F380671
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 275 | 174 | 275 | 362 |
Family's Representative Sequence
| Representative Sequence | 3300047471|Ga0495684_0028669|Ga0495684_0028669_88_1398 |
| Length | 436 |
| Sequence | METRFSRRKLMQGVGAAALAQQVEPAHAQTARKWPIEEGPDTPKLCLAMGDAGVAMPAGMAAPAAQTPAGRGGGYGGTLAPRREAATSPFQRLRQLGVTHLLGVNVGSFPWQEENIRRTVETAKENGMVAYNSMINVPNSIIYGKDGRDKDLEMVIASIQAAGKAGLPVVEYNFYAHRAIEGYFEQVGRANSGYTGFDYDLELLIGENGAVVPGILRDDKGRLTPETLAANPGAKKVKFRDLPPLANEGAHNLDEMWKNVTYFLKAAVPAAEKAGVKLALHPNDPPAPVSRGSQQIMGTVAGWKHLVGIVDSPANGITFDCGVTREMGEDPVAVATYFAGRKRMNHCHYRNVFVERPYEKYSELFIDAGMVDMFGVMKALVKNKYTGTIYPEHPRALDYDRERGRIGGYPGGGGHTGITFSVAYARAMMQAALETV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 102 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 104 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 105 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 111 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 112 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 117 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 118 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 119 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 120 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 121 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 122 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 123 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 124 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 127 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 128 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 129 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 136 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 140 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 147 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 148 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 149 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 151 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 152 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 155 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 156 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 157 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 158 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 159 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 160 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 164 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 165 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 168 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 169 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 171 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 172 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 173 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 174 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.64 |
| Nodule | 0 |
| Rhizoplane | 2.91 |
| Rhizosphere | 88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10016888 | 3300005290 | Bacteria | 2690 |
| 2 | Ga0065715_10210326 | 3300005293 | Unclassified | 1317 |
| 3 | Ga0070690_100158078 | 3300005330 | Unclassified | 1551 |
| 4 | Ga0070670_100006414 | 3300005331 | Bacteria | 9956 |
| 5 | Ga0070670_100086357 | 3300005331 | Bacteria | 2696 |
| 6 | Ga0070670_100292301 | 3300005331 | Bacteria | 1424 |
| 7 | Ga0068869_100017371 | 3300005334 | Bacteria | 4874 |
| 8 | Ga0068869_100142101 | 3300005334 | Bacteria | 1854 |
| 9 | Ga0068868_100018137 | 3300005338 | Bacteria | 5255 |
| 10 | Ga0070689_100339386 | 3300005340 | Bacteria | 1258 |
| 11 | Ga0070669_100034763 | 3300005353 | Bacteria | 3648 |
| 12 | Ga0070675_100068633 | 3300005354 | Bacteria | 2936 |
| 13 | Ga0070671_100018519 | 3300005355 | Bacteria | 5657 |
| 14 | Ga0070671_100052741 | 3300005355 | Bacteria | 3381 |
| 15 | Ga0070674_100012855 | 3300005356 | Bacteria | 5153 |
| 16 | Ga0070688_100033463 | 3300005365 | Bacteria | 3107 |
| 17 | Ga0070667_100050977 | 3300005367 | Bacteria | 3488 |
| 18 | Ga0070713_100008354 | 3300005436 | Bacteria | 7342 |
| 19 | Ga0070713_100322096 | 3300005436 | Unclassified | 1428 |
| 20 | Ga0070701_10031381 | 3300005438 | Unclassified | 2636 |
| 21 | Ga0070708_100190549 | 3300005445 | Unclassified | 1918 |
| 22 | Ga0070678_100040121 | 3300005456 | Bacteria | 3310 |
| 23 | Ga0070678_100122865 | 3300005456 | Bacteria | 2050 |
| 24 | Ga0070662_100102455 | 3300005457 | Unclassified | 2169 |
| 25 | Ga0068867_100011734 | 3300005459 | Bacteria | 6188 |
| 26 | Ga0068867_100017791 | 3300005459 | Bacteria | 5047 |
| 27 | Ga0070685_10002775 | 3300005466 | Bacteria | 8958 |
| 28 | Ga0070706_100197258 | 3300005467 | Bacteria | 1880 |
| 29 | Ga0070707_100095482 | 3300005468 | Unclassified | 2879 |
| 30 | Ga0070699_100122847 | 3300005518 | Bacteria | 2284 |
| 31 | Ga0070699_100171117 | 3300005518 | Bacteria | 1925 |
| 32 | Ga0070697_100018649 | 3300005536 | Bacteria | 5473 |
| 33 | Ga0070672_100064610 | 3300005543 | Bacteria | 2892 |
| 34 | Ga0070672_100078088 | 3300005543 | Unclassified | 2648 |
| 35 | Ga0070686_100281935 | 3300005544 | Unclassified | 1226 |
| 36 | Ga0070695_100077460 | 3300005545 | Bacteria | 2191 |
| 37 | Ga0070665_100036759 | 3300005548 | Bacteria | 4925 |
| 38 | Ga0070704_100036905 | 3300005549 | Bacteria | 3333 |
