F380712

General Info

Members Datasets Scaffolds Average Seq Length
275 213 550 113

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0367778|Ga0501039_0367778_442_792
Length 116
Sequence VSFERACALSDVPEDEALAVTLGAQDVAVARHGDEVFAVEDVCSHANVPLSEGEVEDCTVECWLHGSRFDLRTGKPTGLPATEPVATFPVEVRTNADGTNDVYVDITTTLNGVTPQ

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
91 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
111 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
112 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
113 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
114 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
120 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
121 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
122 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
123 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
204 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2643221679 Angustibacter sp. Root456 Isolate Unclassified
213 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.82
Metatranscriptomes 21.45
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.82
Nodule 0
Rhizoplane 8.73
Rhizosphere 81.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0367778 3300049575 Bacteria 1130
2 Ga0006778J45830_1006628 3300003162 Bacteria 4308
3 Ga0006777J48905_1005367 3300003308 Bacteria 2765
4 Ga0070658_10000603 3300005327 Bacteria 31119
5 Ga0070658_10654409 3300005327 Bacteria 911
6 Ga0070683_100898601 3300005329 Bacteria 849
7 Ga0070680_100000622 3300005336 Bacteria 24598
8 Ga0070675_101257527 3300005354 Bacteria 682
9 Ga0070714_100463741 3300005435 Bacteria 1205
10 Ga0070713_100367048 3300005436 Bacteria 1338
11 Ga0070711_100957707 3300005439 Bacteria 733
12 Ga0070711_101699536 3300005439 Bacteria 553
13 Ga0070700_101940635 3300005441 Bacteria 510
14 Ga0070678_101066056 3300005456 Bacteria 745
15 Ga0070678_102255373 3300005456 Bacteria 517
16 Ga0070678_102343862 3300005456 Bacteria 507
17 Ga0070681_10000561 3300005458 Bacteria 30603
18 Ga0070679_100000912 3300005530 Bacteria 25636
19 Ga0070686_100560390 3300005544 Bacteria 895
20 Ga0070695_101905230 3300005545 Bacteria 500
21 Ga0070696_100009640 3300005546 Bacteria 6458
22 Ga0070693_101488517 3300005547 Bacteria 529
23 Ga0070665_100207868 3300005548 Bacteria 1958
24 Ga0068855_101039656 3300005563 Bacteria 859
25 Ga0070664_101591326 3300005564 Bacteria 619
26 Ga0068856_100542159 3300005614 Bacteria 1184
27 Ga0068852_100245576 3300005616 Bacteria 1713
28 Ga0068852_100446844 3300005616 Bacteria 1279
29 Ga0068859_101983382 3300005617 Bacteria 643
30 Ga0068859_102020121 3300005617 Bacteria 637
31 Ga0068861_100712243 3300005719 Bacteria 934
32 Ga0068862_101902683 3300005844 Bacteria 605
33 Ga0081455_10000530 3300005937 Bacteria 49483
34 Ga0081540_1006583 3300005983 Bacteria 8431
35 Ga0081539_10004861 3300005985 Bacteria 14369
36 Ga0070717_10851713 3300006028 Bacteria 829
37 Ga0075365_10060708 3300006038 Bacteria 2523
38 Ga0075365_10656178 3300006038 Bacteria 741
39 Ga0075365_10704113 3300006038 Bacteria 713
40 Ga0075368_10010467 3300006042 Bacteria 3352
