F380671

General Info

Members Datasets Scaffolds Average Seq Length
275 174 275 362

Family's Representative Sequence

Representative Sequence 3300047471|Ga0495684_0028669|Ga0495684_0028669_88_1398
Length 436
Sequence METRFSRRKLMQGVGAAALAQQVEPAHAQTARKWPIEEGPDTPKLCLAMGDAGVAMPAGMAAPAAQTPAGRGGGYGGTLAPRREAATSPFQRLRQLGVTHLLGVNVGSFPWQEENIRRTVETAKENGMVAYNSMINVPNSIIYGKDGRDKDLEMVIASIQAAGKAGLPVVEYNFYAHRAIEGYFEQVGRANSGYTGFDYDLELLIGENGAVVPGILRDDKGRLTPETLAANPGAKKVKFRDLPPLANEGAHNLDEMWKNVTYFLKAAVPAAEKAGVKLALHPNDPPAPVSRGSQQIMGTVAGWKHLVGIVDSPANGITFDCGVTREMGEDPVAVATYFAGRKRMNHCHYRNVFVERPYEKYSELFIDAGMVDMFGVMKALVKNKYTGTIYPEHPRALDYDRERGRIGGYPGGGGHTGITFSVAYARAMMQAALETV

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
105 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
123 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
124 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
147 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
148 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
151 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
168 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.64
Nodule 0
Rhizoplane 2.91
Rhizosphere 88
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10016888 3300005290 Bacteria 2690
2 Ga0065715_10210326 3300005293 Unclassified 1317
3 Ga0070690_100158078 3300005330 Unclassified 1551
4 Ga0070670_100006414 3300005331 Bacteria 9956
5 Ga0070670_100086357 3300005331 Bacteria 2696
6 Ga0070670_100292301 3300005331 Bacteria 1424
7 Ga0068869_100017371 3300005334 Bacteria 4874
8 Ga0068869_100142101 3300005334 Bacteria 1854
9 Ga0068868_100018137 3300005338 Bacteria 5255
10 Ga0070689_100339386 3300005340 Bacteria 1258
11 Ga0070669_100034763 3300005353 Bacteria 3648
12 Ga0070675_100068633 3300005354 Bacteria 2936
13 Ga0070671_100018519 3300005355 Bacteria 5657
14 Ga0070671_100052741 3300005355 Bacteria 3381
15 Ga0070674_100012855 3300005356 Bacteria 5153
16 Ga0070688_100033463 3300005365 Bacteria 3107
17 Ga0070667_100050977 3300005367 Bacteria 3488
18 Ga0070713_100008354 3300005436 Bacteria 7342
19 Ga0070713_100322096 3300005436 Unclassified 1428
20 Ga0070701_10031381 3300005438 Unclassified 2636
21 Ga0070708_100190549 3300005445 Unclassified 1918
22 Ga0070678_100040121 3300005456 Bacteria 3310
23 Ga0070678_100122865 3300005456 Bacteria 2050
24 Ga0070662_100102455 3300005457 Unclassified 2169
25 Ga0068867_100011734 3300005459 Bacteria 6188
26 Ga0068867_100017791 3300005459 Bacteria 5047
27 Ga0070685_10002775 3300005466 Bacteria 8958
28 Ga0070706_100197258 3300005467 Bacteria 1880
29 Ga0070707_100095482 3300005468 Unclassified 2879
30 Ga0070699_100122847 3300005518 Bacteria 2284
31 Ga0070699_100171117 3300005518 Bacteria 1925
32 Ga0070697_100018649 3300005536 Bacteria 5473
33 Ga0070672_100064610 3300005543 Bacteria 2892
34 Ga0070672_100078088 3300005543 Unclassified 2648
35 Ga0070686_100281935 3300005544 Unclassified 1226
36 Ga0070695_100077460 3300005545 Bacteria 2191
37 Ga0070665_100036759 3300005548 Bacteria 4925
38 Ga0070704_100036905 3300005549 Bacteria 3333
39 Ga0068855_100158776 3300005563 Bacteria 2568
40 Ga0068856_100004385 3300005614 Bacteria 14059
41 Ga0070702_100066619 3300005615 Bacteria 2112
42 Ga0068859_100039253 3300005617 Bacteria 4749
43 Ga0068859_100054668 3300005617 Bacteria 4016
44 Ga0068859_100073173 3300005617 Bacteria 3465
45 Ga0068864_100345485 3300005618 Unclassified 1403
46 Ga0068863_100086706 3300005841 Bacteria 2967
47 Ga0068858_100036329 3300005842 Bacteria 4568
48 Ga0068860_100042598 3300005843 Bacteria 4334
49 Ga0068862_100181425 3300005844 Bacteria 1890
50 Ga0081540_1059149 3300005983 Unclassified 1841
51 Ga0070717_10001106 3300006028 Bacteria 18168
