F380475

General Info

Members Datasets Scaffolds Average Seq Length
275 142 275 329

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10144068|Ga0207671_101440681
Length 368
Sequence MEVIALISARPAVTQHDFLPYEPTPALSPVLRGETQLNGHRSTLTAVLVVCGEIWMAGCATPAHDRGERYVFVATNIGLPYWKEAEAGFLDAANSLGVKGELVGPTGYQPTAELGVLRSVIEENPAGICISAARPEIFQADIDNAVAKGIPVICVDSDVPRSKRVAYVGTDNFKAGKESMKRMAALVSGKSNIVVVSIDGQNNVDDRLAGAVDALSNFPALKITKILDDKGDPRSAADQISDLLQKKEKIDGIICLEASGGSGAAEAVHRFNLDGKLPIVAFDDDPATLDWIDKGVIAATVTQKPYVMSYYGLKLLDDLHHNAVHQFKDWHTALAAPVPTFVDTGTVMVDKNNTGGYRQALNVRTRTQ

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
125 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.27
Rhizosphere 94.55
Stem 0
Stem Tuber 0
Unclassified 2.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10015311 3300005295 Bacteria 1780
2 Ga0070680_100029081 3300005336 Unclassified 4438
3 Ga0070703_10002455 3300005406 Bacteria 5331
4 Ga0070709_10000621 3300005434 Bacteria 20294
5 Ga0070709_10056591 3300005434 Bacteria 2480
6 Ga0070709_10126638 3300005434 Bacteria 1738
7 Ga0070709_10136922 3300005434 Unclassified 1678
8 Ga0070709_10162717 3300005434 Bacteria 1553
9 Ga0070714_100128660 3300005435 Bacteria 2261
10 Ga0070713_100002700 3300005436 Bacteria 11575
11 Ga0070713_100011351 3300005436 Bacteria 6485
12 Ga0070713_100121232 3300005436 Bacteria 2294
13 Ga0070713_100183791 3300005436 Unclassified 1880
14 Ga0070710_10088897 3300005437 Bacteria 1818
15 Ga0070710_10116657 3300005437 Bacteria 1610
16 Ga0070710_10245219 3300005437 Unclassified 1149
17 Ga0070711_100003240 3300005439 Bacteria 9451
18 Ga0070711_100016140 3300005439 Unclassified 4738
19 Ga0070705_100004289 3300005440 Bacteria 6957
20 Ga0070694_100056299 3300005444 Unclassified 2671
21 Ga0070708_100003175 3300005445 Bacteria 12815
22 Ga0070708_100004473 3300005445 Bacteria 10996
23 Ga0070708_100039864 3300005445 Bacteria 4112
24 Ga0070708_100095403 3300005445 Bacteria 2715
25 Ga0070708_100095821 3300005445 Unclassified 2709
26 Ga0070708_100327784 3300005445 Unclassified 1442
27 Ga0070708_100541147 3300005445 Bacteria 1099
28 Ga0070706_100001800 3300005467 Bacteria 22190
29 Ga0070706_100028852 3300005467 Bacteria 5110
30 Ga0070706_100045818 3300005467 Bacteria 4037
31 Ga0070706_100181223 3300005467 Bacteria 1967
32 Ga0070707_100001754 3300005468 Bacteria 20892
33 Ga0070707_100116658 3300005468 Bacteria 2591
34 Ga0070707_100117111 3300005468 Bacteria 2586
35 Ga0070707_100144867 3300005468 Unclassified 2312
36 Ga0070707_100194309 3300005468 Bacteria 1979
37 Ga0070698_100008875 3300005471 Bacteria 10807
38 Ga0070698_100018707 3300005471 Bacteria 7293
39 Ga0070698_100046520 3300005471 Unclassified 4437
40 Ga0070698_100046539 3300005471 Unclassified 4436
41 Ga0070699_100019559 3300005518 Bacteria 5834
42 Ga0070699_100073455 3300005518 Unclassified 2976
43 Ga0070699_100075515 3300005518 Unclassified 2933
44 Ga0070699_100121009 3300005518 Unclassified 2302
45 Ga0070699_100125259 3300005518 Bacteria 2261
46 Ga0070699_100529415 3300005518 Bacteria 1072
47 Ga0070679_100007444 3300005530 Bacteria 10230
48 Ga0070679_100092745 3300005530 Unclassified 3007
49 Ga0070697_100000482 3300005536 Bacteria 30258
50 Ga0070697_100006655 3300005536 Bacteria 8961
51 Ga0070697_100008330 3300005536 Bacteria 8087
52 Ga0070697_100020347 3300005536 Bacteria 5250
53 Ga0070686_100052199 3300005544 Bacteria 2606
54 Ga0070686_100083705 3300005544 Bacteria 2118
55 Ga0070695_100006590 3300005545 Bacteria 6861
56 Ga0070695_100006999 3300005545 Bacteria 6683
57 Ga0070696_100003231 3300005546 Bacteria 10854
58 Ga0070696_100008915 3300005546 Bacteria 6714
59 Ga0070693_100000160 3300005547 Bacteria 30875
60 Ga0070693_100000521 3300005547 Bacteria 17246
61 Ga0070665_100000980 3300005548 Bacteria 36151
62 Ga0070704_100017453 3300005549 Unclassified 4563
63 Ga0070704_100060857 3300005549 Unclassified 2699
64 Ga0070704_100174928 3300005549 Bacteria 1711
65 Ga0068856_100212447 3300005614 Bacteria 1950
66 Ga0068866_10066785 3300005718 Unclassified 1886
67 Ga0068863_100003756 3300005841 Bacteria 15025
68 Ga0068858_100078316 3300005842 Unclassified 3072
69 Ga0068860_100004519 3300005843 Bacteria 14199
70 Ga0068860_100006585 3300005843 Bacteria 11665
71 Ga0081455_10145404 3300005937 Unclassified 1835
72 Ga0070717_10010986 3300006028 Bacteria 6856
73 Ga0070717_10023749 3300006028 Bacteria 4862
74 Ga0070716_100001318 3300006173 Bacteria 10974
75 Ga0070716_100002637 3300006173 Bacteria 8292
76 Ga0070716_100010195 3300006173 Bacteria 4708
77 Ga0070716_100044482 3300006173 Unclassified 2488
78 Ga0070716_100045713 3300006173 Bacteria 2460
79 Ga0070716_100059634 3300006173 Bacteria 2200
80 Ga0070716_100169640 3300006173 Bacteria 1423
81 Ga0070716_100286086 3300006173 Unclassified 1140