41 Ga0075363_100026961 3300006048 Bacteria 2943
42 Ga0070712_100606756 3300006175 Bacteria 927
43 Ga0075367_10004589 3300006178 Bacteria 6759
44 Ga0068865_102008963 3300006881 Bacteria 525
45 Ga0097620_101983276 3300006931 Bacteria 643
46 Ga0097620_102020050 3300006931 Bacteria 637
47 Ga0105240_11267099 3300009093 Bacteria 779
48 Ga0105245_10025570 3300009098 Bacteria 5193
49 Ga0105245_10867375 3300009098 Bacteria 943
50 Ga0105247_10201101 3300009101 Bacteria 1339
51 Ga0105243_11038185 3300009148 Bacteria 824
52 Ga0105248_10083851 3300009177 Bacteria 3585
53 Ga0105237_11325817 3300009545 Bacteria 726
54 Ga0105238_10307192 3300009551 Bacteria 1571
55 Ga0105249_10166902 3300009553 Bacteria 2132
56 Ga0105239_11830519 3300010375 Bacteria 704
57 Ga0105246_10447708 3300011119 Bacteria 1084
58 Ga0157370_10365495 3300013104 Bacteria 1330
59 Ga0157369_10028010 3300013105 Bacteria 6240
60 Ga0157369_10392003 3300013105 Bacteria 1441
61 Ga0157374_11278917 3300013296 Bacteria 755
62 Ga0163162_10436719 3300013306 Bacteria 1441
63 Ga0157375_10318976 3300013308 Bacteria 1718
64 Ga0157375_11297618 3300013308 Bacteria 856
65 Ga0163163_10330089 3300014325 Bacteria 1580
66 Ga0163163_10737436 3300014325 Bacteria 1049
67 Ga0157380_10564345 3300014326 Bacteria 1119
68 Ga0157380_13137001 3300014326 Bacteria 527
69 Ga0157377_11068884 3300014745 Bacteria 616
70 Ga0163161_10571899 3300017792 Bacteria 928
71 Ga0197907_10307493 3300020069 Bacteria 6708
72 Ga0197907_10525440 3300020069 Bacteria 574
73 Ga0197907_11232331 3300020069 Bacteria 594
74 Ga0206356_10218910 3300020070 Bacteria 5744
75 Ga0206356_10676702 3300020070 Bacteria 504
76 Ga0206355_1234936 3300020076 Bacteria 1119
77 Ga0206351_10828683 3300020077 Bacteria 5869
78 Ga0206352_10584478 3300020078 Bacteria 1587
79 Ga0206354_10566456 3300020081 Bacteria 10006
80 Ga0206353_10548237 3300020082 Bacteria 25106
81 Ga0224712_10016051 3300022467 Bacteria 2450
82 Ga0224712_10215819 3300022467 Bacteria 877
83 Ga0207699_10565292 3300025906 Bacteria 826
84 Ga0207705_10000656 3300025909 Bacteria 28823
85 Ga0207707_10000151 3300025912 Bacteria 72718
86 Ga0207707_10560605 3300025912 Bacteria 970
87 Ga0207693_10436184 3300025915 Bacteria 1024
88 Ga0207660_10000490 3300025917 Bacteria 26377
89 Ga0207660_11066177 3300025917 Bacteria 659
90 Ga0207657_10684706 3300025919 Bacteria 797
91 Ga0207652_10000244 3300025921 Bacteria 56728
92 Ga0207681_11331414 3300025923 Bacteria 603
93 Ga0207694_10292821 3300025924 Bacteria 1339
94 Ga0207659_10997244 3300025926 Bacteria 721
95 Ga0207687_10060714 3300025927 Bacteria 2667
96 Ga0207687_10770360 3300025927 Bacteria 819
97 Ga0207704_11504807 3300025938 Bacteria 578
98 Ga0207711_10062125 3300025941 Bacteria 3222
99 Ga0207689_10082999 3300025942 Bacteria 2635
100 Ga0207661_10900876 3300025944 Bacteria 815
101 Ga0207679_10262368 3300025945 Bacteria 1474
102 Ga0207667_11783779 3300025949 Bacteria 580
103 Ga0207712_11091443 3300025961 Bacteria 710
104 Ga0207658_10336404 3300025986 Bacteria 1311
105 Ga0207677_10274007 3300026023 Bacteria 1382
106 Ga0207708_11412847 3300026075 Bacteria 611