52 Ga0075368_10025726 3300006042 Unclassified 2259
53 Ga0075363_100040403 3300006048 Bacteria 2459
54 Ga0070712_100050494 3300006175 Bacteria 2893
55 Ga0075367_10003567 3300006178 Bacteria 7446
56 Ga0075367_10040949 3300006178 Bacteria 2706
57 Ga0075367_10063964 3300006178 Bacteria 2200
58 Ga0075366_10002522 3300006195 Bacteria 9405
59 Ga0075366_10024842 3300006195 Unclassified 3495
60 Ga0075366_10043075 3300006195 Bacteria 2673
61 Ga0097621_100117973 3300006237 Bacteria 2249
62 Ga0075370_10003158 3300006353 Bacteria 7787
63 Ga0075370_10056503 3300006353 Unclassified 2231
64 Ga0068871_100251009 3300006358 Bacteria 1541
65 Ga0068871_100311625 3300006358 Unclassified 1384
66 Ga0075428_100000820 3300006844 Bacteria 32505
67 Ga0075428_100002625 3300006844 Bacteria 19558
68 Ga0075428_100055812 3300006844 Bacteria 4328
69 Ga0075428_100166118 3300006844 Bacteria 2394
70 Ga0075430_100004193 3300006846 Bacteria 12165
71 Ga0075430_100074551 3300006846 Bacteria 2845
72 Ga0075430_100096212 3300006846 Bacteria 2475
73 Ga0075431_100017776 3300006847 Bacteria 7229
74 Ga0075431_100106871 3300006847 Bacteria 2887
75 Ga0075431_100117525 3300006847 Bacteria 2744
76 Ga0075431_100151802 3300006847 Unclassified 2385
77 Ga0075431_100244817 3300006847 Unclassified 1823
78 Ga0075433_10042199 3300006852 Unclassified 3957
79 Ga0075433_10101166 3300006852 Unclassified 2552
80 Ga0075434_100111413 3300006871 Bacteria 2747
81 Ga0075434_100124856 3300006871 Bacteria 2591
82 Ga0075429_100001561 3300006880 Bacteria 18829
83 Ga0075429_100024377 3300006880 Bacteria 5249
84 Ga0075429_100043329 3300006880 Bacteria 3916
85 Ga0068865_100090931 3300006881 Bacteria 2214
86 Ga0097620_100039256 3300006931 Bacteria 4749
87 Ga0097620_100054667 3300006931 Bacteria 4016
88 Ga0097620_100073172 3300006931 Bacteria 3465
89 Ga0075435_100052602 3300007076 Bacteria 3282
90 Ga0111539_10000194 3300009094 Bacteria 71319
91 Ga0111539_10008937 3300009094 Bacteria 12685
92 Ga0111539_10012461 3300009094 Bacteria 10658
93 Ga0111539_10173835 3300009094 Bacteria 2516
94 Ga0105245_10057841 3300009098 Bacteria 3488
95 Ga0114129_10011551 3300009147 Bacteria 12575
96 Ga0114129_10035541 3300009147 Bacteria 7039
97 Ga0114129_10039797 3300009147 Bacteria 6631
98 Ga0114129_10166147 3300009147 Unclassified 3011
99 Ga0114129_10259989 3300009147 Bacteria 2327
100 Ga0114129_10524217 3300009147 Bacteria 1544
101 Ga0105243_10246694 3300009148 Unclassified 1592
102 Ga0105248_10015282 3300009177 Bacteria 8465
103 Ga0105248_10038796 3300009177 Bacteria 5332
104 Ga0105248_10113718 3300009177 Bacteria 3053
105 Ga0105238_10282789 3300009551 Unclassified 1640
106 Ga0157369_10327717 3300013105 Unclassified 1591
107 Ga0157372_10204997 3300013307 Unclassified 2285
108 Ga0157375_10168929 3300013308 Unclassified 2334
109 Ga0157380_10063679 3300014326 Bacteria 2957
110 Ga0157380_10178950 3300014326 Unclassified 1861
111 Ga0157380_10230202 3300014326 Bacteria 1664
112 Ga0157380_10519661 3300014326 Bacteria 1161
113 Ga0207697_10013026 3300025315 Bacteria 3474
114 Ga0207682_10064391 3300025893 Bacteria 1541
115 Ga0207688_10022349 3300025901 Bacteria 3461
116 Ga0207680_10065183 3300025903 Bacteria 2235
117 Ga0207699_10021497 3300025906 Bacteria 3479
118 Ga0207684_10008774 3300025910 Bacteria 8976
119 Ga0207693_10123887 3300025915 Bacteria 2031
120 Ga0207662_10002245 3300025918 Bacteria 9649
121 Ga0207681_10116434 3300025923 Bacteria 1953
122 Ga0207650_10016945 3300025925 Bacteria 5096
123 Ga0207650_10085145 3300025925 Bacteria 2404
124 Ga0207659_10066821 3300025926 Bacteria 2610
125 Ga0207700_10011058 3300025928 Bacteria 5736
126 Ga0207644_10225517 3300025931 Bacteria 1487
127 Ga0207706_10082535 3300025933 Bacteria 2825
