Ga0500607_000130 3300053121 Bacteria 61720
251 Ga0500607_000442 3300053121 Bacteria 39777
252 Ga0500607_214362 3300053121 Bacteria 810
253 Ga0500608_015933 3300053122 Bacteria 3386
254 Ga0500642_0004860 3300053130 Bacteria 4260
255 Ga0500655_000139 3300053133 Bacteria 18346
256 Ga0500559_0000453 3300053136 Bacteria 29214
257 Ga0500559_0004221 3300053136 Bacteria 6874
258 Ga0500559_0092460 3300053136 Bacteria 1386
259 Ga0500564_018889 3300053138 Bacteria 3147
260 Ga0500573_0030596 3300053140 Bacteria 3105
261 Ga0500590_000339 3300053148 Bacteria 15289
262 Ga0500616_0001875 3300053153 Bacteria 18942
263 Ga0500622_0002280 3300053156 Bacteria 14076
264 Ga0500636_0112618 3300053177 Bacteria 1536
265 Ga0500636_0228882 3300053177 Bacteria 963
266 Ga0500637_0002790 3300053178 Bacteria 7842
267 Ga0500567_000268 3300053723 Bacteria 16135
268 Ga0500570_001706 3300053724 Bacteria 10383
269 Ga0500625_000041 3300053729 Bacteria 35224
270 Ga0500645_008197 3300053730 Bacteria 3586
271 Ga0500645_022157 3300053730 Bacteria 1956
272 Ga0500645_031440 3300053730 Bacteria 1595
273 2585260078 2582581305 Bacteria 4895574
274 2739650390 2739367664 Bacteria 4114334
275 2740028863 2739367865 Bacteria 4114482
276 Ga0500590_000337
277 SwRhRL2b_contig_3638825
278 JGI24752J21851_1007849
279 JGI24751J29686_10000113
280 Ga0065704_10090184
281 Ga0065704_10152552
282 Ga0065704_10205669
283 Ga0065712_10118116
284 Ga0065707_10170465
285 Ga0065707_10237149
286 Ga0070658_10000652
287 Ga0070658_10028316
288 Ga0070670_100000792
289 Ga0070670_100575210
290 Ga0070666_10003756
291 Ga0070668_100162808
292 Ga0070669_100000062
293 Ga0070669_100054170
294 Ga0070669_100361691
295 Ga0070671_100000914
296 Ga0070671_100105440
297 Ga0070667_100000290
298 Ga0070667_100006105
299 Ga0070705_100029724
300 Ga0070694_100546591
301 Ga0070707_100825527
302 Ga0070679_100036990
303 Ga0068853_100112753
304 Ga0070686_100138244
305 Ga0070695_100046117
306 Ga0070665_100013049
307 Ga0070665_100136275
308 Ga0070665_100362895
309 Ga0070665_100687804
310 Ga0068855_100063327
311 Ga0068854_100000819
312 Ga0068854_100001393
313 Ga0068856_100259152
314 Ga0068852_100000761
315 Ga0068852_100248903
316 Ga0068859_100003919
317 Ga0068859_100634134
318 Ga0068864_100000063
319 Ga0068864_100131506
320 Ga0068863_100000058
321 Ga0068863_100000062
322 Ga0068863_100385009
323 Ga0068858_100002064
324 Ga0068858_100021087
325 Ga0068858_100128864
326 Ga0068858_100304899
327 Ga0068860_100000057
328 Ga0068860_100021733
329 Ga0068860_100034885
330 Ga0068862_100000069
331 Ga0068862_100023927
332 Ga0068862_100436329
333 Ga0075368_10000096
334 Ga0075363_100000143
335 Ga0075363_100011386
336 Ga0075364_10030671
337 Ga0075364_10040695
338 Ga0075432_10033388
339 Ga0075362_10000021
340 Ga0075362_10002589
341 Ga0075362_10087322
342 Ga0075367_10019730
343 Ga0075369_10001961
344 Ga0075369_10004788
345 Ga0075369_10067133
346 Ga0075366_10000127
347 Ga0075366_10015094
348 Ga0075366_10035967
349 Ga0075366_10059215
350 Ga0075370_10000068
351 Ga0075370_10016901
352 Ga0075430_100304144
353 Ga0097620_100003919