107 Ga0207702_10450744 3300026078 Bacteria 1248
108 Ga0207674_10718445 3300026116 Bacteria 964
109 Ga0207698_10109543 3300026142 Bacteria 2311
110 Ga0207698_11092692 3300026142 Bacteria 810
111 Ga0268266_10144420 3300028379 Bacteria 2138
112 Ga0316176_1027527 3300030732 Bacteria 883
113 Ga0314311_1110028 3300030733 Bacteria 1611
114 Ga0307513_10000009 3300031456 Bacteria 403893
115 Ga0307513_10001072 3300031456 Bacteria 39827
116 Ga0307516_10654140 3300031730 Bacteria 706
117 Ga0307405_10576100 3300031731 Bacteria 915
118 Ga0307413_11115365 3300031824 Bacteria 682
119 Ga0307406_10846282 3300031901 Bacteria 775
120 Ga0307407_11402547 3300031903 Bacteria 550
121 Ga0307416_100451451 3300032002 Bacteria 1338
122 Ga0307411_11228328 3300032005 Bacteria 680
123 Ga0373960_0186245 3300035121 Bacteria 727
124 Ga0373931_0900909 3300035691 Bacteria 594
125 Ga0373935_1081518 3300035692 Bacteria 597
126 Ga0373925_0558577 3300037068 Bacteria 942
127 Ga0395900_0576307 3300037418 Bacteria 1068
128 Ga0395898_0453110 3300037466 Bacteria 1222
129 Ga0395898_0504415 3300037466 Bacteria 1151
130 Ga0395901_0219555 3300038443 Bacteria 1987
131 Ga0395901_0346514 3300038443 Bacteria 1534
132 Ga0436363_0388404 3300039450 Bacteria 1203
133 Ga0439436_0013952 3300041404 Bacteria 2428
134 Ga0439438_020433 3300041405 Bacteria 1858
135 Ga0439439_0035971 3300041406 Bacteria 1273
136 Ga0451789_0256206 3300041443 Bacteria 549
137 Ga0451791_0597168 3300041451 Bacteria 1669
138 Ga0451793_1864782 3300041452 Bacteria 996
139 Ga0451797_1255245 3300041453 Bacteria 733
140 Ga0451807_1266488 3300041486 Bacteria 540
141 Ga0451835_1128071 3300041492 Bacteria 620
142 Ga0451841_0174244 3300041498 Bacteria 770
143 Ga0451853_1616989 3300041512 Bacteria 827
144 Ga0451853_3404156 3300041512 Bacteria 2198
145 Ga0439433_0016019 3300041999 Bacteria 1658
146 Ga0439449_0004393 3300042007 Bacteria 5437
147 Ga0439449_0165633 3300042007 Bacteria 825
148 Ga0439457_003148 3300042014 Bacteria 4554
149 Ga0439457_008982 3300042014 Bacteria 2338
150 Ga0450906_038865 3300042145 Bacteria 840
151 Ga0450907_006750 3300042146 Bacteria 1917
152 Ga0466966_0128052 3300044684 Bacteria 1556
153 Ga0466961_0344164 3300044693 Bacteria 908
154 Ga0466963_1200602 3300044694 Bacteria 533
155 Ga0466971_0121704 3300044719 Bacteria 1208
156 Ga0466970_0192686 3300044765 Bacteria 1133
157 Ga0466970_0377841 3300044765 Bacteria 806
158 Ga0466957_0121992 3300044842 Bacteria 1662
159 Ga0466960_0117862 3300044901 Bacteria 1387
160 Ga0466960_0151480 3300044901 Bacteria 1239
161 Ga0466960_0273832 3300044901 Bacteria 944
162 Ga0466959_0077967 3300045049 Bacteria 2390
163 Ga0466959_0209972 3300045049 Bacteria 1353
164 Ga0466958_0017034 3300045836 Bacteria 4194
165 Ga0466958_0238791 3300045836 Bacteria 1161
166 Ga0466958_0345121 3300045836 Bacteria 958
167 Ga0466967_0129085 3300045976 Bacteria 2345
168 Ga0495603_0705265 3300046455 Bacteria 577
169 Ga0495641_0404901 3300046461 Bacteria 619
170 Ga0495582_0353190 3300046473 Bacteria 847
171 Ga0495639_0504309 3300046475 Bacteria 618
172 Ga0495608_0098398 3300046511 Bacteria 1888
