F380679

General Info

Members Datasets Scaffolds Average Seq Length
275 159 550 390

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0068204|Ga0496105_0068204_564_1691
Length 375
Sequence LHHDWTKLQNLCTACRKPLLAVYDLERAGRALRHEELSTRAEKSLWRYRELLPVPIETAPVSLGEGGTPLLRAGTFGASLQMQDLRVKDESQNPTQSFKARGMSVAVSMAKHLGASKLVAPSAGNAASALAAYAARAGLEAHVFMPRDTPRANIIECRELGARVTLIDGLITDCAAEIGRRKENWFDVSTLKEPYRIEGKKTLGYELAEQLNWELPDVIIYPTGGGTGLIGMWKAFDEMEKLGWISQKRPRMFSVQAEGCAPIVRAFEAGENSAAEFPNAHTLAAGLRVPKAIGDFLILKILRQSNGGAIAVNDEEMIRIAAEVASSEGLFVAPEGAACFAALRSLLSSGKISRDESVVIFNTGSGIKYLDCYDS

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 5.45
Rhizosphere 93.82
Stem 0
Stem Tuber 0
Unclassified 14.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0068204 3300048908 Unclassified 2938
2 SwRhRL2b_contig_3644151 2162886007 Bacteria 2521
3 LJQas_1000021 3300000549 Bacteria 24296
4 JGI25406J46586_10000020 3300003203 Bacteria 86123
5 JGI25405J52794_10000328 3300003911 Bacteria 6572
6 Ga0065712_10000121 3300005290 Bacteria 103063
7 Ga0065715_10003886 3300005293 Bacteria 10812
8 Ga0065715_10164970 3300005293 Bacteria 1595
9 Ga0065707_10010036 3300005295 Bacteria 3001
10 Ga0070670_100072622 3300005331 Bacteria 2955
11 Ga0070670_100162020 3300005331 Bacteria 1938
12 Ga0068869_100103885 3300005334 Bacteria 2153
13 Ga0068869_100155740 3300005334 Unclassified 1775
14 Ga0070666_10028545 3300005335 Unclassified 3662
15 Ga0070680_100005089 3300005336 Bacteria 9921
16 Ga0070680_100041100 3300005336 Bacteria 3748
17 Ga0070682_100001372 3300005337 Bacteria 13759
18 Ga0070682_100001537 3300005337 Bacteria 12940
19 Ga0068868_100054528 3300005338 Unclassified 3151
20 Ga0070661_100065432 3300005344 Bacteria 2671
21 Ga0070692_10000272 3300005345 Bacteria 14480
22 Ga0070668_100073739 3300005347 Unclassified 2661
23 Ga0070669_100003573 3300005353 Bacteria 11224
24 Ga0070675_100034748 3300005354 Unclassified 4092
25 Ga0070675_100096435 3300005354 Unclassified 2484
26 Ga0070675_100110838 3300005354 Bacteria 2321
27 Ga0070675_100169912 3300005354 Unclassified 1880
28 Ga0070671_100131124 3300005355 Bacteria 2111
29 Ga0070674_100032630 3300005356 Unclassified 3459
30 Ga0070674_100093399 3300005356 Unclassified 2176
31 Ga0070673_100016296 3300005364 Bacteria 5251
32 Ga0070688_100009038 3300005365 Bacteria 5432
33 Ga0070688_100017428 3300005365 Bacteria 4122
34 Ga0070667_100036912 3300005367 Unclassified 4097
35 Ga0070703_10003457 3300005406 Bacteria 4504
36 Ga0070714_100046765 3300005435 Unclassified 3672
37 Ga0070705_100006910 3300005440 Bacteria 5574
38 Ga0070705_100161233 3300005440 Bacteria 1499
39 Ga0070700_100021198 3300005441 Bacteria 3775
40 Ga0070700_100032440 3300005441 Bacteria 3138
41 Ga0070694_100028489 3300005444 Bacteria 3635
42 Ga0070708_100000138 3300005445 Bacteria 49981
43 Ga0070708_100045026 3300005445 Bacteria 3885
44 Ga0070708_100045249 3300005445 Bacteria 3876
45 Ga0070708_100293762 3300005445 Bacteria 1530
46 Ga0070681_10001785 3300005458 Bacteria 19321
47 Ga0070681_10010783 3300005458 Bacteria 9031
48 Ga0070681_10033523 3300005458 Bacteria 5155
49 Ga0070681_10241361 3300005458 Bacteria 1720
50 Ga0068867_100012425 3300005459 Bacteria 6024