| 39 | Ga0068855_100158776 | 3300005563 | Bacteria | 2568 |
| 40 | Ga0068856_100004385 | 3300005614 | Bacteria | 14059 |
| 41 | Ga0070702_100066619 | 3300005615 | Bacteria | 2112 |
| 42 | Ga0068859_100039253 | 3300005617 | Bacteria | 4749 |
| 43 | Ga0068859_100054668 | 3300005617 | Bacteria | 4016 |
| 44 | Ga0068859_100073173 | 3300005617 | Bacteria | 3465 |
| 45 | Ga0068864_100345485 | 3300005618 | Unclassified | 1403 |
| 46 | Ga0068863_100086706 | 3300005841 | Bacteria | 2967 |
| 47 | Ga0068858_100036329 | 3300005842 | Bacteria | 4568 |
| 48 | Ga0068860_100042598 | 3300005843 | Bacteria | 4334 |
| 49 | Ga0068862_100181425 | 3300005844 | Bacteria | 1890 |
| 50 | Ga0081540_1059149 | 3300005983 | Unclassified | 1841 |
| 51 | Ga0070717_10001106 | 3300006028 | Bacteria | 18168 |
| 52 | Ga0075368_10025726 | 3300006042 | Unclassified | 2259 |
| 53 | Ga0075363_100040403 | 3300006048 | Bacteria | 2459 |
| 54 | Ga0070712_100050494 | 3300006175 | Bacteria | 2893 |
| 55 | Ga0075367_10003567 | 3300006178 | Bacteria | 7446 |
| 56 | Ga0075367_10040949 | 3300006178 | Bacteria | 2706 |
| 57 | Ga0075367_10063964 | 3300006178 | Bacteria | 2200 |
| 58 | Ga0075366_10002522 | 3300006195 | Bacteria | 9405 |
| 59 | Ga0075366_10024842 | 3300006195 | Unclassified | 3495 |
| 60 | Ga0075366_10043075 | 3300006195 | Bacteria | 2673 |
| 61 | Ga0097621_100117973 | 3300006237 | Bacteria | 2249 |
| 62 | Ga0075370_10003158 | 3300006353 | Bacteria | 7787 |
| 63 | Ga0075370_10056503 | 3300006353 | Unclassified | 2231 |
| 64 | Ga0068871_100251009 | 3300006358 | Bacteria | 1541 |
| 65 | Ga0068871_100311625 | 3300006358 | Unclassified | 1384 |
| 66 | Ga0075428_100000820 | 3300006844 | Bacteria | 32505 |
| 67 | Ga0075428_100002625 | 3300006844 | Bacteria | 19558 |
| 68 | Ga0075428_100055812 | 3300006844 | Bacteria | 4328 |
| 69 | Ga0075428_100166118 | 3300006844 | Bacteria | 2394 |
| 70 | Ga0075430_100004193 | 3300006846 | Bacteria | 12165 |
| 71 | Ga0075430_100074551 | 3300006846 | Bacteria | 2845 |
| 72 | Ga0075430_100096212 | 3300006846 | Bacteria | 2475 |
| 73 | Ga0075431_100017776 | 3300006847 | Bacteria | 7229 |
| 74 | Ga0075431_100106871 | 3300006847 | Bacteria | 2887 |
| 75 | Ga0075431_100117525 | 3300006847 | Bacteria | 2744 |
| 76 | Ga0075431_100151802 | 3300006847 | Unclassified | 2385 |
| 77 | Ga0075431_100244817 | 3300006847 | Unclassified | 1823 |
| 78 | Ga0075433_10042199 | 3300006852 | Unclassified | 3957 |
| 79 | Ga0075433_10101166 | 3300006852 | Unclassified | 2552 |
| 80 | Ga0075434_100111413 | 3300006871 | Bacteria | 2747 |
| 81 | Ga0075434_100124856 | 3300006871 | Bacteria | 2591 |
| 82 | Ga0075429_100001561 | 3300006880 | Bacteria | 18829 |
| 83 | Ga0075429_100024377 | 3300006880 | Bacteria | 5249 |
| 84 | Ga0075429_100043329 | 3300006880 | Bacteria | 3916 |
| 85 | Ga0068865_100090931 | 3300006881 | Bacteria | 2214 |
| 86 | Ga0097620_100039256 | 3300006931 | Bacteria | 4749 |
| 87 | Ga0097620_100054667 | 3300006931 | Bacteria | 4016 |
| 88 | Ga0097620_100073172 | 3300006931 | Bacteria | 3465 |
| 89 | Ga0075435_100052602 | 3300007076 | Bacteria | 3282 |
| 90 | Ga0111539_10000194 | 3300009094 | Bacteria | 71319 |
| 91 | Ga0111539_10008937 | 3300009094 | Bacteria | 12685 |
| 92 | Ga0111539_10012461 | 3300009094 | Bacteria | 10658 |
| 93 | Ga0111539_10173835 | 3300009094 | Bacteria | 2516 |
| 94 | Ga0105245_10057841 | 3300009098 | Bacteria | 3488 |
| 95 | Ga0114129_10011551 | 3300009147 | Bacteria | 12575 |
| 96 | Ga0114129_10035541 | 3300009147 | Bacteria | 7039 |
| 97 | Ga0114129_10039797 | 3300009147 | Bacteria | 6631 |
| 98 | Ga0114129_10166147 | 3300009147 | Unclassified | 3011 |
| 99 | Ga0114129_10259989 | 3300009147 | Bacteria | 2327 |
| 100 | Ga0114129_10524217 | 3300009147 | Bacteria | 1544 |
| 101 | Ga0105243_10246694 | 3300009148 | Unclassified | 1592 |
| 102 | Ga0105248_10015282 | 3300009177 | Bacteria | 8465 |
| 103 | Ga0105248_10038796 | 3300009177 | Bacteria | 5332 |
| 104 | Ga0105248_10113718 | 3300009177 | Bacteria | 3053 |
| 105 | Ga0105238_10282789 | 3300009551 | Unclassified | 1640 |
| 106 | Ga0157369_10327717 | 3300013105 | Unclassified | 1591 |
| 107 | Ga0157372_10204997 | 3300013307 | Unclassified | 2285 |
| 108 | Ga0157375_10168929 | 3300013308 | Unclassified | 2334 |
| 109 | Ga0157380_10063679 | 3300014326 | Bacteria | 2957 |
| 110 | Ga0157380_10178950 | 3300014326 | Unclassified | 1861 |
| 111 | Ga0157380_10230202 | 3300014326 | Bacteria | 1664 |
| 112 | Ga0157380_10519661 | 3300014326 | Bacteria | 1161 |
| 113 | Ga0207697_10013026 | 3300025315 | Bacteria | 3474 |
| 114 | Ga0207682_10064391 | 3300025893 | Bacteria | 1541 |
| 115 | Ga0207688_10022349 | 3300025901 | Bacteria | 3461 |
| 116 | Ga0207680_10065183 | 3300025903 | Bacteria | 2235 |
| 117 | Ga0207699_10021497 | 3300025906 | Bacteria | 3479 |
| 118 | Ga0207684_10008774 | 3300025910 | Bacteria | 8976 |
| 119 | Ga0207693_10123887 | 3300025915 | Bacteria | 2031 |
| 120 | Ga0207662_10002245 | 3300025918 | Bacteria | 9649 |
| 121 | Ga0207681_10116434 | 3300025923 | Bacteria | 1953 |
| 122 | Ga0207650_10016945 | 3300025925 | Bacteria | 5096 |
| 123 | Ga0207650_10085145 | 3300025925 | Bacteria | 2404 |
| 124 | Ga0207659_10066821 | 3300025926 | Bacteria | 2610 |
| 125 | Ga0207700_10011058 | 3300025928 | Bacteria | 5736 |