128 Ga0207706_10147341 3300025933 Bacteria 2071
129 Ga0207686_10039400 3300025934 Unclassified 2867
130 Ga0207670_10085876 3300025936 Bacteria 2212
131 Ga0207669_10017494 3300025937 Bacteria 3679
132 Ga0207704_10051893 3300025938 Bacteria 2483
133 Ga0207691_10101749 3300025940 Unclassified 2563
134 Ga0207691_10115728 3300025940 Bacteria 2380
135 Ga0207689_10005144 3300025942 Bacteria 11758
136 Ga0207689_10127293 3300025942 Bacteria 2095
137 Ga0207661_10138557 3300025944 Bacteria 2092
138 Ga0207667_10176218 3300025949 Bacteria 2197
139 Ga0207651_10192180 3300025960 Bacteria 1629
140 Ga0207712_10279367 3300025961 Unclassified 1362
141 Ga0207678_10073546 3300026067 Bacteria 2929
142 Ga0207708_10061158 3300026075 Unclassified 2875
143 Ga0207641_10100753 3300026088 Bacteria 2544
144 Ga0207648_10001225 3300026089 Bacteria 28789
145 Ga0207674_10025686 3300026116 Bacteria 6272
146 Ga0207674_10153939 3300026116 Bacteria 2255
147 Ga0207675_100045375 3300026118 Bacteria 4106
148 Ga0207675_100115163 3300026118 Unclassified 2540
149 Ga0207683_10007869 3300026121 Bacteria 9119
150 Ga0207683_10050928 3300026121 Bacteria 3627
151 Ga0207683_10126086 3300026121 Bacteria 2301
152 Ga0207428_10000365 3300027907 Bacteria 58330
153 Ga0207428_10006575 3300027907 Bacteria 10714
154 Ga0207428_10009113 3300027907 Bacteria 8919
155 Ga0268265_10071959 3300028380 Bacteria 2695
156 Ga0268265_10079493 3300028380 Bacteria 2583
157 Ga0265338_10066837 3300028800 Unclassified 3108
158 Ga0265338_10068335 3300028800 Bacteria 3062
159 Ga0265339_10000582 3300031249 Bacteria 28512
160 Ga0307408_100012369 3300031548 Bacteria 5650
161 Ga0307408_100034630 3300031548 Unclassified 3538
162 Ga0316576_10003425 3300031727 Bacteria 9283
163 Ga0316578_10003292 3300031728 Bacteria 7350
164 Ga0316578_10037258 3300031728 Bacteria 2801
165 Ga0307405_10075268 3300031731 Unclassified 2186
166 Ga0307405_10266081 3300031731 Unclassified 1283
167 Ga0316577_10003504 3300031733 Bacteria 7938
168 Ga0307410_10106499 3300031852 Unclassified 2020
169 Ga0307406_10243523 3300031901 Unclassified 1350
170 Ga0307412_10083459 3300031911 Bacteria 2215
171 Ga0307412_10180345 3300031911 Bacteria 1588
172 Ga0307409_100263001 3300031995 Unclassified 1584
173 Ga0307416_100010128 3300032002 Bacteria 6212
174 Ga0307416_100316919 3300032002 Unclassified 1559
175 Ga0307415_100040544 3300032126 Unclassified 3085
176 Ga0373955_0031920 3300035172 Bacteria 2761
177 Ga0373937_0036707 3300036401 Bacteria 4466
178 Ga0316582_0019962 3300036647 Bacteria 3932
179 Ga0316584_0005500 3300036712 Bacteria 8509
180 Ga0436364_0376723 3300037853 Bacteria 1353
181 Ga0436364_1231341 3300037853 Bacteria 3767
182 Ga0436365_0335973 3300039437 Bacteria 5430
183 Ga0436365_0972728 3300039437 Bacteria 2408
184 Ga0436360_0926215 3300039438 Bacteria 2489
185 Ga0436361_0226782 3300039447 Bacteria 3939
186 Ga0450894_003360 3300042131 Bacteria 2092
187 Ga0439464_0000029 3300042439 Bacteria 18202
188 Ga0439460_0004636 3300042461 Bacteria 3356
189 Ga0451577_0216098 3300042876 Bacteria 1732
190 Ga0466966_0163005 3300044684 Bacteria 1357
191 Ga0453684_0004382 3300044712 Bacteria 29920
192 Ga0451576_0197409 3300045051 Bacteria 2102
193 Ga0495594_0089755 3300046499 Bacteria 1722
194 Ga0495618_0142323 3300046514 Unclassified 1534
195 Ga0495645_0019865 3300046543 Bacteria 4842
196 Ga0495623_0109442 3300046679 Unclassified 1676
197 Ga0495684_0028669 3300047471 Bacteria 4274
198 Ga0496104_0061973 3300048907 Bacteria 3546
199 Ga0496105_0023636 3300048908 Bacteria 4987
200 Ga0496108_0020964 3300048911 Bacteria 5372
201 Ga0496108_0471326 3300048911 Unclassified 1097
202 Ga0496109_0022277 3300048912 Bacteria 5611