173 Ga0495628_0152759 3300046516 Bacteria 1758
174 Ga0495588_0129016 3300046674 Bacteria 1334
175 Ga0495657_0183263 3300046675 Bacteria 1284
176 Ga0495676_0689325 3300047321 Bacteria 661
177 Ga0495680_0732982 3300047322 Bacteria 650
178 Ga0495593_0317655 3300047673 Bacteria 779
179 Ga0495593_0665744 3300047673 Bacteria 523
180 Ga0495602_0314680 3300048088 Bacteria 1141
181 Ga0496100_0069231 3300048903 Bacteria 2349
182 Ga0496100_0651691 3300048903 Bacteria 820
183 Ga0496100_1025530 3300048903 Bacteria 649
184 Ga0496101_0667363 3300048904 Bacteria 821
185 Ga0496102_0239793 3300048905 Bacteria 1710
186 Ga0496102_1377078 3300048905 Bacteria 624
187 Ga0496104_0804988 3300048907 Bacteria 846
188 Ga0496105_0421395 3300048908 Bacteria 1057
189 Ga0496106_0110887 3300048909 Bacteria 2136
190 Ga0496106_0964751 3300048909 Bacteria 671
191 Ga0496107_0371666 3300048910 Bacteria 1063
192 Ga0496107_0465267 3300048910 Bacteria 939
193 Ga0496108_1172103 3300048911 Bacteria 651
194 Ga0496109_0392623 3300048912 Bacteria 1311
195 Ga0496113_0255470 3300048916 Bacteria 1400
196 Ga0496114_0895002 3300048917 Bacteria 769
197 Ga0496114_0997438 3300048917 Bacteria 721
198 Ga0496115_0059454 3300048918 Bacteria 3078
199 Ga0496115_0942234 3300048918 Bacteria 663
200 Ga0496119_0149732 3300048922 Bacteria 1252
201 Ga0496125_0243865 3300048928 Bacteria 1139
202 Ga0501306_010895 3300049127 Bacteria 1151
203 Ga0501306_047039 3300049127 Bacteria 683
204 Ga0501309_001754 3300049129 Bacteria 2210
205 Ga0501309_004557 3300049129 Bacteria 1620
206 Ga0501310_005714 3300049130 Bacteria 1284
207 Ga0501304_008384 3300049160 Bacteria 870
208 Ga0501305_002043 3300049161 Bacteria 2110
209 Ga0501305_010222 3300049161 Bacteria 1249
210 Ga0501307_031766 3300049162 Bacteria 735
211 Ga0501311_014578 3300049527 Bacteria 1005
212 Ga0501311_017766 3300049527 Bacteria 939
213 Ga0501312_004514 3300049528 Bacteria 1646
214 Ga0501313_022556 3300049529 Bacteria 785
215 Ga0501314_007449 3300049530 Bacteria 971
216 Ga0501315_021366 3300049531 Bacteria 875
217 Ga0501316_023535 3300049532 Bacteria 791
218 Ga0501316_035787 3300049532 Bacteria 679
219 Ga0501317_001375 3300049533 Bacteria 2090
220 Ga0501317_002843 3300049533 Bacteria 1675
221 Ga0501317_064074 3300049533 Bacteria 608
222 Ga0501317_080180 3300049533 Bacteria 564
223 Ga0501318_000347 3300049534 Bacteria 2795
224 Ga0501318_001079 3300049534 Bacteria 2021
225 Ga0501318_073998 3300049534 Bacteria 542
226 Ga0501318_074455 3300049534 Bacteria 541
227 Ga0501320_020483 3300049536 Bacteria 762
228 Ga0501321_000218 3300049537 Bacteria 3291
229 Ga0501321_000583 3300049537 Bacteria 2434
230 Ga0501322_003188 3300049538 Bacteria 1052
231 Ga0501323_001780 3300049539 Bacteria 1985
232 Ga0501323_004966 3300049539 Bacteria 1434
233 Ga0501323_009188 3300049539 Bacteria 1161
234 Ga0501324_003295 3300049540 Bacteria 1231
235 Ga0501324_003355 3300049540 Bacteria 1225
236 Ga0501325_001999 3300049541 Bacteria 1343
237 Ga0501330_005600 3300049546 Bacteria 805
238 Ga0501333_003618 3300049549 Bacteria 948
239 Ga0501340_005127 3300049556 Bacteria 845