| 126 | Ga0207644_10225517 | 3300025931 | Bacteria | 1487 |
| 127 | Ga0207706_10082535 | 3300025933 | Bacteria | 2825 |
| 128 | Ga0207706_10147341 | 3300025933 | Bacteria | 2071 |
| 129 | Ga0207686_10039400 | 3300025934 | Unclassified | 2867 |
| 130 | Ga0207670_10085876 | 3300025936 | Bacteria | 2212 |
| 131 | Ga0207669_10017494 | 3300025937 | Bacteria | 3679 |
| 132 | Ga0207704_10051893 | 3300025938 | Bacteria | 2483 |
| 133 | Ga0207691_10101749 | 3300025940 | Unclassified | 2563 |
| 134 | Ga0207691_10115728 | 3300025940 | Bacteria | 2380 |
| 135 | Ga0207689_10005144 | 3300025942 | Bacteria | 11758 |
| 136 | Ga0207689_10127293 | 3300025942 | Bacteria | 2095 |
| 137 | Ga0207661_10138557 | 3300025944 | Bacteria | 2092 |
| 138 | Ga0207667_10176218 | 3300025949 | Bacteria | 2197 |
| 139 | Ga0207651_10192180 | 3300025960 | Bacteria | 1629 |
| 140 | Ga0207712_10279367 | 3300025961 | Unclassified | 1362 |
| 141 | Ga0207678_10073546 | 3300026067 | Bacteria | 2929 |
| 142 | Ga0207708_10061158 | 3300026075 | Unclassified | 2875 |
| 143 | Ga0207641_10100753 | 3300026088 | Bacteria | 2544 |
| 144 | Ga0207648_10001225 | 3300026089 | Bacteria | 28789 |
| 145 | Ga0207674_10025686 | 3300026116 | Bacteria | 6272 |
| 146 | Ga0207674_10153939 | 3300026116 | Bacteria | 2255 |
| 147 | Ga0207675_100045375 | 3300026118 | Bacteria | 4106 |
| 148 | Ga0207675_100115163 | 3300026118 | Unclassified | 2540 |
| 149 | Ga0207683_10007869 | 3300026121 | Bacteria | 9119 |
| 150 | Ga0207683_10050928 | 3300026121 | Bacteria | 3627 |
| 151 | Ga0207683_10126086 | 3300026121 | Bacteria | 2301 |
| 152 | Ga0207428_10000365 | 3300027907 | Bacteria | 58330 |
| 153 | Ga0207428_10006575 | 3300027907 | Bacteria | 10714 |
| 154 | Ga0207428_10009113 | 3300027907 | Bacteria | 8919 |
| 155 | Ga0268265_10071959 | 3300028380 | Bacteria | 2695 |
| 156 | Ga0268265_10079493 | 3300028380 | Bacteria | 2583 |
| 157 | Ga0265338_10066837 | 3300028800 | Unclassified | 3108 |
| 158 | Ga0265338_10068335 | 3300028800 | Bacteria | 3062 |
| 159 | Ga0265339_10000582 | 3300031249 | Bacteria | 28512 |
| 160 | Ga0307408_100012369 | 3300031548 | Bacteria | 5650 |
| 161 | Ga0307408_100034630 | 3300031548 | Unclassified | 3538 |
| 162 | Ga0316576_10003425 | 3300031727 | Bacteria | 9283 |
| 163 | Ga0316578_10003292 | 3300031728 | Bacteria | 7350 |
| 164 | Ga0316578_10037258 | 3300031728 | Bacteria | 2801 |
| 165 | Ga0307405_10075268 | 3300031731 | Unclassified | 2186 |
| 166 | Ga0307405_10266081 | 3300031731 | Unclassified | 1283 |
| 167 | Ga0316577_10003504 | 3300031733 | Bacteria | 7938 |
| 168 | Ga0307410_10106499 | 3300031852 | Unclassified | 2020 |
| 169 | Ga0307406_10243523 | 3300031901 | Unclassified | 1350 |
| 170 | Ga0307412_10083459 | 3300031911 | Bacteria | 2215 |
| 171 | Ga0307412_10180345 | 3300031911 | Bacteria | 1588 |
| 172 | Ga0307409_100263001 | 3300031995 | Unclassified | 1584 |
| 173 | Ga0307416_100010128 | 3300032002 | Bacteria | 6212 |
| 174 | Ga0307416_100316919 | 3300032002 | Unclassified | 1559 |
| 175 | Ga0307415_100040544 | 3300032126 | Unclassified | 3085 |
| 176 | Ga0373955_0031920 | 3300035172 | Bacteria | 2761 |
| 177 | Ga0373937_0036707 | 3300036401 | Bacteria | 4466 |
| 178 | Ga0316582_0019962 | 3300036647 | Bacteria | 3932 |
| 179 | Ga0316584_0005500 | 3300036712 | Bacteria | 8509 |
| 180 | Ga0436364_0376723 | 3300037853 | Bacteria | 1353 |
| 181 | Ga0436364_1231341 | 3300037853 | Bacteria | 3767 |
| 182 | Ga0436365_0335973 | 3300039437 | Bacteria | 5430 |
| 183 | Ga0436365_0972728 | 3300039437 | Bacteria | 2408 |
| 184 | Ga0436360_0926215 | 3300039438 | Bacteria | 2489 |
| 185 | Ga0436361_0226782 | 3300039447 | Bacteria | 3939 |
| 186 | Ga0450894_003360 | 3300042131 | Bacteria | 2092 |
| 187 | Ga0439464_0000029 | 3300042439 | Bacteria | 18202 |
| 188 | Ga0439460_0004636 | 3300042461 | Bacteria | 3356 |
| 189 | Ga0451577_0216098 | 3300042876 | Bacteria | 1732 |
| 190 | Ga0466966_0163005 | 3300044684 | Bacteria | 1357 |
| 191 | Ga0453684_0004382 | 3300044712 | Bacteria | 29920 |
| 192 | Ga0451576_0197409 | 3300045051 | Bacteria | 2102 |
| 193 | Ga0495594_0089755 | 3300046499 | Bacteria | 1722 |
| 194 | Ga0495618_0142323 | 3300046514 | Unclassified | 1534 |
| 195 | Ga0495645_0019865 | 3300046543 | Bacteria | 4842 |
| 196 | Ga0495623_0109442 | 3300046679 | Unclassified | 1676 |
| 197 | Ga0495684_0028669 | 3300047471 | Bacteria | 4274 |
| 198 | Ga0496104_0061973 | 3300048907 | Bacteria | 3546 |
| 199 | Ga0496105_0023636 | 3300048908 | Bacteria | 4987 |
| 200 | Ga0496108_0020964 | 3300048911 | Bacteria | 5372 |
| 201 | Ga0496108_0471326 | 3300048911 | Unclassified | 1097 |
| 202 | Ga0496109_0022277 | 3300048912 | Bacteria | 5611 |
| 203 | Ga0496109_0163613 | 3300048912 | Bacteria | 2085 |
| 204 | Ga0496110_0034047 | 3300048913 | Bacteria | 4410 |
| 205 | Ga0496110_0235164 | 3300048913 | Unclassified | 1667 |
| 206 | Ga0501300_005444 | 3300049523 | Bacteria | 1875 |
| 207 | Ga0501038_0101644 | 3300049574 | Bacteria | 2393 |
| 208 | Ga0501042_0100791 | 3300049578 | Bacteria | 2076 |
| 209 | Ga0501047_0026957 | 3300049581 | Bacteria | 5533 |
| 210 | Ga0501047_0168239 | 3300049581 | Bacteria | 2062 |
| 211 | Ga0501047_0388018 | 3300049581 | Unclassified | 1230 |
| 212 | Ga0501070_0020169 | 3300049586 | Bacteria | 5592 |