203 Ga0496109_0163613 3300048912 Bacteria 2085
204 Ga0496110_0034047 3300048913 Bacteria 4410
205 Ga0496110_0235164 3300048913 Unclassified 1667
206 Ga0501300_005444 3300049523 Bacteria 1875
207 Ga0501038_0101644 3300049574 Bacteria 2393
208 Ga0501042_0100791 3300049578 Bacteria 2076
209 Ga0501047_0026957 3300049581 Bacteria 5533
210 Ga0501047_0168239 3300049581 Bacteria 2062
211 Ga0501047_0388018 3300049581 Unclassified 1230
212 Ga0501070_0020169 3300049586 Bacteria 5592
213 Ga0501071_0076602 3300049587 Unclassified 2443
214 Ga0501074_0034744 3300049590 Bacteria 3654
215 Ga0501216_026893 3300049660 Unclassified 1041
216 Ga0501217_004112 3300049661 Unclassified 2980
217 Ga0501225_0012302 3300049705 Unclassified 2404
218 Ga0501081_0064398 3300049743 Bacteria 2546
219 Ga0501265_005950 3300049762 Bacteria 1414
220 Ga0501273_005823 3300049770 Bacteria 1406
221 Ga0501044_0008058 3300049823 Bacteria 11571
222 Ga0501044_0020559 3300049823 Bacteria 7048
223 Ga0501044_0054604 3300049823 Unclassified 4105
224 Ga0501045_0009480 3300049824 Bacteria 6814
225 Ga0501045_0054232 3300049824 Bacteria 2931
226 Ga0501212_012965 3300049851 Unclassified 1218
227 nmdc:mga03n38_31623_c1 3300050490 Bacteria 2235
228 nmdc:mga00v17_97199_c1 3300050491 Bacteria 1856
229 nmdc:mga0k408_17915_c2 3300050493 Bacteria 3274
230 nmdc:mga0k408_20596_c1 3300050493 Bacteria 3697
231 nmdc:mga0k408_66040_c1 3300050493 Bacteria 2107
232 nmdc:mga06z11_11219_c1 3300050494 Bacteria 3854
233 nmdc:mga06z11_6581_c1 3300050494 Bacteria 4742
234 nmdc:mga07m45_30646_c1 3300050496 Bacteria 2980
235 nmdc:mga07m45_48267_c1 3300050496 Unclassified 2394
236 nmdc:mga05p37_167169_c1 3300050507 Bacteria 2684
237 nmdc:mga05p37_3923_c1 3300050507 Bacteria 17425
238 nmdc:mga05p37_73074_c1 3300050507 Unclassified 4220
239 nmdc:mga05p37_91842_c1 3300050507 Unclassified 3741
240 nmdc:mga09592_114181_c1 3300050508 Unclassified 2318
241 nmdc:mga09592_24095_c1 3300050508 Bacteria 5032
242 nmdc:mga09592_96448_c1 3300050508 Bacteria 2530
243 nmdc:mga0qj67_31566_c1 3300050509 Bacteria 4127
244 nmdc:mga0qj67_37213_c1 3300050509 Bacteria 3811
245 nmdc:mga0qj67_66457_c1 3300050509 Bacteria 2872
246 nmdc:mga0qj67_77419_c1 3300050509 Unclassified 2661
247 nmdc:mga06r32_144337_c1 3300050510 Bacteria 2357
248 nmdc:mga06r32_15456_c1 3300050510 Bacteria 6929
249 nmdc:mga06r32_192317_c1 3300050510 Bacteria 2028
250 nmdc:mga06r32_301114_c1 3300050510 Unclassified 1589
251 nmdc:mga06r32_46904_c1 3300050510 Bacteria 4125
252 nmdc:mga06r32_47672_c1 3300050510 Unclassified 4094
253 nmdc:mga06r32_52284_c1 3300050510 Bacteria 3912
254 nmdc:mga06r32_89991_c1 3300050510 Bacteria 2997
255 nmdc:mga08y16_12632_c1 3300050511 Bacteria 8883
256 nmdc:mga08y16_173511_c1 3300050511 Unclassified 2239
257 nmdc:mga08y16_2760_c1 3300050511 Bacteria 17993
258 nmdc:mga08y16_782_c1 3300050511 Bacteria 30382
259 nmdc:mga08y16_80671_c1 3300050511 Unclassified 3392
260 nmdc:mga0rr50_12123_c1 3300050513 Bacteria 5556
261 nmdc:mga0a205_112391_c1 3300050515 Unclassified 2623
262 nmdc:mga0a205_270053_c1 3300050515 Bacteria 1578
263 nmdc:mga0a205_5854_c1 3300050515 Bacteria 8468
264 nmdc:mga0a205_79919_c1 3300050515 Unclassified 3160
265 Ga0500641_0001175 3300053096 Bacteria 9344
266 Ga0500568_0006592 3300053139 Bacteria 5807
267 Ga0501084_0016040 3300054114 Bacteria 6218
268 Ga0501084_0459560 3300054114 Bacteria 1076
269 Ga0590071_001447 3300059421 Bacteria 6263
270 Ga0590074_004336 3300059423 Unclassified 2347
271 Ga0590075_002359 3300059424 Unclassified 4532
272 Ga0590075_014902 3300059424 Unclassified 1903
273 Ga0590077_000174 3300059426 Bacteria 18066
274 Ga0590077_002123 3300059426 Bacteria 4340
275 Ga0501082_0058891 3300060353 Bacteria 3310