240 Ga0501031_0210300 3300049568 Bacteria 1268
241 Ga0501034_0197699 3300049571 Bacteria 1970
242 Ga0501034_1380139 3300049571 Bacteria 580
243 Ga0501040_0141216 3300049576 Bacteria 1697
244 Ga0501042_0184249 3300049578 Bacteria 1506
245 Ga0501070_0067432 3300049586 Bacteria 2963
246 Ga0501070_0614271 3300049586 Bacteria 866
247 Ga0501071_0127347 3300049587 Bacteria 1891
248 Ga0501072_0517991 3300049588 Bacteria 943
249 Ga0501074_1232305 3300049590 Bacteria 525
250 Ga0501075_0320080 3300049591 Bacteria 1182
251 Ga0501076_0394304 3300049592 Bacteria 1138
252 Ga0501079_0341037 3300049741 Bacteria 1174
253 Ga0501080_1641348 3300049742 Bacteria 543
254 Ga0501081_0415960 3300049743 Bacteria 996
255 Ga0501045_0213029 3300049824 Bacteria 1439
256 nmdc:mga03n38_3661_c1 3300050490 Bacteria 4970
257 nmdc:mga03n38_589951_c1 3300050490 Bacteria 632
258 nmdc:mga0yw44_126769_c1 3300050492 Bacteria 1649
259 nmdc:mga0yw44_234028_c1 3300050492 Bacteria 1220
260 nmdc:mga0yw44_60876_c1 3300050492 Bacteria 2314
261 nmdc:mga06z11_34864_c1 3300050494 Bacteria 2473
262 nmdc:mga04h51_2185_c1 3300050495 Bacteria 4591
263 Ga0500604_0014103 3300053151 Bacteria 2173
264 Ga0500616_0014026 3300053153 Bacteria 4621
265 Ga0500620_006137 3300053155 Bacteria 2850
266 Ga0587070_222046 3300059491 Bacteria 513
267 Ga0587090_001347 3300059510 Bacteria 2467
268 Ga0587101_009872 3300059623 Bacteria 1188
269 Ga0587122_019896 3300059628 Bacteria 722
270 Ga0587128_095798 3300059630 Bacteria 615
271 Ga0587068_162810 3300059641 Bacteria 511
272 Ga0587111_0008931 3300060346 Bacteria 1676
273 Ga0466962_0150031 3300061719 Bacteria 1131
274 2644445116 2643221679 Bacteria 3839507
275 8056059416 8056054917 Bacteria 5736694
276 Ga0501039_0367778
277 Ga0006778J45830_1006628
278 Ga0006777J48905_1005367
279 Ga0070658_10000603
280 Ga0070658_10654409
281 Ga0070683_100898601
282 Ga0070680_100000622
283 Ga0070675_101257527
284 Ga0070714_100463741
285 Ga0070713_100367048
286 Ga0070711_100957707
287 Ga0070711_101699536
288 Ga0070700_101940635
289 Ga0070678_101066056
290 Ga0070678_102255373
291 Ga0070678_102343862
292 Ga0070681_10000561
293 Ga0070679_100000912
294 Ga0070686_100560390
295 Ga0070695_101905230
296 Ga0070696_100009640
297 Ga0070693_101488517
298 Ga0070665_100207868
299 Ga0068855_101039656
300 Ga0070664_101591326
301 Ga0068856_100542159
302 Ga0068852_100245576
303 Ga0068852_100446844
304 Ga0068859_101983382
305 Ga0068859_102020121
306 Ga0068861_100712243
307 Ga0068862_101902683
308 Ga0081455_10000530
309 Ga0081540_1006583
310 Ga0081539_10004861
311 Ga0070717_10851713
312 Ga0075365_10060708
313 Ga0075365_10656178
314 Ga0075365_10704113
315 Ga0075368_10010467
316 Ga0075363_100026961
317 Ga0070712_100606756
318 Ga0075367_10004589
319 Ga0068865_102008963
320 Ga0097620_101983276
321 Ga0097620_102020050
322 Ga0105240_11267099
323 Ga0105245_10025570
324 Ga0105245_10867375
325 Ga0105247_10201101
326 Ga0105243_11038185
327 Ga0105248_10083851
328 Ga0105237_11325817
329 Ga0105238_10307192
330 Ga0105249_10166902
331 Ga0105239_11830519
332 Ga0105246_10447708
333 Ga0157370_10365495
334 Ga0157369_10028010
335 Ga0157369_10392003