51 Ga0068867_100080905 3300005459 Bacteria 2448
52 Ga0070706_100000011 3300005467 Bacteria 198585
53 Ga0070706_100003255 3300005467 Bacteria 16057
54 Ga0070706_100073480 3300005467 Bacteria 3165
55 Ga0070706_100213334 3300005467 Bacteria 1802
56 Ga0070706_100252702 3300005467 Bacteria 1646
57 Ga0070707_100005658 3300005468 Bacteria 11673
58 Ga0070707_100061946 3300005468 Bacteria 3589
59 Ga0070698_100125383 3300005471 Bacteria 2525
60 Ga0070698_100190131 3300005471 Bacteria 1991
61 Ga0070699_100002708 3300005518 Bacteria 15795
62 Ga0070699_100017103 3300005518 Bacteria 6228
63 Ga0070679_100011054 3300005530 Bacteria 8586
64 Ga0070679_100012514 3300005530 Bacteria 8112
65 Ga0070679_100281240 3300005530 Bacteria 1616
66 Ga0070684_100005126 3300005535 Bacteria 10015
67 Ga0070684_100062796 3300005535 Unclassified 3254
68 Ga0070684_100070501 3300005535 Bacteria 3075
69 Ga0070697_100000014 3300005536 Bacteria 144589
70 Ga0070697_100007286 3300005536 Bacteria 8604
71 Ga0070697_100010867 3300005536 Bacteria 7109
72 Ga0070697_100015497 3300005536 Bacteria 5984
73 Ga0070697_100047038 3300005536 Bacteria 3499
74 Ga0070697_100065058 3300005536 Bacteria 2979
75 Ga0068853_100005469 3300005539 Bacteria 9953
76 Ga0070672_100012965 3300005543 Bacteria 5874
77 Ga0070686_100056263 3300005544 Bacteria 2522
78 Ga0070695_100050798 3300005545 Bacteria 2659
79 Ga0070695_100061206 3300005545 Bacteria 2442
80 Ga0070695_100160804 3300005545 Unclassified 1576
81 Ga0070696_100059399 3300005546 Bacteria 2672
82 Ga0070696_100166496 3300005546 Bacteria 1627
83 Ga0070693_100001535 3300005547 Bacteria 10422
84 Ga0070693_100032253 3300005547 Bacteria 2879
85 Ga0068855_100107038 3300005563 Bacteria 3213
86 Ga0070664_100002362 3300005564 Bacteria 15158
87 Ga0070664_100052634 3300005564 Bacteria 3448
88 Ga0070702_100023067 3300005615 Bacteria 3301
89 Ga0068859_100060427 3300005617 Bacteria 3819
90 Ga0068859_100199490 3300005617 Unclassified 2085
91 Ga0068864_100144676 3300005618 Bacteria 2148
92 Ga0068866_10145713 3300005718 Bacteria 1365
93 Ga0068863_100174937 3300005841 Unclassified 2060
94 Ga0068858_100020884 3300005842 Bacteria 6120
95 Ga0081455_10004706 3300005937 Bacteria 15174
96 Ga0081455_10157085 3300005937 Bacteria 1747
97 Ga0081539_10000052 3300005985 Bacteria 268240
98 Ga0081539_10008752 3300005985 Bacteria 8691
99 Ga0070717_10002855 3300006028 Bacteria 12253
100 Ga0070716_100002710 3300006173 Bacteria 8207
101 Ga0070712_100017842 3300006175 Bacteria 4598
102 Ga0068871_100067916 3300006358 Unclassified 2926
103 Ga0068871_100073785 3300006358 Bacteria 2814
104 Ga0075428_100157549 3300006844 Unclassified 2466
105 Ga0075428_100464625 3300006844 Bacteria 1355
106 Ga0075430_100000325 3300006846 Bacteria 34035
107 Ga0075430_100007319 3300006846 Bacteria 9320
108 Ga0075431_100007697 3300006847 Bacteria 10727
109 Ga0075429_100020716 3300006880 Bacteria 5708
110 Ga0068865_100001396 3300006881 Bacteria 14036
111 Ga0068865_100123682 3300006881 Bacteria 1928
112 Ga0075436_100000419 3300006914 Bacteria 27176
113 Ga0075436_100004756 3300006914 Bacteria 9318
114 Ga0075436_100069188 3300006914 Bacteria 2439
115 Ga0097620_100060427 3300006931 Bacteria 3819