82 Ga0070712_100030575 3300006175 Bacteria 3621
83 Ga0070712_100060226 3300006175 Bacteria 2676
84 Ga0070712_100065136 3300006175 Bacteria 2585
85 Ga0070712_100179631 3300006175 Bacteria 1648
86 Ga0070712_100280796 3300006175 Bacteria 1341
87 Ga0097621_100001690 3300006237 Bacteria 15113
88 Ga0097621_100294371 3300006237 Unclassified 1432
89 Ga0068871_100048316 3300006358 Bacteria 3435
90 Ga0075433_10254670 3300006852 Unclassified 1557
91 Ga0075434_100015819 3300006871 Bacteria 7243
92 Ga0068865_100108390 3300006881 Bacteria 2044
93 Ga0075436_100003881 3300006914 Bacteria 10244
94 Ga0075436_100015059 3300006914 Bacteria 5300
95 Ga0075435_100013555 3300007076 Bacteria 6070
96 Ga0099794_10009410 3300007265 Bacteria 4107
97 Ga0099794_10027430 3300007265 Archaea 2640
98 Ga0099794_10036597 3300007265 Unclassified 2321
99 Ga0099794_10068231 3300007265 Bacteria 1738
100 Ga0099794_10078591 3300007265 Unclassified 1625
101 Ga0099794_10116482 3300007265 Unclassified 1342
102 Ga0099795_10000942 3300007788 Bacteria 5904
103 Ga0099795_10019244 3300007788 Bacteria 2206
104 Ga0105242_10331105 3300009176 Unclassified 1400
105 Ga0105248_10107654 3300009177 Bacteria 3143
106 Ga0105237_10015573 3300009545 Bacteria 7908
107 Ga0105237_10025208 3300009545 Bacteria 6083
108 Ga0099796_10003365 3300010159 Unclassified 3698
109 Ga0099796_10006474 3300010159 Bacteria 2999
110 Ga0105239_10045745 3300010375 Unclassified 4797
111 Ga0105239_10291623 3300010375 Bacteria 1837
112 Ga0157370_10129947 3300013104 Bacteria 2350
113 Ga0157378_10000053 3300013297 Bacteria 99982
114 Ga0157378_10000402 3300013297 Bacteria 42627
115 Ga0157378_10004723 3300013297 Bacteria 11947
116 Ga0157378_10041650 3300013297 Unclassified 4074
117 Ga0163162_10064338 3300013306 Bacteria 3712
118 Ga0163162_10069231 3300013306 Bacteria 3581
119 Ga0157372_10037078 3300013307 Bacteria 5374
120 Ga0157372_10060226 3300013307 Unclassified 4248
121 Ga0157375_10321773 3300013308 Bacteria 1711
122 Ga0163163_10092364 3300014325 Bacteria 3042
123 Ga0157379_10029161 3300014968 Bacteria 4908
124 Ga0157376_10000014 3300014969 Bacteria 303001
125 Ga0157376_10000959 3300014969 Bacteria 18792
126 Ga0157376_10008433 3300014969 Bacteria 7436
127 Ga0213875_10000055 3300021388 Bacteria 139636
128 Ga0207653_10002941 3300025885 Bacteria 5404
129 Ga0207692_10128378 3300025898 Bacteria 1429
130 Ga0207642_10037169 3300025899 Bacteria 2096
131 Ga0207642_10125265 3300025899 Unclassified 1332
132 Ga0207699_10001421 3300025906 Bacteria 11351
133 Ga0207699_10061829 3300025906 Bacteria 2255
134 Ga0207699_10073080 3300025906 Bacteria 2102
135 Ga0207699_10103134 3300025906 Unclassified 1814
136 Ga0207699_10110193 3300025906 Bacteria 1763
137 Ga0207699_10168132 3300025906 Unclassified 1465
138 Ga0207684_10007281 3300025910 Bacteria 9981
139 Ga0207684_10049901 3300025910 Bacteria 3550
140 Ga0207684_10153399 3300025910 Bacteria 1982
141 Ga0207684_10180702 3300025910 Bacteria 1819
142 Ga0207684_10215481 3300025910 Bacteria 1657
143 Ga0207671_10144068 3300025914 Unclassified 1837
144 Ga0207671_10339627 3300025914 Unclassified 1190
145 Ga0207693_10065335 3300025915 Bacteria 2849
146 Ga0207693_10161738 3300025915 Unclassified 1761
147 Ga0207693_10200311 3300025915 Bacteria 1570
148 Ga0207663_10024571 3300025916 Bacteria 3471
149 Ga0207663_10026235 3300025916 Bacteria 3379
150 Ga0207660_10156129 3300025917 Unclassified 1757
151 Ga0207652_10080534 3300025921 Plasmid 2847
152 Ga0207646_10000356 3300025922 Bacteria 62109
153 Ga0207646_10001667 3300025922 Bacteria 27128
154 Ga0207700_10062913 3300025928 Bacteria 2820
155 Ga0207700_10069101 3300025928 Bacteria 2710
156 Ga0207686_10125598 3300025934 Unclassified 1753
157 Ga0207665_10000182 3300025939 Bacteria 42287
158 Ga0207665_10002762 3300025939 Bacteria 11762
159 Ga0207665_10017165 3300025939 Bacteria 4755
160 Ga0207665_10036852 3300025939 Bacteria 3254
161 Ga0207665_10044548 3300025939 Bacteria 2969
162 Ga0207665_10086283 3300025939 Bacteria 2167
163 Ga0207665_10282314 3300025939 Unclassified 1236
164 Ga0207711_10124481 3300025941 Bacteria 2305
165 Ga0207641_10008166 3300026088 Bacteria 8662
166 Ga0209588_1004042 3300027671 Bacteria 4104
167 Ga0209588_1024622 3300027671 Bacteria 1901
168 Ga0209588_1030195 3300027671 Bacteria 1731
169 Ga0265354_1000040 3300028016 Bacteria 20750
170 Ga0265354_1001496 3300028016 Unclassified 3306
171 Ga0268266_10000072 3300028379 Bacteria 232245
172 Ga0265338_10176821 3300028800 Bacteria 1631
173 Ga0265760_10008133 3300031090 Unclassified 2997
174 Ga0265332_10094272 3300031238 Bacteria 1265
175 Ga0265325_10009706 3300031241 Bacteria 5612
176 Ga0373934_0001378 3300035086 Bacteria 8855
177 Ga0373934_0004563 3300035086 Bacteria 5118
178 Ga0373923_0021166 3300035111 Unclassified 2536