336 Ga0157374_11278917
337 Ga0163162_10436719
338 Ga0157375_10318976
339 Ga0157375_11297618
340 Ga0163163_10330089
341 Ga0163163_10737436
342 Ga0157380_10564345
343 Ga0157380_13137001
344 Ga0157377_11068884
345 Ga0163161_10571899
346 Ga0197907_10307493
347 Ga0197907_10525440
348 Ga0197907_11232331
349 Ga0206356_10218910
350 Ga0206356_10676702
351 Ga0206355_1234936
352 Ga0206351_10828683
353 Ga0206352_10584478
354 Ga0206354_10566456
355 Ga0206353_10548237
356 Ga0224712_10016051
357 Ga0224712_10215819
358 Ga0207699_10565292
359 Ga0207705_10000656
360 Ga0207707_10000151
361 Ga0207707_10560605
362 Ga0207693_10436184
363 Ga0207660_10000490
364 Ga0207660_11066177
365 Ga0207657_10684706
366 Ga0207652_10000244
367 Ga0207681_11331414
368 Ga0207694_10292821
369 Ga0207659_10997244
370 Ga0207687_10060714
371 Ga0207687_10770360
372 Ga0207704_11504807
373 Ga0207711_10062125
374 Ga0207689_10082999
375 Ga0207661_10900876
376 Ga0207679_10262368
377 Ga0207667_11783779
378 Ga0207712_11091443
379 Ga0207658_10336404
380 Ga0207677_10274007
381 Ga0207708_11412847
382 Ga0207702_10450744
383 Ga0207674_10718445
384 Ga0207698_10109543
385 Ga0207698_11092692
386 Ga0268266_10144420
387 Ga0316176_1027527
388 Ga0314311_1110028
389 Ga0307513_10000009
390 Ga0307513_10001072
391 Ga0307516_10654140
392 Ga0307405_10576100
393 Ga0307413_11115365
394 Ga0307406_10846282
395 Ga0307407_11402547
396 Ga0307416_100451451
397 Ga0307411_11228328
398 Ga0373960_0186245
399 Ga0373931_0900909
400 Ga0373935_1081518
401 Ga0373925_0558577
402 Ga0395900_0576307
403 Ga0395898_0453110
404 Ga0395898_0504415
405 Ga0395901_0219555
406 Ga0395901_0346514
407 Ga0436363_0388404
408 Ga0439436_0013952
409 Ga0439438_020433
410 Ga0439439_0035971
411 Ga0451789_0256206
412 Ga0451791_0597168
413 Ga0451793_1864782
414 Ga0451797_1255245
415 Ga0451807_1266488
416 Ga0451835_1128071
417 Ga0451841_0174244
418 Ga0451853_1616989
419 Ga0451853_3404156
420 Ga0439433_0016019
421 Ga0439449_0004393
422 Ga0439449_0165633
423 Ga0439457_003148
424 Ga0439457_008982
425 Ga0450906_038865
426 Ga0450907_006750
427 Ga0466966_0128052
428 Ga0466961_0344164
429 Ga0466963_1200602
430 Ga0466971_0121704
431 Ga0466970_0192686
432 Ga0466970_0377841
433 Ga0466957_0121992
434 Ga0466960_0117862
435 Ga0466960_0151480
436 Ga0466960_0273832
437 Ga0466959_0077967
438 Ga0466959_0209972
439 Ga0466958_0017034
440 Ga0466958_0238791
441 Ga0466958_0345121
442 Ga0466967_0129085
443 Ga0495603_0705265
444 Ga0495641_0404901
445 Ga0495582_0353190
446 Ga0495639_0504309
447 Ga0495608_0098398
448 Ga0495628_0152759
449 Ga0495588_0129016
450 Ga0495657_0183263
451 Ga0495676_0689325
452 Ga0495680_0732982
453 Ga0495593_0317655
454 Ga0495593_0665744
455 Ga0495602_0314680
456 Ga0496100_0069231
457 Ga0496100_0651691
458 Ga0496100_1025530
459 Ga0496101_0667363
460 Ga0496102_0239793
461 Ga0496102_1377078
462 Ga0496104_0804988
463 Ga0496105_0421395
464 Ga0496106_0110887
465 Ga0496106_0964751
466 Ga0496107_0371666
467 Ga0496107_0465267
468 Ga0496108_1172103
469 Ga0496109_0392623
470 Ga0496113_0255470
471 Ga0496114_0895002
472 Ga0496114_0997438
473 Ga0496115_0059454