116 Ga0097620_100199510 3300006931 Unclassified 2085
117 Ga0105240_10054251 3300009093 Bacteria 5024
118 Ga0111539_10022995 3300009094 Bacteria 7654
119 Ga0111539_10117625 3300009094 Bacteria 3115
120 Ga0111539_10149031 3300009094 Bacteria 2739
121 Ga0105245_10009283 3300009098 Bacteria 8576
122 Ga0105245_10017648 3300009098 Bacteria 6229
123 Ga0105247_10152836 3300009101 Bacteria 1522
124 Ga0114129_10005287 3300009147 Bacteria 18217
125 Ga0114129_10017602 3300009147 Bacteria 10173
126 Ga0114129_10028457 3300009147 Bacteria 7919
127 Ga0114129_10042510 3300009147 Bacteria 6400
128 Ga0114129_10048889 3300009147 Bacteria 5944
129 Ga0114129_10131840 3300009147 Bacteria 3431
130 Ga0114129_10721556 3300009147 Unclassified 1279
131 Ga0105248_10182619 3300009177 Bacteria 2364
132 Ga0105248_10214146 3300009177 Bacteria 2170
133 Ga0105237_10000015 3300009545 Bacteria 266079
134 Ga0105237_10000218 3300009545 Bacteria 80923
135 Ga0105238_10074079 3300009551 Bacteria 3398
136 Ga0105239_10013773 3300010375 Bacteria 8977
137 Ga0157369_10399785 3300013105 Bacteria 1425
138 Ga0157374_10062054 3300013296 Bacteria 3502
139 Ga0157378_10025984 3300013297 Bacteria 5160
140 Ga0157378_10068509 3300013297 Bacteria 3182
141 Ga0157378_10169644 3300013297 Bacteria 2046
142 Ga0157378_10233125 3300013297 Bacteria 1755
143 Ga0157378_10251354 3300013297 Bacteria 1692
144 Ga0157378_10252440 3300013297 Bacteria 1689
145 Ga0163162_10028401 3300013306 Bacteria 5535
146 Ga0157372_10034190 3300013307 Bacteria 5587
147 Ga0157372_10044404 3300013307 Unclassified 4924
148 Ga0157372_10097395 3300013307 Bacteria 3355
149 Ga0157372_10102355 3300013307 Unclassified 3272
150 Ga0157375_10006469 3300013308 Bacteria 10208
151 Ga0157375_10195061 3300013308 Bacteria 2180
152 Ga0157375_10318266 3300013308 Bacteria 1720
153 Ga0157375_10333748 3300013308 Bacteria 1681
154 Ga0163163_10145676 3300014325 Unclassified 2412
155 Ga0163163_10190052 3300014325 Bacteria 2102
156 Ga0157376_10024768 3300014969 Bacteria 4718
157 Ga0213872_10026012 3300021361 Unclassified 2688
158 Ga0207673_1006779 3300025290 Unclassified 1425
159 Ga0207697_10000512 3300025315 Bacteria 21885
160 Ga0207697_10003230 3300025315 Bacteria 8106
161 Ga0207653_10004349 3300025885 Bacteria 4447
162 Ga0207692_10025247 3300025898 Bacteria 2773
163 Ga0207688_10015615 3300025901 Bacteria 4118
164 Ga0207680_10162788 3300025903 Bacteria 1498
165 Ga0207645_10007795 3300025907 Bacteria 7533
166 Ga0207684_10000052 3300025910 Bacteria 228510
167 Ga0207684_10000316 3300025910 Bacteria 68606
168 Ga0207684_10000809 3300025910 Bacteria 36199
169 Ga0207684_10004590 3300025910 Bacteria 12981
170 Ga0207684_10006038 3300025910 Bacteria 11085
171 Ga0207684_10038467 3300025910 Bacteria 4059
172 Ga0207684_10165181 3300025910 Bacteria 1907
173 Ga0207684_10180034 3300025910 Bacteria 1823
174 Ga0207684_10228763 3300025910 Unclassified 1604
175 Ga0207707_10005605 3300025912 Bacteria 10984
176 Ga0207707_10006608 3300025912 Bacteria 10118
177 Ga0207707_10007690 3300025912 Bacteria 9387
178 Ga0207695_10000530 3300025913 Bacteria 80151
179 Ga0207671_10000007 3300025914 Bacteria 825758
180 Ga0207671_10016678 3300025914 Bacteria 5701
181 Ga0207660_10021274 3300025917 Bacteria 4361