| 213 | Ga0501071_0076602 | 3300049587 | Unclassified | 2443 |
| 214 | Ga0501074_0034744 | 3300049590 | Bacteria | 3654 |
| 215 | Ga0501216_026893 | 3300049660 | Unclassified | 1041 |
| 216 | Ga0501217_004112 | 3300049661 | Unclassified | 2980 |
| 217 | Ga0501225_0012302 | 3300049705 | Unclassified | 2404 |
| 218 | Ga0501081_0064398 | 3300049743 | Bacteria | 2546 |
| 219 | Ga0501265_005950 | 3300049762 | Bacteria | 1414 |
| 220 | Ga0501273_005823 | 3300049770 | Bacteria | 1406 |
| 221 | Ga0501044_0008058 | 3300049823 | Bacteria | 11571 |
| 222 | Ga0501044_0020559 | 3300049823 | Bacteria | 7048 |
| 223 | Ga0501044_0054604 | 3300049823 | Unclassified | 4105 |
| 224 | Ga0501045_0009480 | 3300049824 | Bacteria | 6814 |
| 225 | Ga0501045_0054232 | 3300049824 | Bacteria | 2931 |
| 226 | Ga0501212_012965 | 3300049851 | Unclassified | 1218 |
| 227 | nmdc:mga03n38_31623_c1 | 3300050490 | Bacteria | 2235 |
| 228 | nmdc:mga00v17_97199_c1 | 3300050491 | Bacteria | 1856 |
| 229 | nmdc:mga0k408_17915_c2 | 3300050493 | Bacteria | 3274 |
| 230 | nmdc:mga0k408_20596_c1 | 3300050493 | Bacteria | 3697 |
| 231 | nmdc:mga0k408_66040_c1 | 3300050493 | Bacteria | 2107 |
| 232 | nmdc:mga06z11_11219_c1 | 3300050494 | Bacteria | 3854 |
| 233 | nmdc:mga06z11_6581_c1 | 3300050494 | Bacteria | 4742 |
| 234 | nmdc:mga07m45_30646_c1 | 3300050496 | Bacteria | 2980 |
| 235 | nmdc:mga07m45_48267_c1 | 3300050496 | Unclassified | 2394 |
| 236 | nmdc:mga05p37_167169_c1 | 3300050507 | Bacteria | 2684 |
| 237 | nmdc:mga05p37_3923_c1 | 3300050507 | Bacteria | 17425 |
| 238 | nmdc:mga05p37_73074_c1 | 3300050507 | Unclassified | 4220 |
| 239 | nmdc:mga05p37_91842_c1 | 3300050507 | Unclassified | 3741 |
| 240 | nmdc:mga09592_114181_c1 | 3300050508 | Unclassified | 2318 |
| 241 | nmdc:mga09592_24095_c1 | 3300050508 | Bacteria | 5032 |
| 242 | nmdc:mga09592_96448_c1 | 3300050508 | Bacteria | 2530 |
| 243 | nmdc:mga0qj67_31566_c1 | 3300050509 | Bacteria | 4127 |
| 244 | nmdc:mga0qj67_37213_c1 | 3300050509 | Bacteria | 3811 |
| 245 | nmdc:mga0qj67_66457_c1 | 3300050509 | Bacteria | 2872 |
| 246 | nmdc:mga0qj67_77419_c1 | 3300050509 | Unclassified | 2661 |
| 247 | nmdc:mga06r32_144337_c1 | 3300050510 | Bacteria | 2357 |
| 248 | nmdc:mga06r32_15456_c1 | 3300050510 | Bacteria | 6929 |
| 249 | nmdc:mga06r32_192317_c1 | 3300050510 | Bacteria | 2028 |
| 250 | nmdc:mga06r32_301114_c1 | 3300050510 | Unclassified | 1589 |
| 251 | nmdc:mga06r32_46904_c1 | 3300050510 | Bacteria | 4125 |
| 252 | nmdc:mga06r32_47672_c1 | 3300050510 | Unclassified | 4094 |
| 253 | nmdc:mga06r32_52284_c1 | 3300050510 | Bacteria | 3912 |
| 254 | nmdc:mga06r32_89991_c1 | 3300050510 | Bacteria | 2997 |
| 255 | nmdc:mga08y16_12632_c1 | 3300050511 | Bacteria | 8883 |
| 256 | nmdc:mga08y16_173511_c1 | 3300050511 | Unclassified | 2239 |
| 257 | nmdc:mga08y16_2760_c1 | 3300050511 | Bacteria | 17993 |
| 258 | nmdc:mga08y16_782_c1 | 3300050511 | Bacteria | 30382 |
| 259 | nmdc:mga08y16_80671_c1 | 3300050511 | Unclassified | 3392 |
| 260 | nmdc:mga0rr50_12123_c1 | 3300050513 | Bacteria | 5556 |
| 261 | nmdc:mga0a205_112391_c1 | 3300050515 | Unclassified | 2623 |
| 262 | nmdc:mga0a205_270053_c1 | 3300050515 | Bacteria | 1578 |
| 263 | nmdc:mga0a205_5854_c1 | 3300050515 | Bacteria | 8468 |
| 264 | nmdc:mga0a205_79919_c1 | 3300050515 | Unclassified | 3160 |
| 265 | Ga0500641_0001175 | 3300053096 | Bacteria | 9344 |
| 266 | Ga0500568_0006592 | 3300053139 | Bacteria | 5807 |
| 267 | Ga0501084_0016040 | 3300054114 | Bacteria | 6218 |
| 268 | Ga0501084_0459560 | 3300054114 | Bacteria | 1076 |
| 269 | Ga0590071_001447 | 3300059421 | Bacteria | 6263 |
| 270 | Ga0590074_004336 | 3300059423 | Unclassified | 2347 |
| 271 | Ga0590075_002359 | 3300059424 | Unclassified | 4532 |
| 272 | Ga0590075_014902 | 3300059424 | Unclassified | 1903 |
| 273 | Ga0590077_000174 | 3300059426 | Bacteria | 18066 |
| 274 | Ga0590077_002123 | 3300059426 | Bacteria | 4340 |
| 275 | Ga0501082_0058891 | 3300060353 | Bacteria | 3310 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009147 | Ga0114129_10166147 | Ga0114129_101661472 | 298 |
| 2 | 3300014326 | Ga0157380_10519661 | Ga0157380_105196611 | 298 |
| 3 | 3300054114 | Ga0501084_0459560 | Ga0501084_0459560_130_1065 | 299 |
| 4 | 3300028800 | Ga0265338_10068335 | Ga0265338_100683351 | 306 |
| 5 | 3300049660 | Ga0501216_026893 | Ga0501216_026893_13_963 | 306 |
| 6 | 3300048911 | Ga0496108_0471326 | Ga0496108_0471326_23_1075 | 316 |
| 7 | 3300005331 | Ga0070670_100006414 | Ga0070670_1000064142 | 321 |
| 8 | 3300005340 | Ga0070689_100339386 | Ga0070689_1003393862 | 321 |
| 9 | 3300005353 | Ga0070669_100034763 | Ga0070669_1000347634 | 321 |
| 10 | 3300005355 | Ga0070671_100052741 | Ga0070671_1000527414 | 321 |
| 11 | 3300005365 | Ga0070688_100033463 | Ga0070688_1000334631 | 321 |
| 12 | 3300005456 | Ga0070678_100122865 | Ga0070678_1001228653 | 321 |
| 13 | 3300005459 | Ga0068867_100017791 | Ga0068867_1000177914 | 321 |
| 14 | 3300005466 | Ga0070685_10002775 | Ga0070685_100027757 | 321 |
| 15 | 3300005543 | Ga0070672_100078088 | Ga0070672_1000780882 | 321 |
| 16 | 3300006358 | Ga0068871_100311625 | Ga0068871_1003116252 | 321 |
| 17 | 3300009148 | Ga0105243_10246694 | Ga0105243_102466942 | 321 |