179 Ga0373953_0007311 3300035117 Unclassified 3694
180 Ga0373954_0001535 3300035118 Bacteria 9398
181 Ga0373954_0097190 3300035118 Bacteria 1419
182 Ga0373956_0001607 3300035119 Bacteria 9299
183 Ga0373956_0003382 3300035119 Bacteria 6427
184 Ga0373957_0001479 3300035120 Bacteria 6364
185 Ga0373955_0001551 3300035172 Bacteria 9815
186 Ga0373955_0012731 3300035172 Bacteria 4051
187 Ga0373924_0073584 3300035410 Bacteria 1444
188 Ga0373931_0042395 3300035691 Unclassified 2393
189 Ga0373927_0000453 3300035695 Bacteria 31371
190 Ga0373927_0070891 3300035695 Bacteria 2256
191 Ga0373933_0001197 3300035724 Bacteria 15356
192 Ga0373933_0002293 3300035724 Bacteria 10885
193 Ga0373947_0014273 3300035725 Bacteria 4556
194 Ga0373937_0002231 3300036401 Bacteria 16187
195 Ga0373937_0010747 3300036401 Bacteria 8008
196 Ga0373925_0001233 3300037068 Bacteria 22604
197 Ga0373925_0291836 3300037068 Bacteria 1315
198 Ga0436364_1111922 3300037853 Bacteria 6768
199 Ga0436364_1144981 3300037853 Unclassified 4966
200 Ga0436364_1528714 3300037853 Bacteria 88642
201 Ga0395901_0830458 3300038443 Archaea 911
202 Ga0436365_1055445 3300039437 Unclassified 2384
203 Ga0436361_0760811 3300039447 Bacteria 1885
204 Ga0436362_0240783 3300039453 Bacteria 3168
205 Ga0466967_0183678 3300045976 Bacteria 1974
206 Ga0495629_0018068 3300046459 Bacteria 5054
207 Ga0495651_0009368 3300046462 Bacteria 7517
208 Ga0495651_0021794 3300046462 Bacteria 4981
209 Ga0495651_0056762 3300046462 Unclassified 3007
210 Ga0495653_0270094 3300046463 Unclassified 1120
211 Ga0495580_0001767 3300046472 Bacteria 18992
212 Ga0495580_0081156 3300046472 Bacteria 2260
213 Ga0495580_0218147 3300046472 Unclassified 1311
214 Ga0495582_0000227 3300046473 Bacteria 31128
215 Ga0495582_0017798 3300046473 Unclassified 3884
216 Ga0495639_0038260 3300046475 Unclassified 2154
217 Ga0495662_0061646 3300046476 Bacteria 1812
218 Ga0495664_0049840 3300046477 Bacteria 2486
219 Ga0495594_0017485 3300046499 Unclassified 3789
220 Ga0495628_0014678 3300046516 Bacteria 6560
221 Ga0495630_0011061 3300046517 Bacteria 6528
222 Ga0495666_0067696 3300046526 Bacteria 1701
223 Ga0495665_0126172 3300046531 Bacteria 1340
224 Ga0495640_0016785 3300046533 Bacteria 5472
225 Ga0495640_0081526 3300046533 Bacteria 2150
226 Ga0495586_0018628 3300046535 Bacteria 3696
227 Ga0495587_0024100 3300046536 Unclassified 3734
228 Ga0495587_0032090 3300046536 Unclassified 3177
229 Ga0495587_0124193 3300046536 Bacteria 1477
230 Ga0495645_0061046 3300046543 Unclassified 2732
231 Ga0495667_0046847 3300046559 Bacteria 2858
232 Ga0495635_0070779 3300046663 Unclassified 2391
233 Ga0495635_0128207 3300046663 Bacteria 1730
234 Ga0495657_0092661 3300046675 Bacteria 1935
235 Ga0495623_0043661 3300046679 Unclassified 2851
236 Ga0495658_0037049 3300046683 Bacteria 2694
237 Ga0495613_0015451 3300046689 Bacteria 5676
238 Ga0495581_0123689 3300047315 Bacteria 1506
239 Ga0495581_0130955 3300047315 Bacteria 1461
240 Ga0495604_0000512 3300047317 Bacteria 34047
241 Ga0495604_0001395 3300047317 Bacteria 19792
242 Ga0495674_0069915 3300047319 Bacteria 3035
243 Ga0495674_0073415 3300047319 Bacteria 2949
244 Ga0495674_0148325 3300047319 Unclassified 1968
245 Ga0495674_0170213 3300047319 Bacteria 1818
246 Ga0495676_0027554 3300047321 Unclassified 4869
247 Ga0495676_0179435 3300047321 Bacteria 1485
248 Ga0495680_0041655 3300047322 Unclassified 3650
249 Ga0495680_0213051 3300047322 Bacteria 1382
250 Ga0495684_0068183 3300047471 Unclassified 2705
251 Ga0495684_0394265 3300047471 Unclassified 973
252 Ga0495602_0004521 3300048088 Bacteria 14514
253 Ga0495602_0016920 3300048088 Bacteria 7317
254 Ga0495614_0023893 3300048089 Bacteria 2638
255 Ga0496100_0338567 3300048903 Bacteria 1134
256 Ga0496104_0366231 3300048907 Bacteria 1354
257 Ga0496112_0151437 3300048915 Bacteria 2286
258 Ga0496114_0082076 3300048917 Bacteria 2724
259 Ga0496114_0133909 3300048917 Bacteria 2142
260 Ga0496114_0199798 3300048917 Unclassified 1751
261 Ga0496115_0000977 3300048918 Bacteria 20712
262 Ga0496115_0004128 3300048918 Bacteria 10483
263 Ga0496115_0052662 3300048918 Bacteria 3266
264 Ga0496126_0122318 3300048929 Unclassified 2256
265 Ga0501044_0004876 3300049823 Bacteria 14991
266 nmdc:mga0n895_18505_c1 3300050512 Bacteria 6447
267 nmdc:mga0n895_200999_c1 3300050512 Unclassified 2024
268 nmdc:mga0rr50_24240_c1 3300050513 Unclassified 4200
269 nmdc:mga0rr50_433267_c1 3300050513 Bacteria 1113
270 nmdc:mga08x19_23704_c1 3300050514 Bacteria 3809
271 nmdc:mga08x19_38871_c1 3300050514 Bacteria 3023
272 nmdc:mga0a205_261128_c1 3300050515 Unclassified 1609
273 Ga0495601_0019496 3300053077 Unclassified 4137
274 Ga0495601_0070820 3300053077 Unclassified 2226
275 Ga0495595_0072210 3300053084 Unclassified 1633