182 Ga0207660_10048606 3300025917 Bacteria 3003
183 Ga0207660_10056048 3300025917 Bacteria 2819
184 Ga0207657_10075676 3300025919 Bacteria 2841
185 Ga0207652_10021983 3300025921 Bacteria 5270
186 Ga0207652_10047784 3300025921 Bacteria 3656
187 Ga0207646_10000951 3300025922 Bacteria 37284
188 Ga0207646_10020096 3300025922 Bacteria 6193
189 Ga0207646_10032401 3300025922 Bacteria 4730
190 Ga0207646_10090289 3300025922 Bacteria 2742
191 Ga0207646_10156377 3300025922 Bacteria 2056
192 Ga0207646_10280159 3300025922 Bacteria 1507
193 Ga0207681_10001479 3300025923 Bacteria 15144
194 Ga0207650_10025443 3300025925 Bacteria 4216
195 Ga0207650_10116822 3300025925 Bacteria 2072
196 Ga0207659_10086490 3300025926 Unclassified 2331
197 Ga0207644_10079878 3300025931 Unclassified 2414
198 Ga0207706_10001355 3300025933 Bacteria 24461
199 Ga0207706_10175281 3300025933 Unclassified 1884
200 Ga0207670_10008427 3300025936 Bacteria 5823
201 Ga0207670_10017763 3300025936 Bacteria 4307
202 Ga0207670_10119869 3300025936 Bacteria 1910
203 Ga0207704_10211318 3300025938 Bacteria 1428
204 Ga0207665_10000447 3300025939 Bacteria 28305
205 Ga0207665_10019192 3300025939 Unclassified 4492
206 Ga0207691_10000425 3300025940 Bacteria 41975
207 Ga0207711_10181351 3300025941 Bacteria 1915
208 Ga0207661_10003622 3300025944 Bacteria 10753
209 Ga0207661_10062194 3300025944 Unclassified 3020
210 Ga0207679_10004546 3300025945 Bacteria 8639
211 Ga0207679_10135338 3300025945 Bacteria 1983
212 Ga0207679_10194256 3300025945 Bacteria 1690
213 Ga0207651_10044290 3300025960 Bacteria 2977
214 Ga0207651_10102705 3300025960 Unclassified 2126
215 Ga0207677_10122273 3300026023 Bacteria 1960
216 Ga0207639_10206507 3300026041 Bacteria 1688
217 Ga0207678_10003331 3300026067 Bacteria 14485
218 Ga0207708_10027253 3300026075 Bacteria 4326
219 Ga0207708_10081760 3300026075 Bacteria 2483
220 Ga0207641_10055290 3300026088 Bacteria 3370
221 Ga0207648_10033644 3300026089 Bacteria 4521
222 Ga0207648_10097473 3300026089 Bacteria 2573
223 Ga0207674_10030969 3300026116 Bacteria 5623
224 Ga0207675_100106290 3300026118 Unclassified 2646
225 Ga0207675_100295297 3300026118 Bacteria 1577
226 Ga0207683_10016698 3300026121 Bacteria 6246
227 Ga0207428_10020128 3300027907 Bacteria 5675
228 Ga0207428_10076643 3300027907 Bacteria 2618
229 Ga0268265_10242360 3300028380 Bacteria 1592
230 Ga0307416_100185104 3300032002 Unclassified 1957
231 Ga0373941_0043793 3300035115 Bacteria 1394
232 Ga0373935_0033413 3300035692 Unclassified 3201
233 Ga0373947_0095098 3300035725 Bacteria 1864
234 Ga0373925_0144020 3300037068 Bacteria 1867
235 Ga0395901_0100395 3300038443 Bacteria 3035
236 Ga0436360_0140335 3300039438 Bacteria 1559
237 Ga0436361_0214246 3300039447 Bacteria 24648
238 Ga0439432_014922 3300042006 Bacteria 2626
239 Ga0439434_0008523 3300042435 Bacteria 3008
240 Ga0466964_0033533 3300044706 Bacteria 2046
241 Ga0495580_0035661 3300046472 Bacteria 3576
242 Ga0495645_0010072 3300046543 Bacteria 6623
243 Ga0495674_0291148 3300047319 Bacteria 1335
244 Ga0495602_0122522 3300048088 Bacteria 2089
245 Ga0496101_0067124 3300048904 Bacteria 2618
246 Ga0496102_0287140 3300048905 Bacteria 1551