354 Ga0097620_100634055
355 Ga0079104_1020089
356 Ga0079104_1043883
357 Ga0105251_10003021
358 Ga0105240_10187116
359 Ga0105240_10887178
360 Ga0105247_10007366
361 Ga0105247_10413200
362 Ga0105248_10000536
363 Ga0105248_10161428
364 Ga0105248_10202507
365 Ga0105249_10000160
366 Ga0105249_10022643
367 Ga0163162_10016721
368 Ga0163162_10064701
369 Ga0163163_10394537
370 Ga0163163_10624132
371 Ga0157380_10443860
372 Ga0157379_10308027
373 Ga0207656_10126129
374 Ga0207713_1002174
375 Ga0207710_10056547
376 Ga0207710_10300637
377 Ga0207647_10021662
378 Ga0207647_10279321
379 Ga0207705_10000023
380 Ga0207705_10121681
381 Ga0207695_10122380
382 Ga0207695_10376646
383 Ga0207657_10671974
384 Ga0207652_10100477
385 Ga0207646_10374605
386 Ga0207681_10492691
387 Ga0207650_10000986
388 Ga0207650_10212472
389 Ga0207650_10655618
390 Ga0207644_10000003
391 Ga0207711_10000017
392 Ga0207711_10395673
393 Ga0207711_10610398
394 Ga0207667_10007877
395 Ga0207667_10027058
396 Ga0207712_10000222
397 Ga0207712_10105145
398 Ga0207640_10000394
399 Ga0207640_10151113
400 Ga0207640_10573424
401 Ga0207658_10000133
402 Ga0207658_10020195
403 Ga0207658_10080733
404 Ga0207703_10001872
405 Ga0207703_10014902
406 Ga0207703_10051383
407 Ga0207703_10106464
408 Ga0207639_10043456
409 Ga0207702_10032993
410 Ga0207641_10000022
411 Ga0207641_10000338
412 Ga0207676_10000056
413 Ga0207676_10009602
414 Ga0207676_10034270
415 Ga0207676_10285912
416 Ga0207674_10138565
417 Ga0207698_10000141
418 Ga0207698_10662339
419 Ga0209984_1033500
420 Ga0209813_10000013
421 Ga0209974_10003563
422 Ga0207428_10039937
423 Ga0268266_10005666
424 Ga0268266_10134871
425 Ga0268265_10000044
426 Ga0268265_10015867
427 Ga0268264_10000078
428 Ga0268264_10045468
429 Ga0268264_10244186
430 Ga0265331_10149618
431 Ga0307408_101081247
432 Ga0316575_10009101
433 Ga0307413_10074869
434 Ga0307410_10031686
435 Ga0307406_10190107
436 Ga0307407_10081816
437 Ga0307412_10276500
438 Ga0307409_100048419
439 Ga0307416_100659048
440 Ga0307414_10391550
441 Ga0307414_10640635
442 Ga0307411_10143976
443 Ga0307415_100566449
444 Ga0307415_100631633
445 Ga0373943_0360165
446 Ga0436364_0323187
447 Ga0451807_2691360
448 Ga0451841_0265881
449 Ga0451853_1261340
450 Ga0439449_0090972
451 Ga0451577_0174541
452 Ga0453684_0274345
453 Ga0495643_0044969
454 Ga0495643_0061141
455 Ga0495648_0235843
456 Ga0495597_0004884
457 Ga0495668_0026948
458 Ga0495668_0112414
459 Ga0495625_0039651
460 Ga0495625_0085542
461 Ga0495669_0007355
462 Ga0495686_0125800
463 Ga0495686_0364714
464 Ga0496100_0035892
465 Ga0496101_0098529
466 Ga0496102_0022193
467 Ga0496103_0041614
468 Ga0496103_0292779
469 Ga0496104_0063192
470 Ga0496104_0188322
471 Ga0496105_0000751
472 Ga0496106_0000675
473 Ga0496107_0084944
474 Ga0496108_0218428
475 Ga0496109_0844860
476 Ga0496110_0763441
477 Ga0496113_0007065
478 Ga0496114_0278297
479 Ga0496117_0010298
480 Ga0496118_0121287
481 Ga0496121_0000312
482 Ga0496121_0273269
483 Ga0496121_0424653
484 Ga0496124_0193885
485 Ga0496126_0006683
486 Ga0496126_0252343
487 Ga0501306_036647