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0830458 Ga0395901_0830458_83_898 271
2 3300025906 Ga0207699_10168132 Ga0207699_101681322 295
3 3300007788 Ga0099795_10000942 Ga0099795_100009427 296
4 3300013297 Ga0157378_10004723 Ga0157378_1000472310 296
5 3300046475 Ga0495639_0038260 Ga0495639_0038260_76_972 296
6 3300047471 Ga0495684_0394265 Ga0495684_0394265_50_946 296
7 3300006028 Ga0070717_10023749 Ga0070717_100237492 301
8 3300005518 Ga0070699_100125259 Ga0070699_1001252594 303
9 3300035695 Ga0373927_0000453 Ga0373927_0000453_10920_11849 307
10 3300035725 Ga0373947_0014273 Ga0373947_0014273_2710_3639 307
11 3300037068 Ga0373925_0001233 Ga0373925_0001233_19632_20561 307
12 3300046517 Ga0495630_0011061 Ga0495630_0011061_168_1097 307
13 3300050513 nmdc:mga0rr50_433267_c1 nmdc:mga0rr50_433267_c1_46_984 310
14 3300009545 Ga0105237_10015573 Ga0105237_100155735 311
15 3300013297 Ga0157378_10000402 Ga0157378_1000040230 311
16 3300013307 Ga0157372_10037078 Ga0157372_100370783 311
17 3300014968 Ga0157379_10029161 Ga0157379_100291611 311
18 3300007265 Ga0099794_10078591 Ga0099794_100785912 312
19 3300005937 Ga0081455_10145404 Ga0081455_101454042 313
20 3300039447 Ga0436361_0760811 Ga0436361_0760811_847_1794 313
21 3300035086 Ga0373934_0004563 Ga0373934_0004563_310_1263 314
22 3300035117 Ga0373953_0007311 Ga0373953_0007311_673_1626 314
23 3300035118 Ga0373954_0001535 Ga0373954_0001535_7185_8138 314
24 3300035119 Ga0373956_0001607 Ga0373956_0001607_5761_6714 314
25 3300035172 Ga0373955_0001551 Ga0373955_0001551_1778_2731 314
26 3300035724 Ga0373933_0002293 Ga0373933_0002293_3407_4360 314
27 3300036401 Ga0373937_0010747 Ga0373937_0010747_5979_6932 314
28 3300046462 Ga0495651_0009368 Ga0495651_0009368_1956_2909 314
29 3300046536 Ga0495587_0024100 Ga0495587_0024100_1581_2534 314
30 3300046559 Ga0495667_0046847 Ga0495667_0046847_867_1820 314
31 3300046675 Ga0495657_0092661 Ga0495657_0092661_193_1146 314
32 3300046679 Ga0495623_0043661 Ga0495623_0043661_467_1420 314
33 3300047317 Ga0495604_0000512 Ga0495604_0000512_12221_13174 314
34 3300047322 Ga0495680_0213051 Ga0495680_0213051_172_1125 314
35 3300048088 Ga0495602_0004521 Ga0495602_0004521_3422_4375 314
36 3300053084 Ga0495595_0072210 Ga0495595_0072210_150_1103 314
37 3300013308 Ga0157375_10321773 Ga0157375_103217732 316
38 3300014969 Ga0157376_10000959 Ga0157376_100009594 316
39 3300005547 Ga0070693_100000160 Ga0070693_1000001607 319
40 3300046472 Ga0495580_0081156 Ga0495580_0081156_547_1512 319
41 3300005436 Ga0070713_100121232 Ga0070713_1001212322 321
42 3300005614 Ga0068856_100212447 Ga0068856_1002124472 321
43 3300013104 Ga0157370_10129947 Ga0157370_101299472 321
44 3300025928 Ga0207700_10062913 Ga0207700_100629132 321
45 3300037068 Ga0373925_0291836 Ga0373925_0291836_319_1293 321
46 3300045976 Ga0466967_0183678 Ga0466967_0183678_480_1466 321
47 3300031241 Ga0265325_10009706 Ga0265325_100097062 323
48 3300048915 Ga0496112_0151437 Ga0496112_0151437_1128_2123 323
49 3300005467 Ga0070706_100181223 Ga0070706_1001812232 324
50 3300006173 Ga0070716_100045713 Ga0070716_1000457132 324
51 3300009176 Ga0105242_10331105 Ga0105242_103311051 324
52 3300013297 Ga0157378_10041650 Ga0157378_100416503 324
53 3300014325 Ga0163163_10092364 Ga0163163_100923642 324
54 3300014969 Ga0157376_10000014 Ga0157376_10000014256 324
55 3300025910 Ga0207684_10180702 Ga0207684_101807022 324
56 3300046472 Ga0495580_0001767 Ga0495580_0001767_16577_17551 324
57 3300046473 Ga0495582_0000227 Ga0495582_0000227_17589_18563 324
58 3300048917 Ga0496114_0082076 Ga0496114_0082076_606_1580 324
59 3300048918 Ga0496115_0004128 Ga0496115_0004128_1067_2041 324
60 3300050512 nmdc:mga0n895_18505_c1 nmdc:mga0n895_18505_c1_5202_6176 324
61 3300050515 nmdc:mga0a205_261128_c1 nmdc:mga0a205_261128_c1_266_1240 324
62 3300005434 Ga0070709_10126638 Ga0070709_101266382 326
63 3300005437 Ga0070710_10116657 Ga0070710_101166571 326
64 3300005439 Ga0070711_100016140 Ga0070711_1000161401 326
65 3300006173 Ga0070716_100169640 Ga0070716_1001696401 326
66 3300006175 Ga0070712_100060226 Ga0070712_1000602262 326
67 3300006175 Ga0070712_100065136 Ga0070712_1000651362 326
68 3300021388 Ga0213875_10000055 Ga0213875_10000055129 326