247 Ga0496104_0064078 3300048907 Bacteria 3487
248 Ga0496104_0099035 3300048907 Unclassified 2791
249 Ga0496105_0013229 3300048908 Bacteria 6548
250 Ga0496106_0134610 3300048909 Unclassified 1940
251 Ga0496109_0092059 3300048912 Unclassified 2804
252 Ga0496109_0344562 3300048912 Bacteria 1407
253 Ga0496112_0036657 3300048915 Bacteria 4784
254 Ga0496112_0073889 3300048915 Bacteria 3370
255 Ga0496112_0427446 3300048915 Bacteria 1263
256 Ga0496113_0039306 3300048916 Bacteria 3482
257 Ga0496115_0047014 3300048918 Bacteria 3450
258 Ga0496115_0247214 3300048918 Bacteria 1469
259 Ga0501083_0094535 3300049744 Bacteria 1973
260 nmdc:mga05p37_157292_c1 3300050507 Bacteria 2777
261 nmdc:mga05p37_52798_c1 3300050507 Unclassified 4998
262 nmdc:mga09592_73767_c1 3300050508 Bacteria 2900
263 nmdc:mga0qj67_34586_c1 3300050509 Bacteria 3948
264 nmdc:mga0qj67_877_c1 3300050509 Bacteria 20625
265 nmdc:mga06r32_63451_c1 3300050510 Bacteria 3561
266 nmdc:mga08y16_8906_c1 3300050511 Bacteria 7963
267 nmdc:mga0n895_196065_c1 3300050512 Bacteria 2051
268 nmdc:mga0rr50_67206_c1 3300050513 Bacteria 2722
269 nmdc:mga08x19_101281_c1 3300050514 Bacteria 1912
270 nmdc:mga08x19_12320_c2 3300050514 Bacteria 2502
271 nmdc:mga08x19_34_c1 3300050514 Bacteria 196523
272 nmdc:mga0a205_228144_c1 3300050515 Bacteria 1746
273 Ga0495601_0019428 3300053077 Bacteria 4143
274 Ga0500556_0004401 3300053104 Bacteria 4013
275 Ga0500616_0001693 3300053153 Bacteria 20300
276 Ga0496105_0068204
277 SwRhRL2b_contig_3644151
278 LJQas_1000021
279 JGI25406J46586_10000020
280 JGI25405J52794_10000328
281 Ga0065712_10000121
282 Ga0065715_10003886
283 Ga0065715_10164970
284 Ga0065707_10010036
285 Ga0070670_100072622
286 Ga0070670_100162020
287 Ga0068869_100103885
288 Ga0068869_100155740
289 Ga0070666_10028545
290 Ga0070680_100005089
291 Ga0070680_100041100
292 Ga0070682_100001372
293 Ga0070682_100001537
294 Ga0068868_100054528
295 Ga0070661_100065432
296 Ga0070692_10000272
297 Ga0070668_100073739
298 Ga0070669_100003573
299 Ga0070675_100034748
300 Ga0070675_100096435
301 Ga0070675_100110838
302 Ga0070675_100169912
303 Ga0070671_100131124
304 Ga0070674_100032630
305 Ga0070674_100093399
306 Ga0070673_100016296
307 Ga0070688_100009038
308 Ga0070688_100017428
309 Ga0070667_100036912
310 Ga0070703_10003457
311 Ga0070714_100046765
312 Ga0070705_100006910
313 Ga0070705_100161233
314 Ga0070700_100021198
315 Ga0070700_100032440
316 Ga0070694_100028489
317 Ga0070708_100000138
318 Ga0070708_100045026
319 Ga0070708_100045249
320 Ga0070708_100293762
321 Ga0070681_10001785
322 Ga0070681_10010783
323 Ga0070681_10033523
324 Ga0070681_10241361
325 Ga0068867_100012425
326 Ga0068867_100080905
327 Ga0070706_100000011
328 Ga0070706_100003255
329 Ga0070706_100073480
330 Ga0070706_100213334
331 Ga0070706_100252702
332 Ga0070707_100005658
333 Ga0070707_100061946
334 Ga0070698_100125383
335 Ga0070698_100190131
336 Ga0070699_100002708
337 Ga0070699_100017103
338 Ga0070679_100011054
339 Ga0070679_100012514
340 Ga0070679_100281240
341 Ga0070684_100005126
342 Ga0070684_100062796
343 Ga0070684_100070501
344 Ga0070697_100000014
345 Ga0070697_100007286
346 Ga0070697_100010867
347 Ga0070697_100015497
348 Ga0070697_100047038