488 Ga0495682_0034100
489 Ga0501224_043861
490 Ga0501249_004939
491 nmdc:mga03683_21552_c1
492 nmdc:mga03683_27484_c1
493 nmdc:mga03683_69_c1
494 nmdc:mga03n38_191967_c1
495 nmdc:mga03n38_4399_c1
496 nmdc:mga00v17_51167_c1
497 nmdc:mga00v17_5572_c1
498 nmdc:mga00v17_83730_c1
499 nmdc:mga0yw44_204881_c1
500 nmdc:mga0k408_161310_c1
501 nmdc:mga0k408_173706_c1
502 nmdc:mga0k408_29073_c1
503 nmdc:mga0k408_427700_c1
504 nmdc:mga0k408_45_c1
505 nmdc:mga0k408_78863_c1
506 nmdc:mga06z11_49_c1
507 nmdc:mga06z11_50141_c1
508 nmdc:mga04h51_144_c1
509 nmdc:mga07m45_16_c1
510 nmdc:mga07m45_2530_c1
511 nmdc:mga07m45_39_c1
512 nmdc:mga07m45_457601_c1
513 nmdc:mga05p37_903506_c1
514 nmdc:mga08x19_59191_c1
515 nmdc:mga0sz30_1654_c1
516 nmdc:mga0sz30_28070_c1
517 nmdc:mga0sz30_638_c1
518 Ga0500643_000001
519 Ga0500643_018506
520 Ga0500647_0085432
521 Ga0500647_0224771
522 Ga0500651_0003043
523 Ga0500555_058458
524 Ga0500592_003033
525 Ga0500607_000130
526 Ga0500607_000442
527 Ga0500607_214362
528 Ga0500608_015933
529 Ga0500642_0004860
530 Ga0500655_000139
531 Ga0500559_0000453
532 Ga0500559_0004221
533 Ga0500559_0092460
534 Ga0500564_018889
535 Ga0500573_0030596
536 Ga0500590_000339
537 Ga0500616_0001875
538 Ga0500622_0002280
539 Ga0500636_0112618
540 Ga0500636_0228882
541 Ga0500637_0002790
542 Ga0500567_000268
543 Ga0500570_001706
544 Ga0500625_000041
545 Ga0500645_008197
546 Ga0500645_022157
547 Ga0500645_031440
548 2585260078
549 2739650390
550 2740028863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

103

207

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v6y-assembly1.cif.gz_A structure of the mit domain from a s. solfataricus vps4-like atpase 0.6326 30 136
2v6y-assembly1.cif.gz_A structure of the mit domain from a s. solfataricus vps4-like atpase 0.6193 30 136
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.5414 26 132
4zlw-assembly1.cif.gz_B crystal structure of the pmftn variant e130a soaked in iron (overnight) 0.5228 48 144
4zmc-assembly1.cif.gz_C crystal structure of the pmftn variant e130a soaked in iron (5 min) 0.5201 44 144
ID Description Score Start End Superfamily
2v6yA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6326 30 136 1.20.58.80
2v6yA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.6193 30 136 1.20.58.80
af_Q99PA5_49_164_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5498 33 144 1.20.140.150
af_P0AAM1_1_207_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5468 26 133 1.20.950.20
af_A0A0R0GA89_473_615_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5431 32 152 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A383EIT8-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9339 33 139 GO:0016020
AF-A0A7C3LS60-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.8941 33 129 GO:0016020
AF-A0A2E8KV25-F1-model_v4 Antitermination protein NusG 0.8929 33 151 GO:0016020
AF-A0A521S3S7-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.8918 33 145 GO:0016020
AF-A0A2V7IND0-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.8856 33 146 GO:0016020

Map