69 3300025906 Ga0207699_10110193 Ga0207699_101101932 326
70 3300037853 Ga0436364_1111922 Ga0436364_1111922_1440_2435 326
71 3300037853 Ga0436364_1528714 Ga0436364_1528714_52108_53112 326
72 3300049823 Ga0501044_0004876 Ga0501044_0004876_3349_4344 326
73 3300005436 Ga0070713_100183791 Ga0070713_1001837912 327
74 3300006028 Ga0070717_10010986 Ga0070717_100109862 327
75 3300006175 Ga0070712_100179631 Ga0070712_1001796312 327
76 3300037853 Ga0436364_1144981 Ga0436364_1144981_2980_4041 327
77 3300005445 Ga0070708_100095821 Ga0070708_1000958212 328
78 3300006173 Ga0070716_100001318 Ga0070716_1000013186 328
79 3300006173 Ga0070716_100286086 Ga0070716_1002860861 328
80 3300006914 Ga0075436_100015059 Ga0075436_1000150594 328
81 3300007265 Ga0099794_10027430 Ga0099794_100274302 328
82 3300007265 Ga0099794_10116482 Ga0099794_101164821 328
83 3300025906 Ga0207699_10061829 Ga0207699_100618291 328
84 3300025939 Ga0207665_10000182 Ga0207665_100001829 328
85 3300025939 Ga0207665_10282314 Ga0207665_102823142 328
86 3300027671 Ga0209588_1030195 Ga0209588_10301951 328
87 3300039453 Ga0436362_0240783 Ga0436362_0240783_1695_2696 328
88 3300050514 nmdc:mga08x19_38871_c1 nmdc:mga08x19_38871_c1_232_1227 328
89 3300005295 Ga0065707_10015311 Ga0065707_100153112 329
90 3300005336 Ga0070680_100029081 Ga0070680_1000290813 329
91 3300005406 Ga0070703_10002455 Ga0070703_100024554 329
92 3300005434 Ga0070709_10000621 Ga0070709_1000062113 329
93 3300005434 Ga0070709_10056591 Ga0070709_100565913 329
94 3300005434 Ga0070709_10136922 Ga0070709_101369222 329
95 3300005434 Ga0070709_10162717 Ga0070709_101627172 329
96 3300005435 Ga0070714_100128660 Ga0070714_1001286604 329
97 3300005436 Ga0070713_100002700 Ga0070713_1000027003 329
98 3300005436 Ga0070713_100011351 Ga0070713_1000113513 329
99 3300005437 Ga0070710_10088897 Ga0070710_100888971 329
100 3300005437 Ga0070710_10245219 Ga0070710_102452191 329
101 3300005439 Ga0070711_100003240 Ga0070711_1000032403 329
102 3300005440 Ga0070705_100004289 Ga0070705_1000042894 329
103 3300005444 Ga0070694_100056299 Ga0070694_1000562993 329
104 3300005445 Ga0070708_100003175 Ga0070708_1000031755 329
105 3300005445 Ga0070708_100004473 Ga0070708_1000044737 329
106 3300005445 Ga0070708_100039864 Ga0070708_1000398642 329
107 3300005445 Ga0070708_100095403 Ga0070708_1000954032 329
108 3300005445 Ga0070708_100327784 Ga0070708_1003277842 329
109 3300005445 Ga0070708_100541147 Ga0070708_1005411471 329
110 3300005467 Ga0070706_100001800 Ga0070706_10000180016 329
111 3300005467 Ga0070706_100028852 Ga0070706_1000288522 329
112 3300005467 Ga0070706_100045818 Ga0070706_1000458186 329
113 3300005468 Ga0070707_100001754 Ga0070707_10000175415 329
114 3300005468 Ga0070707_100116658 Ga0070707_1001166581 329
115 3300005468 Ga0070707_100117111 Ga0070707_1001171114 329
116 3300005468 Ga0070707_100144867 Ga0070707_1001448673 329
117 3300005468 Ga0070707_100194309 Ga0070707_1001943092 329
118 3300005471 Ga0070698_100008875 Ga0070698_1000088754 329
119 3300005471 Ga0070698_100018707 Ga0070698_1000187077 329
120 3300005471 Ga0070698_100046520 Ga0070698_1000465202 329
121 3300005471 Ga0070698_100046539 Ga0070698_1000465394 329
122 3300005518 Ga0070699_100019559 Ga0070699_1000195593 329
123 3300005518 Ga0070699_100073455 Ga0070699_1000734552 329
124 3300005518 Ga0070699_100075515 Ga0070699_1000755153 329
125 3300005518 Ga0070699_100121009 Ga0070699_1001210092 329
126 3300005518 Ga0070699_100529415 Ga0070699_1005294151 329
127 3300005530 Ga0070679_100007444 Ga0070679_1000074444 329
128 3300005530 Ga0070679_100092745 Ga0070679_1000927452 329
129 3300005536 Ga0070697_100000482 Ga0070697_10000048212 329
130 3300005536 Ga0070697_100006655 Ga0070697_1000066555 329
131 3300005536 Ga0070697_100008330 Ga0070697_1000083304 329
132 3300005536 Ga0070697_100020347 Ga0070697_1000203475 329
133 3300005544 Ga0070686_100052199 Ga0070686_1000521993 329
134 3300005544 Ga0070686_100083705 Ga0070686_1000837052 329
135 3300005545 Ga0070695_100006590 Ga0070695_1000065906 329
136 3300005545 Ga0070695_100006999 Ga0070695_1000069994 329
137 3300005546 Ga0070696_100003231 Ga0070696_1000032314 329
138 3300005546 Ga0070696_100008915 Ga0070696_1000089157 329
139 3300005547 Ga0070693_100000521 Ga0070693_10000052112 329