349 Ga0070697_100065058
350 Ga0068853_100005469
351 Ga0070672_100012965
352 Ga0070686_100056263
353 Ga0070695_100050798
354 Ga0070695_100061206
355 Ga0070695_100160804
356 Ga0070696_100059399
357 Ga0070696_100166496
358 Ga0070693_100001535
359 Ga0070693_100032253
360 Ga0068855_100107038
361 Ga0070664_100002362
362 Ga0070664_100052634
363 Ga0070702_100023067
364 Ga0068859_100060427
365 Ga0068859_100199490
366 Ga0068864_100144676
367 Ga0068866_10145713
368 Ga0068863_100174937
369 Ga0068858_100020884
370 Ga0081455_10004706
371 Ga0081455_10157085
372 Ga0081539_10000052
373 Ga0081539_10008752
374 Ga0070717_10002855
375 Ga0070716_100002710
376 Ga0070712_100017842
377 Ga0068871_100067916
378 Ga0068871_100073785
379 Ga0075428_100157549
380 Ga0075428_100464625
381 Ga0075430_100000325
382 Ga0075430_100007319
383 Ga0075431_100007697
384 Ga0075429_100020716
385 Ga0068865_100001396
386 Ga0068865_100123682
387 Ga0075436_100000419
388 Ga0075436_100004756
389 Ga0075436_100069188
390 Ga0097620_100060427
391 Ga0097620_100199510
392 Ga0105240_10054251
393 Ga0111539_10022995
394 Ga0111539_10117625
395 Ga0111539_10149031
396 Ga0105245_10009283
397 Ga0105245_10017648
398 Ga0105247_10152836
399 Ga0114129_10005287
400 Ga0114129_10017602
401 Ga0114129_10028457
402 Ga0114129_10042510
403 Ga0114129_10048889
404 Ga0114129_10131840
405 Ga0114129_10721556
406 Ga0105248_10182619
407 Ga0105248_10214146
408 Ga0105237_10000015
409 Ga0105237_10000218
410 Ga0105238_10074079
411 Ga0105239_10013773
412 Ga0157369_10399785
413 Ga0157374_10062054
414 Ga0157378_10025984
415 Ga0157378_10068509
416 Ga0157378_10169644
417 Ga0157378_10233125
418 Ga0157378_10251354
419 Ga0157378_10252440
420 Ga0163162_10028401
421 Ga0157372_10034190
422 Ga0157372_10044404
423 Ga0157372_10097395
424 Ga0157372_10102355
425 Ga0157375_10006469
426 Ga0157375_10195061
427 Ga0157375_10318266
428 Ga0157375_10333748
429 Ga0163163_10145676
430 Ga0163163_10190052
431 Ga0157376_10024768
432 Ga0213872_10026012
433 Ga0207673_1006779
434 Ga0207697_10000512
435 Ga0207697_10003230
436 Ga0207653_10004349
437 Ga0207692_10025247
438 Ga0207688_10015615
439 Ga0207680_10162788
440 Ga0207645_10007795
441 Ga0207684_10000052
442 Ga0207684_10000316
443 Ga0207684_10000809
444 Ga0207684_10004590
445 Ga0207684_10006038
446 Ga0207684_10038467
447 Ga0207684_10165181
448 Ga0207684_10180034
449 Ga0207684_10228763
450 Ga0207707_10005605
451 Ga0207707_10006608
452 Ga0207707_10007690
453 Ga0207695_10000530
454 Ga0207671_10000007
455 Ga0207671_10016678
456 Ga0207660_10021274
457 Ga0207660_10048606
458 Ga0207660_10056048
459 Ga0207657_10075676
460 Ga0207652_10021983
461 Ga0207652_10047784
462 Ga0207646_10000951
463 Ga0207646_10020096
464 Ga0207646_10032401
465 Ga0207646_10090289
466 Ga0207646_10156377
467 Ga0207646_10280159
468 Ga0207681_10001479
469 Ga0207650_10025443
470 Ga0207650_10116822
471 Ga0207659_10086490
472 Ga0207644_10079878
473 Ga0207706_10001355
474 Ga0207706_10175281
475 Ga0207670_10008427
476 Ga0207670_10017763
477 Ga0207670_10119869
478 Ga0207704_10211318
479 Ga0207665_10000447
480 Ga0207665_10019192
481 Ga0207691_10000425
482 Ga0207711_10181351
483 Ga0207661_10003622
484 Ga0207661_10062194
485 Ga0207679_10004546