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10166147 Ga0114129_101661472 298
2 3300014326 Ga0157380_10519661 Ga0157380_105196611 298
3 3300054114 Ga0501084_0459560 Ga0501084_0459560_130_1065 299
4 3300028800 Ga0265338_10068335 Ga0265338_100683351 306
5 3300049660 Ga0501216_026893 Ga0501216_026893_13_963 306
6 3300048911 Ga0496108_0471326 Ga0496108_0471326_23_1075 316
7 3300005331 Ga0070670_100006414 Ga0070670_1000064142 321
8 3300005340 Ga0070689_100339386 Ga0070689_1003393862 321
9 3300005353 Ga0070669_100034763 Ga0070669_1000347634 321
10 3300005355 Ga0070671_100052741 Ga0070671_1000527414 321
11 3300005365 Ga0070688_100033463 Ga0070688_1000334631 321
12 3300005456 Ga0070678_100122865 Ga0070678_1001228653 321
13 3300005459 Ga0068867_100017791 Ga0068867_1000177914 321
14 3300005466 Ga0070685_10002775 Ga0070685_100027757 321
15 3300005543 Ga0070672_100078088 Ga0070672_1000780882 321
16 3300006358 Ga0068871_100311625 Ga0068871_1003116252 321
17 3300009148 Ga0105243_10246694 Ga0105243_102466942 321
18 3300009177 Ga0105248_10015282 Ga0105248_100152822 321
19 3300009551 Ga0105238_10282789 Ga0105238_102827892 321
20 3300025923 Ga0207681_10116434 Ga0207681_101164341 321
21 3300025925 Ga0207650_10016945 Ga0207650_100169452 321
22 3300025931 Ga0207644_10225517 Ga0207644_102255172 321
23 3300025934 Ga0207686_10039400 Ga0207686_100394002 321
24 3300025940 Ga0207691_10101749 Ga0207691_101017492 321
25 3300025961 Ga0207712_10279367 Ga0207712_102793672 321
26 3300026088 Ga0207641_10100753 Ga0207641_101007533 321
27 3300026121 Ga0207683_10050928 Ga0207683_100509282 321
28 3300048907 Ga0496104_0061973 Ga0496104_0061973_2223_3218 321
29 3300048908 Ga0496105_0023636 Ga0496105_0023636_2528_3523 321
30 3300048911 Ga0496108_0020964 Ga0496108_0020964_755_1750 321
31 3300048912 Ga0496109_0022277 Ga0496109_0022277_3666_4661 321
32 3300048913 Ga0496110_0034047 Ga0496110_0034047_3324_4319 321
33 3300049587 Ga0501071_0076602 Ga0501071_0076602_1375_2373 322
34 3300049851 Ga0501212_012965 Ga0501212_012965_118_1116 322
35 3300050508 nmdc:mga09592_96448_c1 nmdc:mga09592_96448_c1_1195_2193 322
36 3300050509 nmdc:mga0qj67_66457_c1 nmdc:mga0qj67_66457_c1_669_1667 322
37 3300050510 nmdc:mga06r32_192317_c1 nmdc:mga06r32_192317_c1_38_1036 322
38 3300050510 nmdc:mga06r32_301114_c1 nmdc:mga06r32_301114_c1_467_1465 322
39 3300049590 Ga0501074_0034744 Ga0501074_0034744_2137_3138 323
40 3300049581 Ga0501047_0168239 Ga0501047_0168239_101_1120 327
41 3300049823 Ga0501044_0054604 Ga0501044_0054604_543_1562 327
42 3300009147 Ga0114129_10524217 Ga0114129_105242172 328
43 3300037853 Ga0436364_0376723 Ga0436364_0376723_171_1202 328
44 3300005356 Ga0070674_100012855 Ga0070674_1000128553 333
45 3300005518 Ga0070699_100171117 Ga0070699_1001711172 333
46 3300005563 Ga0068855_100158776 Ga0068855_1001587762 333
47 3300005614 Ga0068856_100004385 Ga0068856_10000438511 333
48 3300013105 Ga0157369_10327717 Ga0157369_103277172 333
49 3300013307 Ga0157372_10204997 Ga0157372_102049972 333
50 3300025937 Ga0207669_10017494 Ga0207669_100174941 333
51 3300025949 Ga0207667_10176218 Ga0207667_101762182 333
52 3300048913 Ga0496110_0235164 Ga0496110_0235164_233_1348 333
53 3300046514 Ga0495618_0142323 Ga0495618_0142323_36_1211 334
54 3300049581 Ga0501047_0388018 Ga0501047_0388018_133_1191 334
55 3300050494 nmdc:mga06z11_11219_c1 nmdc:mga06z11_11219_c1_2128_3231 337
56 3300053096 Ga0500641_0001175 Ga0500641_0001175_6178_7359 339
57 3300005548 Ga0070665_100036759 Ga0070665_1000367593 340
58 3300006195 Ga0075366_10002522 Ga0075366_100025222 340
59 3300006353 Ga0075370_10056503 Ga0075370_100565032 340
60 3300050493 nmdc:mga0k408_66040_c1 nmdc:mga0k408_66040_c1_420_1565 340
61 3300050496 nmdc:mga07m45_48267_c1 nmdc:mga07m45_48267_c1_391_1536 340
62 3300039437 Ga0436365_0972728 Ga0436365_0972728_500_1561 342
63 3300039438 Ga0436360_0926215 Ga0436360_0926215_499_1587 342
64 3300005331 Ga0070670_100086357 Ga0070670_1000863573 344
65 3300005354 Ga0070675_100068633 Ga0070675_1000686332 344
66 3300005543 Ga0070672_100064610 Ga0070672_1000646103 344
67 3300005618 Ga0068864_100345485 Ga0068864_1003454851 344
68 3300006042 Ga0075368_10025726 Ga0075368_100257262 344
69 3300025315 Ga0207697_10013026 Ga0207697_100130262 344
70 3300025901 Ga0207688_10022349 Ga0207688_100223493 344
71 3300025903 Ga0207680_10065183 Ga0207680_100651832 344
72 3300025925 Ga0207650_10085145 Ga0207650_100851452 344
73 3300025926 Ga0207659_10066821 Ga0207659_100668213 344
74 3300025944 Ga0207661_10138557 Ga0207661_101385572 344
75 3300025960 Ga0207651_10192180 Ga0207651_101921802 344
76 3300045051 Ga0451576_0197409 Ga0451576_0197409_271_1413 344
77 3300048912 Ga0496109_0163613 Ga0496109_0163613_398_1507 344