140 3300005548 Ga0070665_100000980 Ga0070665_1000009807 329
141 3300005549 Ga0070704_100017453 Ga0070704_1000174532 329
142 3300005549 Ga0070704_100060857 Ga0070704_1000608571 329
143 3300005549 Ga0070704_100174928 Ga0070704_1001749282 329
144 3300005718 Ga0068866_10066785 Ga0068866_100667852 329
145 3300005841 Ga0068863_100003756 Ga0068863_1000037569 329
146 3300005842 Ga0068858_100078316 Ga0068858_1000783165 329
147 3300005843 Ga0068860_100004519 Ga0068860_10000451911 329
148 3300005843 Ga0068860_100006585 Ga0068860_10000658511 329
149 3300006173 Ga0070716_100002637 Ga0070716_1000026377 329
150 3300006173 Ga0070716_100010195 Ga0070716_1000101952 329
151 3300006173 Ga0070716_100044482 Ga0070716_1000444821 329
152 3300006173 Ga0070716_100059634 Ga0070716_1000596343 329
153 3300006175 Ga0070712_100030575 Ga0070712_1000305754 329
154 3300006175 Ga0070712_100280796 Ga0070712_1002807961 329
155 3300006237 Ga0097621_100001690 Ga0097621_1000016907 329
156 3300006237 Ga0097621_100294371 Ga0097621_1002943711 329
157 3300006358 Ga0068871_100048316 Ga0068871_1000483161 329
158 3300006852 Ga0075433_10254670 Ga0075433_102546703 329
159 3300006871 Ga0075434_100015819 Ga0075434_1000158193 329
160 3300006881 Ga0068865_100108390 Ga0068865_1001083902 329
161 3300006914 Ga0075436_100003881 Ga0075436_10000388110 329
162 3300007076 Ga0075435_100013555 Ga0075435_1000135556 329
163 3300007265 Ga0099794_10009410 Ga0099794_100094102 329
164 3300007265 Ga0099794_10036597 Ga0099794_100365973 329
165 3300007265 Ga0099794_10068231 Ga0099794_100682311 329
166 3300007788 Ga0099795_10019244 Ga0099795_100192441 329
167 3300009177 Ga0105248_10107654 Ga0105248_101076542 329
168 3300009545 Ga0105237_10025208 Ga0105237_100252085 329
169 3300010159 Ga0099796_10003365 Ga0099796_100033654 329
170 3300010159 Ga0099796_10006474 Ga0099796_100064741 329
171 3300010375 Ga0105239_10045745 Ga0105239_100457452 329
172 3300010375 Ga0105239_10291623 Ga0105239_102916231 329
173 3300013297 Ga0157378_10000053 Ga0157378_100000539 329
174 3300013306 Ga0163162_10064338 Ga0163162_100643382 329
175 3300013306 Ga0163162_10069231 Ga0163162_100692312 329
176 3300013307 Ga0157372_10060226 Ga0157372_100602264 329
177 3300014969 Ga0157376_10008433 Ga0157376_100084335 329
178 3300025885 Ga0207653_10002941 Ga0207653_100029413 329
179 3300025898 Ga0207692_10128378 Ga0207692_101283782 329
180 3300025899 Ga0207642_10037169 Ga0207642_100371692 329
181 3300025899 Ga0207642_10125265 Ga0207642_101252652 329
182 3300025906 Ga0207699_10001421 Ga0207699_1000142111 329
183 3300025906 Ga0207699_10073080 Ga0207699_100730801 329
184 3300025906 Ga0207699_10103134 Ga0207699_101031341 329
185 3300025910 Ga0207684_10007281 Ga0207684_100072819 329
186 3300025910 Ga0207684_10049901 Ga0207684_100499016 329
187 3300025910 Ga0207684_10153399 Ga0207684_101533991 329
188 3300025910 Ga0207684_10215481 Ga0207684_102154811 329
189 3300025914 Ga0207671_10144068 Ga0207671_101440681 329
190 3300025914 Ga0207671_10339627 Ga0207671_103396271 329
191 3300025915 Ga0207693_10065335 Ga0207693_100653352 329
192 3300025915 Ga0207693_10161738 Ga0207693_101617381 329
193 3300025915 Ga0207693_10200311 Ga0207693_102003111 329
194 3300025916 Ga0207663_10024571 Ga0207663_100245712 329
195 3300025916 Ga0207663_10026235 Ga0207663_100262353 329
196 3300025917 Ga0207660_10156129 Ga0207660_101561292 329
197 3300025921 Ga0207652_10080534 Ga0207652_100805342 329
198 3300025922 Ga0207646_10000356 Ga0207646_1000035638 329
199 3300025922 Ga0207646_10001667 Ga0207646_1000166725 329
200 3300025928 Ga0207700_10069101 Ga0207700_100691011 329
201 3300025934 Ga0207686_10125598 Ga0207686_101255982 329
202 3300025939 Ga0207665_10002762 Ga0207665_100027625 329
203 3300025939 Ga0207665_10017165 Ga0207665_100171654 329
204 3300025939 Ga0207665_10036852 Ga0207665_100368524 329
205 3300025939 Ga0207665_10044548 Ga0207665_100445481 329
206 3300025939 Ga0207665_10086283 Ga0207665_100862832 329
207 3300025941 Ga0207711_10124481 Ga0207711_101244812 329
208 3300026088 Ga0207641_10008166 Ga0207641_100081669 329
209 3300027671 Ga0209588_1004042 Ga0209588_10040424 329
210 3300027671 Ga0209588_1024622 Ga0209588_10246221 329
211 3300028016 Ga0265354_1000040 Ga0265354_10000403 329