486 Ga0207679_10135338
487 Ga0207679_10194256
488 Ga0207651_10044290
489 Ga0207651_10102705
490 Ga0207677_10122273
491 Ga0207639_10206507
492 Ga0207678_10003331
493 Ga0207708_10027253
494 Ga0207708_10081760
495 Ga0207641_10055290
496 Ga0207648_10033644
497 Ga0207648_10097473
498 Ga0207674_10030969
499 Ga0207675_100106290
500 Ga0207675_100295297
501 Ga0207683_10016698
502 Ga0207428_10020128
503 Ga0207428_10076643
504 Ga0268265_10242360
505 Ga0307416_100185104
506 Ga0373941_0043793
507 Ga0373935_0033413
508 Ga0373947_0095098
509 Ga0373925_0144020
510 Ga0395901_0100395
511 Ga0436360_0140335
512 Ga0436361_0214246
513 Ga0439432_014922
514 Ga0439434_0008523
515 Ga0466964_0033533
516 Ga0495580_0035661
517 Ga0495645_0010072
518 Ga0495674_0291148
519 Ga0495602_0122522
520 Ga0496101_0067124
521 Ga0496102_0287140
522 Ga0496104_0064078
523 Ga0496104_0099035
524 Ga0496105_0013229
525 Ga0496106_0134610
526 Ga0496109_0092059
527 Ga0496109_0344562
528 Ga0496112_0036657
529 Ga0496112_0073889
530 Ga0496112_0427446
531 Ga0496113_0039306
532 Ga0496115_0047014
533 Ga0496115_0247214
534 Ga0501083_0094535
535 nmdc:mga05p37_157292_c1
536 nmdc:mga05p37_52798_c1
537 nmdc:mga09592_73767_c1
538 nmdc:mga0qj67_34586_c1
539 nmdc:mga0qj67_877_c1
540 nmdc:mga06r32_63451_c1
541 nmdc:mga08y16_8906_c1
542 nmdc:mga0n895_196065_c1
543 nmdc:mga0rr50_67206_c1
544 nmdc:mga08x19_101281_c1
545 nmdc:mga08x19_12320_c2
546 nmdc:mga08x19_34_c1
547 nmdc:mga0a205_228144_c1
548 Ga0495601_0019428
549 Ga0500556_0004401
550 Ga0500616_0001693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

61

364

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2b-assembly2.cif.gz_C crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine 0.9131 13 354
2d1f-assembly1.cif.gz_B structure of mycobacterium tuberculosis threonine synthase 0.8744 34 357
2c2b-assembly2.cif.gz_C crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine 0.8743 13 354
6cgq-assembly1.cif.gz_B-2 threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.8695 35 357
2zsj-assembly2.cif.gz_C crystal structure of threonine synthase from aquifex aeolicus vf5 0.867 35 357
ID Description Score Start End Superfamily
af_Q86AP7_760_862_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9201 93 185 3.40.50.1100
1pwhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9105 95 185 3.40.50.1100
3x44B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9041 87 184 3.40.50.1100
af_A0A1D6M0B0_306_515_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9026 200 353 3.40.50.1100
5b1iC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8961 94 187 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A535BMY9-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9857 202 308
AF-A0A3N5QL49-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9748 1 317 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-A0A5S3VS92-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9688 102 198 GO:0004795
AF-A0A535BMY9-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9678 202 308
AF-A0A7S0D151-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9675 1 309 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
GO:0030170

Map