| 18 | 3300009177 | Ga0105248_10015282 | Ga0105248_100152822 | 321 |
| 19 | 3300009551 | Ga0105238_10282789 | Ga0105238_102827892 | 321 |
| 20 | 3300025923 | Ga0207681_10116434 | Ga0207681_101164341 | 321 |
| 21 | 3300025925 | Ga0207650_10016945 | Ga0207650_100169452 | 321 |
| 22 | 3300025931 | Ga0207644_10225517 | Ga0207644_102255172 | 321 |
| 23 | 3300025934 | Ga0207686_10039400 | Ga0207686_100394002 | 321 |
| 24 | 3300025940 | Ga0207691_10101749 | Ga0207691_101017492 | 321 |
| 25 | 3300025961 | Ga0207712_10279367 | Ga0207712_102793672 | 321 |
| 26 | 3300026088 | Ga0207641_10100753 | Ga0207641_101007533 | 321 |
| 27 | 3300026121 | Ga0207683_10050928 | Ga0207683_100509282 | 321 |
| 28 | 3300048907 | Ga0496104_0061973 | Ga0496104_0061973_2223_3218 | 321 |
| 29 | 3300048908 | Ga0496105_0023636 | Ga0496105_0023636_2528_3523 | 321 |
| 30 | 3300048911 | Ga0496108_0020964 | Ga0496108_0020964_755_1750 | 321 |
| 31 | 3300048912 | Ga0496109_0022277 | Ga0496109_0022277_3666_4661 | 321 |
| 32 | 3300048913 | Ga0496110_0034047 | Ga0496110_0034047_3324_4319 | 321 |
| 33 | 3300049587 | Ga0501071_0076602 | Ga0501071_0076602_1375_2373 | 322 |
| 34 | 3300049851 | Ga0501212_012965 | Ga0501212_012965_118_1116 | 322 |
| 35 | 3300050508 | nmdc:mga09592_96448_c1 | nmdc:mga09592_96448_c1_1195_2193 | 322 |
| 36 | 3300050509 | nmdc:mga0qj67_66457_c1 | nmdc:mga0qj67_66457_c1_669_1667 | 322 |
| 37 | 3300050510 | nmdc:mga06r32_192317_c1 | nmdc:mga06r32_192317_c1_38_1036 | 322 |
| 38 | 3300050510 | nmdc:mga06r32_301114_c1 | nmdc:mga06r32_301114_c1_467_1465 | 322 |
| 39 | 3300049590 | Ga0501074_0034744 | Ga0501074_0034744_2137_3138 | 323 |
| 40 | 3300049581 | Ga0501047_0168239 | Ga0501047_0168239_101_1120 | 327 |
| 41 | 3300049823 | Ga0501044_0054604 | Ga0501044_0054604_543_1562 | 327 |
| 42 | 3300009147 | Ga0114129_10524217 | Ga0114129_105242172 | 328 |
| 43 | 3300037853 | Ga0436364_0376723 | Ga0436364_0376723_171_1202 | 328 |
| 44 | 3300005356 | Ga0070674_100012855 | Ga0070674_1000128553 | 333 |
| 45 | 3300005518 | Ga0070699_100171117 | Ga0070699_1001711172 | 333 |
| 46 | 3300005563 | Ga0068855_100158776 | Ga0068855_1001587762 | 333 |
| 47 | 3300005614 | Ga0068856_100004385 | Ga0068856_10000438511 | 333 |
| 48 | 3300013105 | Ga0157369_10327717 | Ga0157369_103277172 | 333 |
| 49 | 3300013307 | Ga0157372_10204997 | Ga0157372_102049972 | 333 |
| 50 | 3300025937 | Ga0207669_10017494 | Ga0207669_100174941 | 333 |
| 51 | 3300025949 | Ga0207667_10176218 | Ga0207667_101762182 | 333 |
| 52 | 3300048913 | Ga0496110_0235164 | Ga0496110_0235164_233_1348 | 333 |
| 53 | 3300046514 | Ga0495618_0142323 | Ga0495618_0142323_36_1211 | 334 |
| 54 | 3300049581 | Ga0501047_0388018 | Ga0501047_0388018_133_1191 | 334 |
| 55 | 3300050494 | nmdc:mga06z11_11219_c1 | nmdc:mga06z11_11219_c1_2128_3231 | 337 |
| 56 | 3300053096 | Ga0500641_0001175 | Ga0500641_0001175_6178_7359 | 339 |
| 57 | 3300005548 | Ga0070665_100036759 | Ga0070665_1000367593 | 340 |
| 58 | 3300006195 | Ga0075366_10002522 | Ga0075366_100025222 | 340 |
| 59 | 3300006353 | Ga0075370_10056503 | Ga0075370_100565032 | 340 |
| 60 | 3300050493 | nmdc:mga0k408_66040_c1 | nmdc:mga0k408_66040_c1_420_1565 | 340 |
| 61 | 3300050496 | nmdc:mga07m45_48267_c1 | nmdc:mga07m45_48267_c1_391_1536 | 340 |
| 62 | 3300039437 | Ga0436365_0972728 | Ga0436365_0972728_500_1561 | 342 |
| 63 | 3300039438 | Ga0436360_0926215 | Ga0436360_0926215_499_1587 | 342 |
| 64 | 3300005331 | Ga0070670_100086357 | Ga0070670_1000863573 | 344 |
| 65 | 3300005354 | Ga0070675_100068633 | Ga0070675_1000686332 | 344 |
| 66 | 3300005543 | Ga0070672_100064610 | Ga0070672_1000646103 | 344 |
| 67 | 3300005618 | Ga0068864_100345485 | Ga0068864_1003454851 | 344 |
| 68 | 3300006042 | Ga0075368_10025726 | Ga0075368_100257262 | 344 |
| 69 | 3300025315 | Ga0207697_10013026 | Ga0207697_100130262 | 344 |
| 70 | 3300025901 | Ga0207688_10022349 | Ga0207688_100223493 | 344 |
| 71 | 3300025903 | Ga0207680_10065183 | Ga0207680_100651832 | 344 |
| 72 | 3300025925 | Ga0207650_10085145 | Ga0207650_100851452 | 344 |
| 73 | 3300025926 | Ga0207659_10066821 | Ga0207659_100668213 | 344 |
| 74 | 3300025944 | Ga0207661_10138557 | Ga0207661_101385572 | 344 |
| 75 | 3300025960 | Ga0207651_10192180 | Ga0207651_101921802 | 344 |
| 76 | 3300045051 | Ga0451576_0197409 | Ga0451576_0197409_271_1413 | 344 |
| 77 | 3300048912 | Ga0496109_0163613 | Ga0496109_0163613_398_1507 | 344 |
| 78 | 3300053139 | Ga0500568_0006592 | Ga0500568_0006592_4199_5344 | 345 |
| 79 | 3300050515 | nmdc:mga0a205_79919_c1 | nmdc:mga0a205_79919_c1_1387_2532 | 346 |
| 80 | 3300005617 | Ga0068859_100054668 | Ga0068859_1000546683 | 347 |
| 81 | 3300006931 | Ga0097620_100054667 | Ga0097620_1000546673 | 347 |
| 82 | 3300014326 | Ga0157380_10178950 | Ga0157380_101789502 | 347 |
| 83 | 3300042461 | Ga0439460_0004636 | Ga0439460_0004636_637_1713 | 347 |
| 84 | 3300050507 | nmdc:mga05p37_91842_c1 | nmdc:mga05p37_91842_c1_149_1222 | 347 |
| 85 | 3300050509 | nmdc:mga0qj67_77419_c1 | nmdc:mga0qj67_77419_c1_149_1222 | 347 |
| 86 | 3300042439 | Ga0439464_0000029 | Ga0439464_0000029_12366_13472 | 348 |
| 87 | 3300005334 | Ga0068869_100142101 | Ga0068869_1001421012 | 349 |
| 88 | 3300005983 | Ga0081540_1059149 | Ga0081540_10591493 | 349 |
| 89 | 3300006852 | Ga0075433_10101166 | Ga0075433_101011662 | 349 |