212 3300028016 Ga0265354_1001496 Ga0265354_10014963 329
213 3300028379 Ga0268266_10000072 Ga0268266_1000007224 329
214 3300028800 Ga0265338_10176821 Ga0265338_101768213 329
215 3300031090 Ga0265760_10008133 Ga0265760_100081333 329
216 3300031238 Ga0265332_10094272 Ga0265332_100942722 329
217 3300035086 Ga0373934_0001378 Ga0373934_0001378_7300_8298 329
218 3300035111 Ga0373923_0021166 Ga0373923_0021166_641_1639 329
219 3300035118 Ga0373954_0097190 Ga0373954_0097190_117_1112 329
220 3300035119 Ga0373956_0003382 Ga0373956_0003382_3114_4112 329
221 3300035120 Ga0373957_0001479 Ga0373957_0001479_3005_4003 329
222 3300035172 Ga0373955_0012731 Ga0373955_0012731_1084_2082 329
223 3300035410 Ga0373924_0073584 Ga0373924_0073584_432_1430 329
224 3300035691 Ga0373931_0042395 Ga0373931_0042395_1140_2129 329
225 3300035695 Ga0373927_0070891 Ga0373927_0070891_444_1439 329
226 3300035724 Ga0373933_0001197 Ga0373933_0001197_9414_10412 329
227 3300036401 Ga0373937_0002231 Ga0373937_0002231_6185_7183 329
228 3300039437 Ga0436365_1055445 Ga0436365_1055445_622_1617 329
229 3300046459 Ga0495629_0018068 Ga0495629_0018068_3904_4893 329
230 3300046462 Ga0495651_0021794 Ga0495651_0021794_1867_2865 329
231 3300046462 Ga0495651_0056762 Ga0495651_0056762_1254_2249 329
232 3300046463 Ga0495653_0270094 Ga0495653_0270094_107_1105 329
233 3300046472 Ga0495580_0218147 Ga0495580_0218147_289_1278 329
234 3300046473 Ga0495582_0017798 Ga0495582_0017798_1611_2600 329
235 3300046476 Ga0495662_0061646 Ga0495662_0061646_633_1631 329
236 3300046477 Ga0495664_0049840 Ga0495664_0049840_771_1766 329
237 3300046499 Ga0495594_0017485 Ga0495594_0017485_2552_3541 329
238 3300046516 Ga0495628_0014678 Ga0495628_0014678_971_1969 329
239 3300046526 Ga0495666_0067696 Ga0495666_0067696_405_1403 329
240 3300046531 Ga0495665_0126172 Ga0495665_0126172_160_1149 329
241 3300046533 Ga0495640_0016785 Ga0495640_0016785_1672_2661 329
242 3300046533 Ga0495640_0081526 Ga0495640_0081526_388_1386 329
243 3300046535 Ga0495586_0018628 Ga0495586_0018628_1533_2522 329
244 3300046536 Ga0495587_0032090 Ga0495587_0032090_1370_2365 329
245 3300046536 Ga0495587_0124193 Ga0495587_0124193_145_1143 329
246 3300046543 Ga0495645_0061046 Ga0495645_0061046_102_1100 329
247 3300046663 Ga0495635_0070779 Ga0495635_0070779_1348_2346 329
248 3300046663 Ga0495635_0128207 Ga0495635_0128207_95_1093 329
249 3300046683 Ga0495658_0037049 Ga0495658_0037049_1659_2648 329
250 3300046689 Ga0495613_0015451 Ga0495613_0015451_4107_5096 329
251 3300047315 Ga0495581_0123689 Ga0495581_0123689_152_1141 329
252 3300047315 Ga0495581_0130955 Ga0495581_0130955_62_1060 329
253 3300047317 Ga0495604_0001395 Ga0495604_0001395_13393_14391 329
254 3300047319 Ga0495674_0069915 Ga0495674_0069915_602_1600 329
255 3300047319 Ga0495674_0073415 Ga0495674_0073415_944_1942 329
256 3300047319 Ga0495674_0148325 Ga0495674_0148325_298_1293 329
257 3300047319 Ga0495674_0170213 Ga0495674_0170213_668_1657 329
258 3300047321 Ga0495676_0027554 Ga0495676_0027554_1333_2322 329
259 3300047321 Ga0495676_0179435 Ga0495676_0179435_179_1177 329
260 3300047322 Ga0495680_0041655 Ga0495680_0041655_1009_1998 329
261 3300047471 Ga0495684_0068183 Ga0495684_0068183_956_1945 329
262 3300048088 Ga0495602_0016920 Ga0495602_0016920_137_1135 329
263 3300048089 Ga0495614_0023893 Ga0495614_0023893_1456_2445 329
264 3300048903 Ga0496100_0338567 Ga0496100_0338567_133_1122 329
265 3300048907 Ga0496104_0366231 Ga0496104_0366231_80_1075 329
266 3300048917 Ga0496114_0133909 Ga0496114_0133909_917_1906 329
267 3300048917 Ga0496114_0199798 Ga0496114_0199798_466_1464 329
268 3300048918 Ga0496115_0000977 Ga0496115_0000977_2056_3045 329
269 3300048918 Ga0496115_0052662 Ga0496115_0052662_2205_3200 329
270 3300048929 Ga0496126_0122318 Ga0496126_0122318_219_1286 329
271 3300050512 nmdc:mga0n895_200999_c1 nmdc:mga0n895_200999_c1_86_1075 329
272 3300050513 nmdc:mga0rr50_24240_c1 nmdc:mga0rr50_24240_c1_3066_4055 329
273 3300050514 nmdc:mga08x19_23704_c1 nmdc:mga08x19_23704_c1_675_1670 329
274 3300053077 Ga0495601_0019496 Ga0495601_0019496_122_1117 329
275 3300053077 Ga0495601_0070820 Ga0495601_0070820_1093_2091 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13407