78 3300053139 Ga0500568_0006592 Ga0500568_0006592_4199_5344 345
79 3300050515 nmdc:mga0a205_79919_c1 nmdc:mga0a205_79919_c1_1387_2532 346
80 3300005617 Ga0068859_100054668 Ga0068859_1000546683 347
81 3300006931 Ga0097620_100054667 Ga0097620_1000546673 347
82 3300014326 Ga0157380_10178950 Ga0157380_101789502 347
83 3300042461 Ga0439460_0004636 Ga0439460_0004636_637_1713 347
84 3300050507 nmdc:mga05p37_91842_c1 nmdc:mga05p37_91842_c1_149_1222 347
85 3300050509 nmdc:mga0qj67_77419_c1 nmdc:mga0qj67_77419_c1_149_1222 347
86 3300042439 Ga0439464_0000029 Ga0439464_0000029_12366_13472 348
87 3300005334 Ga0068869_100142101 Ga0068869_1001421012 349
88 3300005983 Ga0081540_1059149 Ga0081540_10591493 349
89 3300006852 Ga0075433_10101166 Ga0075433_101011662 349
90 3300025942 Ga0207689_10127293 Ga0207689_101272932 349
91 3300050510 nmdc:mga06r32_144337_c1 nmdc:mga06r32_144337_c1_286_1365 349
92 3300050515 nmdc:mga0a205_112391_c1 nmdc:mga0a205_112391_c1_1217_2296 349
93 3300009147 Ga0114129_10035541 Ga0114129_100355416 350
94 3300046499 Ga0495594_0089755 Ga0495594_0089755_421_1578 350
95 3300049578 Ga0501042_0100791 Ga0501042_0100791_884_1972 350
96 3300049824 Ga0501045_0054232 Ga0501045_0054232_1450_2538 350
97 3300050507 nmdc:mga05p37_73074_c1 nmdc:mga05p37_73074_c1_1248_2330 350
98 3300060353 Ga0501082_0058891 Ga0501082_0058891_106_1194 350
99 3300025906 Ga0207699_10021497 Ga0207699_100214972 351
100 3300042131 Ga0450894_003360 Ga0450894_003360_926_2017 351
101 3300049823 Ga0501044_0008058 Ga0501044_0008058_10229_11341 351
102 3300005617 Ga0068859_100073173 Ga0068859_1000731732 352
103 3300006931 Ga0097620_100073172 Ga0097620_1000731722 352
104 3300031727 Ga0316576_10003425 Ga0316576_100034254 352
105 3300031728 Ga0316578_10037258 Ga0316578_100372583 352
106 3300005545 Ga0070695_100077460 Ga0070695_1000774602 353
107 3300006178 Ga0075367_10003567 Ga0075367_100035675 353
108 3300006195 Ga0075366_10043075 Ga0075366_100430752 353
109 3300006844 Ga0075428_100002625 Ga0075428_10000262514 353
110 3300006852 Ga0075433_10042199 Ga0075433_100421994 353
111 3300006880 Ga0075429_100024377 Ga0075429_1000243771 353
112 3300009094 Ga0111539_10008937 Ga0111539_1000893712 353
113 3300027907 Ga0207428_10009113 Ga0207428_100091133 353
114 3300028380 Ga0268265_10079493 Ga0268265_100794932 353
115 3300050494 nmdc:mga06z11_6581_c1 nmdc:mga06z11_6581_c1_1355_2509 353
116 3300050508 nmdc:mga09592_114181_c1 nmdc:mga09592_114181_c1_1141_2241 353
117 3300050511 nmdc:mga08y16_12632_c1 nmdc:mga08y16_12632_c1_1941_3041 353
118 3300005438 Ga0070701_10031381 Ga0070701_100313813 354
119 3300026116 Ga0207674_10025686 Ga0207674_100256862 354
120 3300044684 Ga0466966_0163005 Ga0466966_0163005_226_1323 354
121 3300049743 Ga0501081_0064398 Ga0501081_0064398_1359_2462 354
122 3300049824 Ga0501045_0009480 Ga0501045_0009480_3852_4955 354
123 3300054114 Ga0501084_0016040 Ga0501084_0016040_1327_2430 354
124 3300005293 Ga0065715_10210326 Ga0065715_102103261 355
125 3300005330 Ga0070690_100158078 Ga0070690_1001580782 355
126 3300005334 Ga0068869_100017371 Ga0068869_1000173712 355
127 3300005338 Ga0068868_100018137 Ga0068868_1000181373 355
128 3300005367 Ga0070667_100050977 Ga0070667_1000509772 355
129 3300005436 Ga0070713_100008354 Ga0070713_1000083542 355
130 3300005445 Ga0070708_100190549 Ga0070708_1001905491 355
131 3300005456 Ga0070678_100040121 Ga0070678_1000401212 355
132 3300005457 Ga0070662_100102455 Ga0070662_1001024552 355
133 3300005459 Ga0068867_100011734 Ga0068867_1000117342 355
134 3300005467 Ga0070706_100197258 Ga0070706_1001972582 355
135 3300005468 Ga0070707_100095482 Ga0070707_1000954823 355
136 3300005518 Ga0070699_100122847 Ga0070699_1001228472 355
137 3300005536 Ga0070697_100018649 Ga0070697_1000186493 355
138 3300005549 Ga0070704_100036905 Ga0070704_1000369052 355
139 3300005615 Ga0070702_100066619 Ga0070702_1000666191 355
140 3300005617 Ga0068859_100039253 Ga0068859_1000392532 355
141 3300005841 Ga0068863_100086706 Ga0068863_1000867062 355
142 3300005842 Ga0068858_100036329 Ga0068858_1000363292 355
143 3300005843 Ga0068860_100042598 Ga0068860_1000425984 355
144 3300005844 Ga0068862_100181425 Ga0068862_1001814252 355
145 3300006175 Ga0070712_100050494 Ga0070712_1000504943 355
146 3300006178 Ga0075367_10040949 Ga0075367_100409491 355
147 3300006195 Ga0075366_10024842 Ga0075366_100248422 355
148 3300006237 Ga0097621_100117973 Ga0097621_1001179731 355
149 3300006358 Ga0068871_100251009 Ga0068871_1002510092 355
150 3300006844 Ga0075428_100000820 Ga0075428_10000082017 355
151 3300006844 Ga0075428_100055812 Ga0075428_1000558122 355
152 3300006844 Ga0075428_100166118 Ga0075428_1001661182 355
153 3300006846 Ga0075430_100004193 Ga0075430_1000041937 355
154 3300006846 Ga0075430_100074551 Ga0075430_1000745512 355
155 3300006846 Ga0075430_100096212 Ga0075430_1000962122 355
156 3300006847 Ga0075431_100017776 Ga0075431_1000177763 355
157 3300006847 Ga0075431_100106871 Ga0075431_1001068712 355
158 3300006847 Ga0075431_100244817 Ga0075431_1002448173 355
159 3300006871 Ga0075434_100111413 Ga0075434_1001114132 355
160 3300006871 Ga0075434_100124856 Ga0075434_1001248562 355
161 3300006880 Ga0075429_100001561 Ga0075429_1000015617 355
162 3300006880 Ga0075429_100043329 Ga0075429_1000433291 355
163 3300006881 Ga0068865_100090931 Ga0068865_1000909312 355
164 3300006931 Ga0097620_100039256 Ga0097620_1000392564 355
165 3300007076 Ga0075435_100052602 Ga0075435_1000526022 355
166 3300009094 Ga0111539_10000194 Ga0111539_1000019418 355
167 3300009094 Ga0111539_10012461 Ga0111539_100124612 355
168 3300009147 Ga0114129_10011551 Ga0114129_100115518 355
169 3300009147 Ga0114129_10039797 Ga0114129_100397974 355
170 3300009147 Ga0114129_10259989 Ga0114129_102599892 355
171 3300009177 Ga0105248_10038796 Ga0105248_100387964 355
172 3300013308 Ga0157375_10168929 Ga0157375_101689292 355
173 3300014326 Ga0157380_10230202 Ga0157380_102302022 355
174 3300025910 Ga0207684_10008774 Ga0207684_100087748 355
175 3300025915 Ga0207693_10123887 Ga0207693_101238873 355
176 3300025918 Ga0207662_10002245 Ga0207662_100022455 355
177 3300025928 Ga0207700_10011058 Ga0207700_100110584 355
178 3300025933 Ga0207706_10082535 Ga0207706_100825352 355
179 3300025936 Ga0207670_10085876 Ga0207670_100858762 355
180 3300025938 Ga0207704_10051893 Ga0207704_100518932 355
181 3300025940 Ga0207691_10115728 Ga0207691_101157282 355
182 3300025942 Ga0207689_10005144 Ga0207689_100051444 355
183 3300026075 Ga0207708_10061158 Ga0207708_100611582 355
184 3300026089 Ga0207648_10001225 Ga0207648_1000122523 355
185 3300026116 Ga0207674_10153939 Ga0207674_101539392 355
186 3300026118 Ga0207675_100045375 Ga0207675_1000453752 355
187 3300026121 Ga0207683_10007869 Ga0207683_100078695 355
188 3300027907 Ga0207428_10000365 Ga0207428_1000036524 355
189 3300027907 Ga0207428_10006575 Ga0207428_100065753 355
190 3300028380 Ga0268265_10071959 Ga0268265_100719592 355
191 3300031548 Ga0307408_100012369 Ga0307408_1000123692 355
192 3300031548 Ga0307408_100034630 Ga0307408_1000346302 355
193 3300031728 Ga0316578_10003292 Ga0316578_100032924 355
194 3300031731 Ga0307405_10075268 Ga0307405_100752682 355
195 3300031731 Ga0307405_10266081 Ga0307405_102660811 355
196 3300031733 Ga0316577_10003504 Ga0316577_100035046 355
197 3300031901 Ga0307406_10243523 Ga0307406_102435231 355
198 3300031911 Ga0307412_10083459 Ga0307412_100834592 355
199 3300032002 Ga0307416_100010128 Ga0307416_1000101285 355
200 3300032002 Ga0307416_100316919 Ga0307416_1003169192 355
201 3300036647 Ga0316582_0019962 Ga0316582_0019962_2686_3792 355
202 3300036712 Ga0316584_0005500 Ga0316584_0005500_7349_8455 355
203 3300042876 Ga0451577_0216098 Ga0451577_0216098_33_1175 355
204 3300044712 Ga0453684_0004382 Ga0453684_0004382_26540_27682 355
205 3300049523 Ga0501300_005444 Ga0501300_005444_602_1708 355
206 3300049661 Ga0501217_004112 Ga0501217_004112_955_2061 355
207 3300049705 Ga0501225_0012302 Ga0501225_0012302_1030_2136 355
208 3300049762 Ga0501265_005950 Ga0501265_005950_223_1329 355
209 3300049770 Ga0501273_005823 Ga0501273_005823_226_1332 355
210 3300050493 nmdc:mga0k408_20596_c1 nmdc:mga0k408_20596_c1_1945_3048 355
211 3300050507 nmdc:mga05p37_167169_c1 nmdc:mga05p37_167169_c1_1026_2132 355
212 3300050507 nmdc:mga05p37_3923_c1 nmdc:mga05p37_3923_c1_7627_8733 355
213 3300050508 nmdc:mga09592_24095_c1 nmdc:mga09592_24095_c1_2962_4068 355
214 3300050509 nmdc:mga0qj67_31566_c1 nmdc:mga0qj67_31566_c1_369_1466 355
215 3300050509 nmdc:mga0qj67_37213_c1 nmdc:mga0qj67_37213_c1_121_1227 355
216 3300050510 nmdc:mga06r32_15456_c1 nmdc:mga06r32_15456_c1_427_1530 355
217 3300050510 nmdc:mga06r32_46904_c1 nmdc:mga06r32_46904_c1_2240_3352 355
218 3300050510 nmdc:mga06r32_52284_c1 nmdc:mga06r32_52284_c1_1701_2804 355
219 3300050510 nmdc:mga06r32_89991_c1 nmdc:mga06r32_89991_c1_1842_2948 355
220 3300050511 nmdc:mga08y16_173511_c1 nmdc:mga08y16_173511_c1_1030_2136 355
221 3300050511 nmdc:mga08y16_2760_c1 nmdc:mga08y16_2760_c1_1545_2651 355
222 3300050511 nmdc:mga08y16_782_c1 nmdc:mga08y16_782_c1_10005_11108 355
223 3300050511 nmdc:mga08y16_80671_c1 nmdc:mga08y16_80671_c1_1522_2628 355
224 3300050513 nmdc:mga0rr50_12123_c1 nmdc:mga0rr50_12123_c1_2257_3360 355
225 3300050515 nmdc:mga0a205_270053_c1 nmdc:mga0a205_270053_c1_370_1476 355
226 3300059421 Ga0590071_001447 Ga0590071_001447_2704_3810 355
227 3300059423 Ga0590074_004336 Ga0590074_004336_743_1849 355
228 3300059424 Ga0590075_014902 Ga0590075_014902_382_1488 355
229 3300059426 Ga0590077_002123 Ga0590077_002123_2704_3810 355