| 90 | 3300025942 | Ga0207689_10127293 | Ga0207689_101272932 | 349 |
| 91 | 3300050510 | nmdc:mga06r32_144337_c1 | nmdc:mga06r32_144337_c1_286_1365 | 349 |
| 92 | 3300050515 | nmdc:mga0a205_112391_c1 | nmdc:mga0a205_112391_c1_1217_2296 | 349 |
| 93 | 3300009147 | Ga0114129_10035541 | Ga0114129_100355416 | 350 |
| 94 | 3300046499 | Ga0495594_0089755 | Ga0495594_0089755_421_1578 | 350 |
| 95 | 3300049578 | Ga0501042_0100791 | Ga0501042_0100791_884_1972 | 350 |
| 96 | 3300049824 | Ga0501045_0054232 | Ga0501045_0054232_1450_2538 | 350 |
| 97 | 3300050507 | nmdc:mga05p37_73074_c1 | nmdc:mga05p37_73074_c1_1248_2330 | 350 |
| 98 | 3300060353 | Ga0501082_0058891 | Ga0501082_0058891_106_1194 | 350 |
| 99 | 3300025906 | Ga0207699_10021497 | Ga0207699_100214972 | 351 |
| 100 | 3300042131 | Ga0450894_003360 | Ga0450894_003360_926_2017 | 351 |
| 101 | 3300049823 | Ga0501044_0008058 | Ga0501044_0008058_10229_11341 | 351 |
| 102 | 3300005617 | Ga0068859_100073173 | Ga0068859_1000731732 | 352 |
| 103 | 3300006931 | Ga0097620_100073172 | Ga0097620_1000731722 | 352 |
| 104 | 3300031727 | Ga0316576_10003425 | Ga0316576_100034254 | 352 |
| 105 | 3300031728 | Ga0316578_10037258 | Ga0316578_100372583 | 352 |
| 106 | 3300005545 | Ga0070695_100077460 | Ga0070695_1000774602 | 353 |
| 107 | 3300006178 | Ga0075367_10003567 | Ga0075367_100035675 | 353 |
| 108 | 3300006195 | Ga0075366_10043075 | Ga0075366_100430752 | 353 |
| 109 | 3300006844 | Ga0075428_100002625 | Ga0075428_10000262514 | 353 |
| 110 | 3300006852 | Ga0075433_10042199 | Ga0075433_100421994 | 353 |
| 111 | 3300006880 | Ga0075429_100024377 | Ga0075429_1000243771 | 353 |
| 112 | 3300009094 | Ga0111539_10008937 | Ga0111539_1000893712 | 353 |
| 113 | 3300027907 | Ga0207428_10009113 | Ga0207428_100091133 | 353 |
| 114 | 3300028380 | Ga0268265_10079493 | Ga0268265_100794932 | 353 |
| 115 | 3300050494 | nmdc:mga06z11_6581_c1 | nmdc:mga06z11_6581_c1_1355_2509 | 353 |
| 116 | 3300050508 | nmdc:mga09592_114181_c1 | nmdc:mga09592_114181_c1_1141_2241 | 353 |
| 117 | 3300050511 | nmdc:mga08y16_12632_c1 | nmdc:mga08y16_12632_c1_1941_3041 | 353 |
| 118 | 3300005438 | Ga0070701_10031381 | Ga0070701_100313813 | 354 |
| 119 | 3300026116 | Ga0207674_10025686 | Ga0207674_100256862 | 354 |
| 120 | 3300044684 | Ga0466966_0163005 | Ga0466966_0163005_226_1323 | 354 |
| 121 | 3300049743 | Ga0501081_0064398 | Ga0501081_0064398_1359_2462 | 354 |
| 122 | 3300049824 | Ga0501045_0009480 | Ga0501045_0009480_3852_4955 | 354 |
| 123 | 3300054114 | Ga0501084_0016040 | Ga0501084_0016040_1327_2430 | 354 |
| 124 | 3300005293 | Ga0065715_10210326 | Ga0065715_102103261 | 355 |
| 125 | 3300005330 | Ga0070690_100158078 | Ga0070690_1001580782 | 355 |
| 126 | 3300005334 | Ga0068869_100017371 | Ga0068869_1000173712 | 355 |
| 127 | 3300005338 | Ga0068868_100018137 | Ga0068868_1000181373 | 355 |
| 128 | 3300005367 | Ga0070667_100050977 | Ga0070667_1000509772 | 355 |
| 129 | 3300005436 | Ga0070713_100008354 | Ga0070713_1000083542 | 355 |
| 130 | 3300005445 | Ga0070708_100190549 | Ga0070708_1001905491 | 355 |
| 131 | 3300005456 | Ga0070678_100040121 | Ga0070678_1000401212 | 355 |
| 132 | 3300005457 | Ga0070662_100102455 | Ga0070662_1001024552 | 355 |
| 133 | 3300005459 | Ga0068867_100011734 | Ga0068867_1000117342 | 355 |
| 134 | 3300005467 | Ga0070706_100197258 | Ga0070706_1001972582 | 355 |
| 135 | 3300005468 | Ga0070707_100095482 | Ga0070707_1000954823 | 355 |
| 136 | 3300005518 | Ga0070699_100122847 | Ga0070699_1001228472 | 355 |
| 137 | 3300005536 | Ga0070697_100018649 | Ga0070697_1000186493 | 355 |
| 138 | 3300005549 | Ga0070704_100036905 | Ga0070704_1000369052 | 355 |
| 139 | 3300005615 | Ga0070702_100066619 | Ga0070702_1000666191 | 355 |
| 140 | 3300005617 | Ga0068859_100039253 | Ga0068859_1000392532 | 355 |
| 141 | 3300005841 | Ga0068863_100086706 | Ga0068863_1000867062 | 355 |
| 142 | 3300005842 | Ga0068858_100036329 | Ga0068858_1000363292 | 355 |
| 143 | 3300005843 | Ga0068860_100042598 | Ga0068860_1000425984 | 355 |
| 144 | 3300005844 | Ga0068862_100181425 | Ga0068862_1001814252 | 355 |
| 145 | 3300006175 | Ga0070712_100050494 | Ga0070712_1000504943 | 355 |
| 146 | 3300006178 | Ga0075367_10040949 | Ga0075367_100409491 | 355 |
| 147 | 3300006195 | Ga0075366_10024842 | Ga0075366_100248422 | 355 |
| 148 | 3300006237 | Ga0097621_100117973 | Ga0097621_1001179731 | 355 |
| 149 | 3300006358 | Ga0068871_100251009 | Ga0068871_1002510092 | 355 |
| 150 | 3300006844 | Ga0075428_100000820 | Ga0075428_10000082017 | 355 |
| 151 | 3300006844 | Ga0075428_100055812 | Ga0075428_1000558122 | 355 |
| 152 | 3300006844 | Ga0075428_100166118 | Ga0075428_1001661182 | 355 |
| 153 | 3300006846 | Ga0075430_100004193 | Ga0075430_1000041937 | 355 |
| 154 | 3300006846 | Ga0075430_100074551 | Ga0075430_1000745512 | 355 |
| 155 | 3300006846 | Ga0075430_100096212 | Ga0075430_1000962122 | 355 |
| 156 | 3300006847 | Ga0075431_100017776 | Ga0075431_1000177763 | 355 |
| 157 | 3300006847 | Ga0075431_100106871 | Ga0075431_1001068712 | 355 |
| 158 | 3300006847 | Ga0075431_100244817 | Ga0075431_1002448173 | 355 |
| 159 | 3300006871 | Ga0075434_100111413 | Ga0075434_1001114132 | 355 |
| 160 | 3300006871 | Ga0075434_100124856 | Ga0075434_1001248562 | 355 |