Peripla_BP_4

Periplasmic binding protein domain

70

322

0.97

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

71

306

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g1w-assembly1.cif.gz_A crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.9481 31 318
3g1w-assembly1.cif.gz_A crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.9355 31 318
6gq0-assembly1.cif.gz_A crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus 0.9303 28 314
3g1w-assembly1.cif.gz_B crystal structure of sugar abc transporter (sugar-binding protein) from bacillus halodurans 0.9292 30 318
4zjp-assembly1.cif.gz_A structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose 0.9268 30 312
ID Description Score Start End Superfamily
5ibqA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9396 134 264 3.40.50.2300
3rotB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9369 30 134 3.40.50.2300
2qvcB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9318 33 134 3.40.50.2300
3ksmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9295 33 130 3.40.50.2300
af_P39265_140_289_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9236 139 279 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A149TP35-F1-model_v4 deleted 0.938 76 318
AF-A0A2X3EEJ8-F1-model_v4 Ribose ABC transport system, periplasmic ribose-binding protein RbsB 0.9358 134 242 GO:0030246
GO:0030313
AF-A0A356NYS2-F1-model_v4 LacI family transcriptional regulator 0.9277 27 149 GO:0030246
GO:0030288
AF-A0A6P2B264-F1-model_v4 Periplasmic binding protein domain-containing protein 0.9272 30 311 GO:0030246
GO:0030313
AF-A0A3Q8SCB3-F1-model_v4 Sugar ABC transporter substrate-binding protein 0.9263 23 320 GO:0016020
GO:0030246
GO:0030313

Feature Viewer

pLDDT pTM Quality
90.86 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map