474 Ga0496115_0942234
475 Ga0496119_0149732
476 Ga0496125_0243865
477 Ga0501306_010895
478 Ga0501306_047039
479 Ga0501309_001754
480 Ga0501309_004557
481 Ga0501310_005714
482 Ga0501304_008384
483 Ga0501305_002043
484 Ga0501305_010222
485 Ga0501307_031766
486 Ga0501311_014578
487 Ga0501311_017766
488 Ga0501312_004514
489 Ga0501313_022556
490 Ga0501314_007449
491 Ga0501315_021366
492 Ga0501316_023535
493 Ga0501316_035787
494 Ga0501317_001375
495 Ga0501317_002843
496 Ga0501317_064074
497 Ga0501317_080180
498 Ga0501318_000347
499 Ga0501318_001079
500 Ga0501318_073998
501 Ga0501318_074455
502 Ga0501320_020483
503 Ga0501321_000218
504 Ga0501321_000583
505 Ga0501322_003188
506 Ga0501323_001780
507 Ga0501323_004966
508 Ga0501323_009188
509 Ga0501324_003295
510 Ga0501324_003355
511 Ga0501325_001999
512 Ga0501330_005600
513 Ga0501333_003618
514 Ga0501340_005127
515 Ga0501031_0210300
516 Ga0501034_0197699
517 Ga0501034_1380139
518 Ga0501040_0141216
519 Ga0501042_0184249
520 Ga0501070_0067432
521 Ga0501070_0614271
522 Ga0501071_0127347
523 Ga0501072_0517991
524 Ga0501074_1232305
525 Ga0501075_0320080
526 Ga0501076_0394304
527 Ga0501079_0341037
528 Ga0501080_1641348
529 Ga0501081_0415960
530 Ga0501045_0213029
531 nmdc:mga03n38_3661_c1
532 nmdc:mga03n38_589951_c1
533 nmdc:mga0yw44_126769_c1
534 nmdc:mga0yw44_234028_c1
535 nmdc:mga0yw44_60876_c1
536 nmdc:mga06z11_34864_c1
537 nmdc:mga04h51_2185_c1
538 Ga0500604_0014103
539 Ga0500616_0014026
540 Ga0500620_006137
541 Ga0587070_222046
542 Ga0587090_001347
543 Ga0587101_009872
544 Ga0587122_019896
545 Ga0587128_095798
546 Ga0587068_162810
547 Ga0587111_0008931
548 Ga0466962_0150031
549 2644445116
550 8056059416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

2

89

0.96

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

2

102

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bok-assembly1.cif.gz_A ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2 0.9548 7 107
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9539 4 107
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.9477 6 104
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.9477 6 104
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9451 4 107
ID Description Score Start End Superfamily
af_Q2FVL9_1_103_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9629 3 104 2.102.10.10
5bokA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9549 7 107 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9477 6 104 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9426 6 109 2.102.10.10
af_P0ABW0_1_105_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9386 5 110 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A522U2E6-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.9942 22 104 GO:0046872
GO:0051537
AF-A0A810MCA6-F1-model_v4 deleted 0.994 5 109
AF-A0A0Q7JMQ9-F1-model_v4 Rieske domain-containing protein 0.9931 5 109 GO:0046872
GO:0051537
AF-A0A0K1JJD0-F1-model_v4 Rieske domain-containing protein 0.9921 7 110 GO:0046872
GO:0051537
AF-A0A1Q7W041-F1-model_v4 2Fe-2S ferredoxin 0.9914 8 109 GO:0046872
GO:0051537

Map