| 161 | 3300006880 | Ga0075429_100001561 | Ga0075429_1000015617 | 355 |
| 162 | 3300006880 | Ga0075429_100043329 | Ga0075429_1000433291 | 355 |
| 163 | 3300006881 | Ga0068865_100090931 | Ga0068865_1000909312 | 355 |
| 164 | 3300006931 | Ga0097620_100039256 | Ga0097620_1000392564 | 355 |
| 165 | 3300007076 | Ga0075435_100052602 | Ga0075435_1000526022 | 355 |
| 166 | 3300009094 | Ga0111539_10000194 | Ga0111539_1000019418 | 355 |
| 167 | 3300009094 | Ga0111539_10012461 | Ga0111539_100124612 | 355 |
| 168 | 3300009147 | Ga0114129_10011551 | Ga0114129_100115518 | 355 |
| 169 | 3300009147 | Ga0114129_10039797 | Ga0114129_100397974 | 355 |
| 170 | 3300009147 | Ga0114129_10259989 | Ga0114129_102599892 | 355 |
| 171 | 3300009177 | Ga0105248_10038796 | Ga0105248_100387964 | 355 |
| 172 | 3300013308 | Ga0157375_10168929 | Ga0157375_101689292 | 355 |
| 173 | 3300014326 | Ga0157380_10230202 | Ga0157380_102302022 | 355 |
| 174 | 3300025910 | Ga0207684_10008774 | Ga0207684_100087748 | 355 |
| 175 | 3300025915 | Ga0207693_10123887 | Ga0207693_101238873 | 355 |
| 176 | 3300025918 | Ga0207662_10002245 | Ga0207662_100022455 | 355 |
| 177 | 3300025928 | Ga0207700_10011058 | Ga0207700_100110584 | 355 |
| 178 | 3300025933 | Ga0207706_10082535 | Ga0207706_100825352 | 355 |
| 179 | 3300025936 | Ga0207670_10085876 | Ga0207670_100858762 | 355 |
| 180 | 3300025938 | Ga0207704_10051893 | Ga0207704_100518932 | 355 |
| 181 | 3300025940 | Ga0207691_10115728 | Ga0207691_101157282 | 355 |
| 182 | 3300025942 | Ga0207689_10005144 | Ga0207689_100051444 | 355 |
| 183 | 3300026075 | Ga0207708_10061158 | Ga0207708_100611582 | 355 |
| 184 | 3300026089 | Ga0207648_10001225 | Ga0207648_1000122523 | 355 |
| 185 | 3300026116 | Ga0207674_10153939 | Ga0207674_101539392 | 355 |
| 186 | 3300026118 | Ga0207675_100045375 | Ga0207675_1000453752 | 355 |
| 187 | 3300026121 | Ga0207683_10007869 | Ga0207683_100078695 | 355 |
| 188 | 3300027907 | Ga0207428_10000365 | Ga0207428_1000036524 | 355 |
| 189 | 3300027907 | Ga0207428_10006575 | Ga0207428_100065753 | 355 |
| 190 | 3300028380 | Ga0268265_10071959 | Ga0268265_100719592 | 355 |
| 191 | 3300031548 | Ga0307408_100012369 | Ga0307408_1000123692 | 355 |
| 192 | 3300031548 | Ga0307408_100034630 | Ga0307408_1000346302 | 355 |
| 193 | 3300031728 | Ga0316578_10003292 | Ga0316578_100032924 | 355 |
| 194 | 3300031731 | Ga0307405_10075268 | Ga0307405_100752682 | 355 |
| 195 | 3300031731 | Ga0307405_10266081 | Ga0307405_102660811 | 355 |
| 196 | 3300031733 | Ga0316577_10003504 | Ga0316577_100035046 | 355 |
| 197 | 3300031901 | Ga0307406_10243523 | Ga0307406_102435231 | 355 |
| 198 | 3300031911 | Ga0307412_10083459 | Ga0307412_100834592 | 355 |
| 199 | 3300032002 | Ga0307416_100010128 | Ga0307416_1000101285 | 355 |
| 200 | 3300032002 | Ga0307416_100316919 | Ga0307416_1003169192 | 355 |
| 201 | 3300036647 | Ga0316582_0019962 | Ga0316582_0019962_2686_3792 | 355 |
| 202 | 3300036712 | Ga0316584_0005500 | Ga0316584_0005500_7349_8455 | 355 |
| 203 | 3300042876 | Ga0451577_0216098 | Ga0451577_0216098_33_1175 | 355 |
| 204 | 3300044712 | Ga0453684_0004382 | Ga0453684_0004382_26540_27682 | 355 |
| 205 | 3300049523 | Ga0501300_005444 | Ga0501300_005444_602_1708 | 355 |
| 206 | 3300049661 | Ga0501217_004112 | Ga0501217_004112_955_2061 | 355 |
| 207 | 3300049705 | Ga0501225_0012302 | Ga0501225_0012302_1030_2136 | 355 |
| 208 | 3300049762 | Ga0501265_005950 | Ga0501265_005950_223_1329 | 355 |
| 209 | 3300049770 | Ga0501273_005823 | Ga0501273_005823_226_1332 | 355 |
| 210 | 3300050493 | nmdc:mga0k408_20596_c1 | nmdc:mga0k408_20596_c1_1945_3048 | 355 |
| 211 | 3300050507 | nmdc:mga05p37_167169_c1 | nmdc:mga05p37_167169_c1_1026_2132 | 355 |
| 212 | 3300050507 | nmdc:mga05p37_3923_c1 | nmdc:mga05p37_3923_c1_7627_8733 | 355 |
| 213 | 3300050508 | nmdc:mga09592_24095_c1 | nmdc:mga09592_24095_c1_2962_4068 | 355 |
| 214 | 3300050509 | nmdc:mga0qj67_31566_c1 | nmdc:mga0qj67_31566_c1_369_1466 | 355 |
| 215 | 3300050509 | nmdc:mga0qj67_37213_c1 | nmdc:mga0qj67_37213_c1_121_1227 | 355 |
| 216 | 3300050510 | nmdc:mga06r32_15456_c1 | nmdc:mga06r32_15456_c1_427_1530 | 355 |
| 217 | 3300050510 | nmdc:mga06r32_46904_c1 | nmdc:mga06r32_46904_c1_2240_3352 | 355 |
| 218 | 3300050510 | nmdc:mga06r32_52284_c1 | nmdc:mga06r32_52284_c1_1701_2804 | 355 |
| 219 | 3300050510 | nmdc:mga06r32_89991_c1 | nmdc:mga06r32_89991_c1_1842_2948 | 355 |
| 220 | 3300050511 | nmdc:mga08y16_173511_c1 | nmdc:mga08y16_173511_c1_1030_2136 | 355 |
| 221 | 3300050511 | nmdc:mga08y16_2760_c1 | nmdc:mga08y16_2760_c1_1545_2651 | 355 |
| 222 | 3300050511 | nmdc:mga08y16_782_c1 | nmdc:mga08y16_782_c1_10005_11108 | 355 |
| 223 | 3300050511 | nmdc:mga08y16_80671_c1 | nmdc:mga08y16_80671_c1_1522_2628 | 355 |
| 224 | 3300050513 | nmdc:mga0rr50_12123_c1 | nmdc:mga0rr50_12123_c1_2257_3360 | 355 |
| 225 | 3300050515 | nmdc:mga0a205_270053_c1 | nmdc:mga0a205_270053_c1_370_1476 | 355 |
| 226 | 3300059421 | Ga0590071_001447 | Ga0590071_001447_2704_3810 | 355 |
| 227 | 3300059423 | Ga0590074_004336 | Ga0590074_004336_743_1849 | 355 |
| 228 | 3300059424 | Ga0590075_014902 | Ga0590075_014902_382_1488 | 355 |
| 229 | 3300059426 | Ga0590077_002123 | Ga0590077_002123_2704_3810 | 355 |
| 230 | 3300006847 | Ga0075431_100117525 | Ga0075431_1001175252 | 356 |