230 3300006847 Ga0075431_100117525 Ga0075431_1001175252 356
231 3300009094 Ga0111539_10173835 Ga0111539_101738352 356
232 3300037853 Ga0436364_1231341 Ga0436364_1231341_2113_3219 356
233 3300039437 Ga0436365_0335973 Ga0436365_0335973_3098_4204 356
234 3300049574 Ga0501038_0101644 Ga0501038_0101644_137_1264 356
235 3300049581 Ga0501047_0026957 Ga0501047_0026957_2328_3455 356
236 3300050510 nmdc:mga06r32_47672_c1 nmdc:mga06r32_47672_c1_2310_3419 356
237 3300050515 nmdc:mga0a205_5854_c1 nmdc:mga0a205_5854_c1_6976_8085 356
238 3300031852 Ga0307410_10106499 Ga0307410_101064991 357
239 3300031995 Ga0307409_100263001 Ga0307409_1002630011 357
240 3300032126 Ga0307415_100040544 Ga0307415_1000405442 357
241 3300059424 Ga0590075_002359 Ga0590075_002359_1165_2277 357
242 3300059426 Ga0590077_000174 Ga0590077_000174_10926_12038 357
243 3300031249 Ga0265339_10000582 Ga0265339_1000058214 358
244 3300005436 Ga0070713_100322096 Ga0070713_1003220961 359
245 3300006028 Ga0070717_10001106 Ga0070717_1000110611 359
246 3300006847 Ga0075431_100151802 Ga0075431_1001518022 359
247 3300035172 Ga0373955_0031920 Ga0373955_0031920_716_1828 359
248 3300036401 Ga0373937_0036707 Ga0373937_0036707_2792_3904 359
249 3300039447 Ga0436361_0226782 Ga0436361_0226782_533_1660 359
250 3300046679 Ga0495623_0109442 Ga0495623_0109442_432_1544 359
251 3300009098 Ga0105245_10057841 Ga0105245_100578412 360
252 3300005355 Ga0070671_100018519 Ga0070671_1000185193 362
253 3300005544 Ga0070686_100281935 Ga0070686_1002819351 362
254 3300009177 Ga0105248_10113718 Ga0105248_101137182 362
255 3300025893 Ga0207682_10064391 Ga0207682_100643912 362
256 3300025933 Ga0207706_10147341 Ga0207706_101473412 362
257 3300026067 Ga0207678_10073546 Ga0207678_100735462 362
258 3300026118 Ga0207675_100115163 Ga0207675_1001151632 362
259 3300026121 Ga0207683_10126086 Ga0207683_101260862 362
260 3300031911 Ga0307412_10180345 Ga0307412_101803452 362
261 3300049586 Ga0501070_0020169 Ga0501070_0020169_337_1473 362
262 3300049823 Ga0501044_0020559 Ga0501044_0020559_2932_4068 362
263 3300050493 nmdc:mga0k408_17915_c2 nmdc:mga0k408_17915_c2_866_2026 362
264 3300006178 Ga0075367_10063964 Ga0075367_100639641 363
265 3300006048 Ga0075363_100040403 Ga0075363_1000404032 365
266 3300006353 Ga0075370_10003158 Ga0075370_100031583 365
267 3300050490 nmdc:mga03n38_31623_c1 nmdc:mga03n38_31623_c1_220_1374 365
268 3300050491 nmdc:mga00v17_97199_c1 nmdc:mga00v17_97199_c1_422_1576 365
269 3300050496 nmdc:mga07m45_30646_c1 nmdc:mga07m45_30646_c1_609_1763 365
270 3300028800 Ga0265338_10066837 Ga0265338_100668375 366
271 3300046543 Ga0495645_0019865 Ga0495645_0019865_1290_2570 373
272 3300047471 Ga0495684_0028669 Ga0495684_0028669_88_1398 379
273 3300005331 Ga0070670_100292301 Ga0070670_1002923012 394
274 3300005290 Ga0065712_10016888 Ga0065712_100168882 397
275 3300014326 Ga0157380_10063679 Ga0157380_100636792 397

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

227

406

0.83

PF03786

UxuA

D-mannonate dehydratase (UxuA)

82

434

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.8185 53 396
3ban-assembly1.cif.gz_B the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.8012 52 396
3ban-assembly1.cif.gz_A the crystal structure of mannonate dehydratase from streptococcus suis serotype2 0.7873 53 396
1tz9-assembly1.cif.gz_B crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 0.7814 54 389
4eay-assembly1.cif.gz_A crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate 0.7806 53 388
ID Description Score Start End Superfamily
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8264 53 388 3.20.20.150
af_P24215_172_393_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8152 216 388 3.20.20.150
3banB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8012 52 396 3.20.20.150
4eayC01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7962 53 388 3.20.20.150
1tz9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7776 54 389 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V9GB46-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9867 213 301 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A5N9D0B8-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9737 213 389 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A383BE52-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9724 282 391 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A2E0XE94-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9657 217 314 GO:0008198
GO:0008927
GO:0030145
GO:0042840
AF-A0A2V9GB46-F1-model_v4 mannonate dehydratase (EC 4.2.1.8) 0.9652 213 301 GO:0008198
GO:0008927
GO:0030145
GO:0042840

Feature Viewer

pLDDT pTM Quality
86.35 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map