| 231 | 3300009094 | Ga0111539_10173835 | Ga0111539_101738352 | 356 |
| 232 | 3300037853 | Ga0436364_1231341 | Ga0436364_1231341_2113_3219 | 356 |
| 233 | 3300039437 | Ga0436365_0335973 | Ga0436365_0335973_3098_4204 | 356 |
| 234 | 3300049574 | Ga0501038_0101644 | Ga0501038_0101644_137_1264 | 356 |
| 235 | 3300049581 | Ga0501047_0026957 | Ga0501047_0026957_2328_3455 | 356 |
| 236 | 3300050510 | nmdc:mga06r32_47672_c1 | nmdc:mga06r32_47672_c1_2310_3419 | 356 |
| 237 | 3300050515 | nmdc:mga0a205_5854_c1 | nmdc:mga0a205_5854_c1_6976_8085 | 356 |
| 238 | 3300031852 | Ga0307410_10106499 | Ga0307410_101064991 | 357 |
| 239 | 3300031995 | Ga0307409_100263001 | Ga0307409_1002630011 | 357 |
| 240 | 3300032126 | Ga0307415_100040544 | Ga0307415_1000405442 | 357 |
| 241 | 3300059424 | Ga0590075_002359 | Ga0590075_002359_1165_2277 | 357 |
| 242 | 3300059426 | Ga0590077_000174 | Ga0590077_000174_10926_12038 | 357 |
| 243 | 3300031249 | Ga0265339_10000582 | Ga0265339_1000058214 | 358 |
| 244 | 3300005436 | Ga0070713_100322096 | Ga0070713_1003220961 | 359 |
| 245 | 3300006028 | Ga0070717_10001106 | Ga0070717_1000110611 | 359 |
| 246 | 3300006847 | Ga0075431_100151802 | Ga0075431_1001518022 | 359 |
| 247 | 3300035172 | Ga0373955_0031920 | Ga0373955_0031920_716_1828 | 359 |
| 248 | 3300036401 | Ga0373937_0036707 | Ga0373937_0036707_2792_3904 | 359 |
| 249 | 3300039447 | Ga0436361_0226782 | Ga0436361_0226782_533_1660 | 359 |
| 250 | 3300046679 | Ga0495623_0109442 | Ga0495623_0109442_432_1544 | 359 |
| 251 | 3300009098 | Ga0105245_10057841 | Ga0105245_100578412 | 360 |
| 252 | 3300005355 | Ga0070671_100018519 | Ga0070671_1000185193 | 362 |
| 253 | 3300005544 | Ga0070686_100281935 | Ga0070686_1002819351 | 362 |
| 254 | 3300009177 | Ga0105248_10113718 | Ga0105248_101137182 | 362 |
| 255 | 3300025893 | Ga0207682_10064391 | Ga0207682_100643912 | 362 |
| 256 | 3300025933 | Ga0207706_10147341 | Ga0207706_101473412 | 362 |
| 257 | 3300026067 | Ga0207678_10073546 | Ga0207678_100735462 | 362 |
| 258 | 3300026118 | Ga0207675_100115163 | Ga0207675_1001151632 | 362 |
| 259 | 3300026121 | Ga0207683_10126086 | Ga0207683_101260862 | 362 |
| 260 | 3300031911 | Ga0307412_10180345 | Ga0307412_101803452 | 362 |
| 261 | 3300049586 | Ga0501070_0020169 | Ga0501070_0020169_337_1473 | 362 |
| 262 | 3300049823 | Ga0501044_0020559 | Ga0501044_0020559_2932_4068 | 362 |
| 263 | 3300050493 | nmdc:mga0k408_17915_c2 | nmdc:mga0k408_17915_c2_866_2026 | 362 |
| 264 | 3300006178 | Ga0075367_10063964 | Ga0075367_100639641 | 363 |
| 265 | 3300006048 | Ga0075363_100040403 | Ga0075363_1000404032 | 365 |
| 266 | 3300006353 | Ga0075370_10003158 | Ga0075370_100031583 | 365 |
| 267 | 3300050490 | nmdc:mga03n38_31623_c1 | nmdc:mga03n38_31623_c1_220_1374 | 365 |
| 268 | 3300050491 | nmdc:mga00v17_97199_c1 | nmdc:mga00v17_97199_c1_422_1576 | 365 |
| 269 | 3300050496 | nmdc:mga07m45_30646_c1 | nmdc:mga07m45_30646_c1_609_1763 | 365 |
| 270 | 3300028800 | Ga0265338_10066837 | Ga0265338_100668375 | 366 |
| 271 | 3300046543 | Ga0495645_0019865 | Ga0495645_0019865_1290_2570 | 373 |
| 272 | 3300047471 | Ga0495684_0028669 | Ga0495684_0028669_88_1398 | 379 |
| 273 | 3300005331 | Ga0070670_100292301 | Ga0070670_1002923012 | 394 |
| 274 | 3300005290 | Ga0065712_10016888 | Ga0065712_100168882 | 397 |
| 275 | 3300014326 | Ga0157380_10063679 | Ga0157380_100636792 | 397 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ban-assembly1.cif.gz_A | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.8185 | 53 | 396 |
| 3ban-assembly1.cif.gz_B | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.8012 | 52 | 396 |
| 3ban-assembly1.cif.gz_A | the crystal structure of mannonate dehydratase from streptococcus suis serotype2 | 0.7873 | 53 | 396 |
| 1tz9-assembly1.cif.gz_B | crystal structure of the putative mannonate dehydratase from enterococcus faecalis, northeast structural genomics target efr41 | 0.7814 | 54 | 389 |
| 4eay-assembly1.cif.gz_A | crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate | 0.7806 | 53 | 388 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4eayC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8264 | 53 | 388 | 3.20.20.150 |
| af_P24215_172_393_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8152 | 216 | 388 | 3.20.20.150 |
| 3banB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8012 | 52 | 396 | 3.20.20.150 |
| 4eayC01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7962 | 53 | 388 | 3.20.20.150 |
| 1tz9A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.7776 | 54 | 389 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9GB46-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9867 | 213 | 301 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A5N9D0B8-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9737 | 213 | 389 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A383BE52-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9724 | 282 | 391 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A2E0XE94-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9657 | 217 | 314 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
| AF-A0A2V9GB46-F1-model_v4 | mannonate dehydratase (EC 4.2.1.8) | 0.9652 | 213 | 301 |
GO:0008198
GO:0008927 GO:0030145 GO:0042840 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar