F380278

General Info

Members Datasets Scaffolds Average Seq Length
275 211 550 105

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_101299146|Ga0068855_1012991462
Length 111
Sequence MPRKEWSAKRERQYKHIKESAKDRGEGEDRAEEIAARTVNKERARHGESKTASRLSKKDVSSGHRGGKRSHSGAQGRTKEQLYNEAKQLGVEGRSKMNKASLQRAVDARKR

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
133 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
134 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
147 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
151 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
155 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
156 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
182 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
183 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
187 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
188 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
189 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
190 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
191 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
192 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
193 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
194 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
195 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
196 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
197 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
198 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
199 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
200 2858882152 Micromonospora noduli MED15 Isolate Nodule
201 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
202 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
203 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
204 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
205 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
206 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
207 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
208 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
209 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
210 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
211 8054704163 Micromonospora trifolii NIE79 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.55
Metatranscriptomes 1.82
Isolates 7.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8
Nodule 1.09
Rhizoplane 4.36
Rhizosphere 69.82
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_101299146 3300005563 Bacteria 753
2 JGI24735J21928_10110630 3300002067 Bacteria 790
3 Ga0006777J48905_1088202 3300003308 Bacteria 565
4 rootH2_10057168 3300003320 Bacteria 2506
5 rootH1_10127132 3300003323 Bacteria 4292
6 Ga0007427J51700_111847 3300003559 Bacteria 1818
7 Ga0070676_10104755 3300005328 Bacteria 1753
8 Ga0070683_100039947 3300005329 Bacteria 4310
9 Ga0070670_100146738 3300005331 Bacteria 2041
10 Ga0070670_100851532 3300005331 Bacteria 825
11 Ga0068869_100165122 3300005334 Bacteria 1726
12 Ga0068869_100243980 3300005334 Bacteria 1432
13 Ga0070680_100186987 3300005336 Bacteria 1745
14 Ga0070680_100344781 3300005336 Bacteria 1266
15 Ga0070682_101857281 3300005337 Bacteria 527
16 Ga0068868_100004164 3300005338 Bacteria 10112
17 Ga0070660_100210311 3300005339 Bacteria 1579
18 Ga0070661_100006073 3300005344 Bacteria 8312
19 Ga0070692_10027141 3300005345 Bacteria 2835
20 Ga0070668_100004973 3300005347 Bacteria 9840
21 Ga0070668_100123734 3300005347 Bacteria 2070
22 Ga0070675_100003280 3300005354 Bacteria 12275
23 Ga0070667_100027767 3300005367 Bacteria 4709
24 Ga0070667_101627361 3300005367 Bacteria 607
25 Ga0070709_10245483 3300005434 Bacteria 1287
26 Ga0070714_100011246 3300005435 Bacteria 7095
27 Ga0070713_101080605 3300005436 Bacteria 775
28 Ga0070713_101759805 3300005436 Bacteria 601
29 Ga0070711_100644685 3300005439 Bacteria 887
30 Ga0070700_100023303 3300005441 Bacteria 3619
31 Ga0070708_101616159 3300005445 Bacteria 603
32 Ga0070678_101604772 3300005456 Bacteria 611
33 Ga0070662_101096652 3300005457 Bacteria 683
34 Ga0070685_10124577 3300005466 Bacteria 1604
35 Ga0068853_100157087 3300005539 Bacteria 2050
36 Ga0068853_101288801 3300005539 Bacteria 706
37 Ga0070672_101279001 3300005543 Bacteria 655
38 Ga0070696_100047902 3300005546 Bacteria 2967
39 Ga0070696_100772156 3300005546 Bacteria 789
40 Ga0070693_100196226 3300005547 Bacteria 1308
41 Ga0070665_100855396 3300005548 Bacteria 922
42 Ga0070664_100003419 3300005564 Bacteria 12823
43 Ga0068857_100007646 3300005577 Bacteria 9307
44 Ga0068854_100807193 3300005578 Bacteria 818
45 Ga0068852_100855685 3300005616 Bacteria 925
46 Ga0068866_10551041 3300005718 Bacteria 771
47 Ga0068861_100621598 3300005719 Bacteria 994
48 Ga0068861_100624554 3300005719 Bacteria 992
49 Ga0068858_100116428 3300005842 Bacteria 2498
50 Ga0068860_101055939 3300005843 Bacteria 831
51 Ga0081540_1028575 3300005983 Bacteria 3128
52 Ga0081540_1160807 3300005983 Bacteria 871
53 Ga0081539_10005140 3300005985 Bacteria 13643
54 Ga0081539_10131923 3300005985 Bacteria 1226
55 Ga0075368_10357406 3300006042 Bacteria 637
56 Ga0075363_100040057 3300006048 Bacteria 2468
57 Ga0070715_10709964 3300006163 Bacteria 601
58 Ga0075362_10228392 3300006177 Bacteria 911
59 Ga0075369_10458702 3300006186 Bacteria 604
60 Ga0075366_10130525 3300006195 Bacteria 1516
61 Ga0075370_10456175 3300006353 Bacteria 769
62 Ga0068871_100381484 3300006358 Bacteria 1252
63 Ga0075428_101082839 3300006844 Bacteria 847
64 Ga0075430_100368330 3300006846 Bacteria 1186
65 Ga0075431_100979851 3300006847 Bacteria 813
66 Ga0068865_100383197 3300006881 Bacteria 1147
67 Ga0111539_10014307 3300009094 Bacteria 9907
68 Ga0111539_12534906 3300009094 Bacteria 595
69 Ga0105245_10033207 3300009098 Bacteria 4573
70 Ga0105245_11192028 3300009098 Bacteria 809
71 Ga0105243_10874371 3300009148 Bacteria 892
72 Ga0105243_11706870 3300009148 Bacteria 659
73 Ga0105242_10851555 3300009176 Bacteria 907
74 Ga0105237_10120877 3300009545 Bacteria 2614
75 Ga0105237_11968691 3300009545 Bacteria 593
76 Ga0105238_10293879 3300009551 Bacteria 1607
77 Ga0105032_108415 3300009979 Bacteria 849
78 Ga0105239_10084830 3300010375 Bacteria 3490
79 Ga0105239_10805093 3300010375 Bacteria 1077
80 Ga0105246_10046465 3300011119 Bacteria 2961
81 Ga0157378_12608808 3300013297 Bacteria 558
82 Ga0163162_12002206 3300013306 Bacteria 664
83 Ga0157372_10589740 3300013307 Bacteria 1295
84 Ga0163163_10113027 3300014325 Bacteria 2745
85 Ga0163163_10711911 3300014325 Bacteria 1068
86 Ga0157377_10013380 3300014745 Bacteria 4151
87 Ga0157376_11928170 3300014969 Bacteria 628
88 Ga0206350_11471106 3300020080 Bacteria 977
89 Ga0224712_10269711 3300022467 Bacteria 790
90 Ga0224712_10323111 3300022467 Bacteria 725
91 Ga0207699_10083684 3300025906 Bacteria 1985
92 Ga0207645_10111531 3300025907 Bacteria 1771
93 Ga0207643_10072409 3300025908 Bacteria 1985
94 Ga0207671_10218254 3300025914 Bacteria 1493
95 Ga0207693_10143694 3300025915 Bacteria 1876
96 Ga0207663_10108275 3300025916 Bacteria 1881
97 Ga0207663_11493688 3300025916 Bacteria 544
98 Ga0207660_10305597 3300025917 Bacteria 1267
99 Ga0207649_10021430 3300025920 Bacteria 3721
100 Ga0207652_11750727 3300025921 Bacteria 526
101 Ga0207694_10480085 3300025924 Bacteria 1040
102 Ga0207650_10462141 3300025925 Bacteria 1057
103 Ga0207650_10725609 3300025925 Bacteria 840
104 Ga0207659_10105547 3300025926 Bacteria 2132
105 Ga0207687_10046245 3300025927 Bacteria 3012
106 Ga0207700_11592542 3300025928 Bacteria 578
107 Ga0207700_11753887 3300025928 Bacteria 547
108 Ga0207664_10144012 3300025929 Bacteria 2019
109 Ga0207690_10059656 3300025932 Bacteria 2586
110 Ga0207706_11265271 3300025933 Bacteria 611
111 Ga0207686_10621842 3300025934 Bacteria 852
112 Ga0207704_11168077 3300025938 Bacteria 656
113 Ga0207665_11135742 3300025939 Bacteria 623
114 Ga0207689_10003509 3300025942 Bacteria 14324
115 Ga0207689_10827621 3300025942 Bacteria 781
116 Ga0207661_10026201 3300025944 Bacteria 4440
117 Ga0207679_10014789 3300025945 Bacteria 5139
118 Ga0207668_10031345 3300025972 Bacteria 3501
119 Ga0207668_10614444 3300025972 Bacteria 948
120 Ga0207640_10271315 3300025981 Bacteria 1327
121 Ga0207640_10654328 3300025981 Bacteria 896
122 Ga0207658_10355463 3300025986 Bacteria 1277
123 Ga0207677_11666360 3300026023 Bacteria 591
124 Ga0207703_10107606 3300026035 Bacteria 2374
125 Ga0207703_10275256 3300026035 Bacteria 1526
126 Ga0207639_10980513 3300026041 Bacteria 791
127 Ga0207678_10119547 3300026067 Bacteria 2248
128 Ga0207708_10038435 3300026075 Bacteria 3646
129 Ga0207641_11403127 3300026088 Bacteria 699
130 Ga0207674_10123910 3300026116 Bacteria 2550
131 Ga0207675_100376958 3300026118 Bacteria 1394
132 Ga0207675_100839510 3300026118 Bacteria 933
133 Ga0207683_10260643 3300026121 Bacteria 1583
134 Ga0207698_10167117 3300026142 Bacteria 1932
135 Ga0209998_10054641 3300027717 Bacteria 931
136 Ga0209974_10005748 3300027876 Bacteria 4349
137 Ga0207428_10026517 3300027907 Bacteria 4838
138 Ga0268266_10025429 3300028379 Bacteria 5037
139 Ga0268264_11146858 3300028381 Bacteria 786
140 Ga0307515_10000149 3300028794 Bacteria 169663
141 Ga0307515_10006206 3300028794 Bacteria 24005
142 Ga0307515_10726510 3300028794 Bacteria 610
143 Ga0307512_10040986 3300030522 Bacteria 3854
144 Ga0307513_10000693 3300031456 Bacteria 48399
145 Ga0307513_10117902 3300031456 Bacteria 2631
146 Ga0307513_10145923 3300031456 Bacteria 2284
147 Ga0307513_10281482 3300031456 Bacteria 1440
148 Ga0307513_10427548 3300031456 Bacteria 1053
149 Ga0307509_10642175 3300031507 Bacteria 731
150 Ga0307408_101452833 3300031548 Unclassified 647
151 Ga0307508_10005723 3300031616 Bacteria 11764
152 Ga0307508_10175178 3300031616 Bacteria 1748
153 Ga0307514_10429235 3300031649 Bacteria 660
154 Ga0307516_10001431 3300031730 Bacteria 32975
155 Ga0307516_10002120 3300031730 Bacteria 26892
156 Ga0307516_10013428 3300031730 Bacteria 8729
157 Ga0307516_10015062 3300031730 Bacteria 8151
158 Ga0307516_10020984 3300031730 Bacteria 6738
159 Ga0307516_10056201 3300031730 Bacteria 3838
160 Ga0307405_11400259 3300031731 Bacteria 611
161 Ga0307405_11745683 3300031731 Bacteria 552
162 Ga0307405_12089848 3300031731 Bacteria 508
163 Ga0307413_10719799 3300031824 Bacteria 831
164 Ga0307413_11348099 3300031824 Bacteria 626
165 Ga0307413_11350322 3300031824 Bacteria 625
166 Ga0307413_12034561 3300031824 Bacteria 518
167 Ga0307406_10131095 3300031901 Bacteria 1760
168 Ga0307406_10193455 3300031901 Bacteria 1491
169 Ga0307406_10412807 3300031901 Bacteria 1073
170 Ga0307406_10452215 3300031901 Bacteria 1031
171 Ga0307406_10744652 3300031901 Bacteria 822
172 Ga0307407_10584451 3300031903 Bacteria 830
173 Ga0307407_10923895 3300031903 Bacteria 671
174 Ga0307407_10984410 3300031903 Bacteria 651
175 Ga0307412_11162694 3300031911 Bacteria 689
176 Ga0307409_100290270 3300031995 Bacteria 1517
177 Ga0307409_100690013 3300031995 Bacteria 1019
178 Ga0307409_100911570 3300031995 Bacteria 893
179 Ga0307409_102181900 3300031995 Bacteria 583
180 Ga0307416_100168611 3300032002 Bacteria 2035
181 Ga0307416_102551562 3300032002 Bacteria 609
182 Ga0307415_100010172 3300032126 Bacteria 5315
183 Ga0307415_100032103 3300032126 Bacteria 3392
184 Ga0307415_100210377 3300032126 Bacteria 1551
185 Ga0307415_100850588 3300032126 Bacteria 837
186 Ga0307507_10038998 3300033179 Bacteria 4802
187 Ga0307510_10412140 3300033180 Bacteria 794
188 Ga0373930_0057935 3300034816 Bacteria 859
189 Ga0373950_0067494 3300034818 Bacteria 728
190 Ga0373959_0049715 3300034820 Bacteria 902
191 Ga0373938_0138607 3300034957 Bacteria 640
192 Ga0373929_0026235 3300035085 Bacteria 1216
193 Ga0373940_0004558 3300035088 Bacteria 2937
194 Ga0373932_0068767 3300035112 Bacteria 1094
195 Ga0373932_0119982 3300035112 Bacteria 876
196 Ga0373941_0382959 3300035115 Bacteria 578
197 Ga0373942_0028852 3300035207 Bacteria 1452
198 Ga0373962_0002306 3300035242 Bacteria 4556
199 Ga0373962_0282270 3300035242 Bacteria 584
200 Ga0373931_0760971 3300035691 Bacteria 643
201 Ga0373935_0337060 3300035692 Bacteria 1073
202 Ga0395900_1922251 3300037418 Bacteria 502
203 Ga0395901_1173823 3300038443 Bacteria 735
204 Ga0451791_0387691 3300041451 Bacteria 576
205 Ga0451791_0644800 3300041451 Bacteria 790
206 Ga0451795_0269440 3300041456 Bacteria 955
207 Ga0451802_0075599 3300041460 Bacteria 2564
208 Ga0451802_1011527 3300041460 Bacteria 633
209 Ga0451804_0670704 3300041463 Bacteria 564
210 Ga0451841_1152729 3300041498 Bacteria 660
211 Ga0451845_0800581 3300041501 Bacteria 748
212 Ga0451849_0135873 3300041505 Bacteria 1893
213 Ga0451851_1207642 3300041507 Bacteria 977
214 Ga0451843_0590563 3300041509 Bacteria 1410
215 Ga0451855_0037537 3300041511 Bacteria 1042
216 Ga0451853_3323476 3300041512 Bacteria 2458
217 Ga0466967_1518474 3300045976 Bacteria 667
218 Ga0495629_0104245 3300046459 Bacteria 1978
219 Ga0495594_0141470 3300046499 Bacteria 1365
220 Ga0495610_0010209 3300046512 Bacteria 5857
221 Ga0495610_0201483 3300046512 Bacteria 815
222 Ga0495632_0065606 3300046519 Bacteria 1753
223 Ga0495643_0099660 3300046522 Bacteria 1490
224 Ga0495625_0001839 3300046660 Bacteria 24238
225 Ga0495671_0581553 3300046692 Bacteria 533
226 Ga0495649_0627854 3300046694 Bacteria 529
227 Ga0495686_0027234 3300047472 Bacteria 3734
228 Ga0496104_0508166 3300048907 Bacteria 1116
229 Ga0496108_0000056 3300048911 Bacteria 124850
230 Ga0496108_0343265 3300048911 Bacteria 1303
231 Ga0496110_0057808 3300048913 Bacteria 3415
232 Ga0496112_0360013 3300048915 Bacteria 1397
233 Ga0496112_1510354 3300048915 Bacteria 585
234 Ga0496124_0576997 3300048927 Bacteria 737
235 nmdc:mga03n38_608598_c1 3300050490 Bacteria 623
236 nmdc:mga0k408_485624_c1 3300050493 Bacteria 733
237 nmdc:mga07m45_265887_c1 3300050496 Bacteria 998
238 nmdc:mga09592_631845_c1 3300050508 Bacteria 915
239 nmdc:mga0qj67_334035_c1 3300050509 Bacteria 1226
240 nmdc:mga06r32_926074_c1 3300050510 Bacteria 827
241 nmdc:mga08y16_236963_c1 3300050511 Bacteria 1887
242 Ga0500644_0187596 3300053088 Bacteria 849
243 Ga0500644_0493551 3300053088 Bacteria 538
244 Ga0500651_0631560 3300053093 Bacteria 578
245 Ga0500641_0201133 3300053096 Bacteria 850
246 Ga0500650_0138547 3300053098 Bacteria 1129
247 Ga0500652_058424 3300053131 Bacteria 1584
248 Ga0500658_0046285 3300053134 Bacteria 1761
249 Ga0500573_0303695 3300053140 Bacteria 796
250 Ga0500579_064928 3300053143 Bacteria 2143
251 Ga0500630_126215 3300053159 Bacteria 1125
252 Ga0500633_0219402 3300053160 Bacteria 710
253 Ga0500611_026595 3300053727 Bacteria 1158
254 Ga0500587_007233 3300053739 Bacteria 1450
255 2587754732 2585428062 Bacteria 6842168
256 2643947312 2643221587 Bacteria 7586415
257 2644433217 2643221677 Bacteria 7584031
258 2676483022 2675903059 Bacteria 8644972
259 2753265896 2751185782 Bacteria 11227053
260 2855673628 2855670206 Bacteria 7120389
261 2855677935 2855676851 Bacteria 7063653
262 2857291091 2857288857 Bacteria 7189066
263 2858854024 2858848962 Bacteria 6963058
264 2858887007 2858882152 Bacteria 7230291
265 2858894490 2858888857 Bacteria 7060307
266 2858896407 2858895516 Bacteria 7378898
267 2867314875 2867312974 Bacteria 7058875
268 2867322112 2867319477 Bacteria 7069771
269 2869048903 2869048445 Bacteria 6875584
270 2869066726 2869061728 Bacteria 7112407
271 2869069373 2869068681 Bacteria 7205615
272 2880495751 2880489317 Bacteria 7096270
273 2880496595 2880495981 Bacteria 7340502
274 2929231802 2929226422 Bacteria 7248583
275 8054704848 8054704163 Bacteria 7247792
276 Ga0068855_101299146
277 JGI24735J21928_10110630
278 Ga0006777J48905_1088202
279 rootH2_10057168
280 rootH1_10127132
281 Ga0007427J51700_111847
282 Ga0070676_10104755
283 Ga0070683_100039947
284 Ga0070670_100146738
285 Ga0070670_100851532
286 Ga0068869_100165122
287 Ga0068869_100243980
288 Ga0070680_100186987
289 Ga0070680_100344781
290 Ga0070682_101857281
291 Ga0068868_100004164
292 Ga0070660_100210311
293 Ga0070661_100006073
294 Ga0070692_10027141
295 Ga0070668_100004973
296 Ga0070668_100123734
297 Ga0070675_100003280
298 Ga0070667_100027767
299 Ga0070667_101627361
300 Ga0070709_10245483
301 Ga0070714_100011246
302 Ga0070713_101080605
303 Ga0070713_101759805
304 Ga0070711_100644685
305 Ga0070700_100023303
306 Ga0070708_101616159
307 Ga0070678_101604772
308 Ga0070662_101096652
309 Ga0070685_10124577
310 Ga0068853_100157087
311 Ga0068853_101288801
312 Ga0070672_101279001
313 Ga0070696_100047902
314 Ga0070696_100772156
315 Ga0070693_100196226
316 Ga0070665_100855396
317 Ga0070664_100003419
318 Ga0068857_100007646
319 Ga0068854_100807193
320 Ga0068852_100855685
321 Ga0068866_10551041
322 Ga0068861_100621598
323 Ga0068861_100624554
324 Ga0068858_100116428
325 Ga0068860_101055939
326 Ga0081540_1028575
327 Ga0081540_1160807
328 Ga0081539_10005140
329 Ga0081539_10131923
330 Ga0075368_10357406
331 Ga0075363_100040057
332 Ga0070715_10709964
333 Ga0075362_10228392
334 Ga0075369_10458702
335 Ga0075366_10130525
336 Ga0075370_10456175
337 Ga0068871_100381484
338 Ga0075428_101082839
339 Ga0075430_100368330
340 Ga0075431_100979851
341 Ga0068865_100383197
342 Ga0111539_10014307
343 Ga0111539_12534906
344 Ga0105245_10033207
345 Ga0105245_11192028
346 Ga0105243_10874371
347 Ga0105243_11706870
348 Ga0105242_10851555
349 Ga0105237_10120877
350 Ga0105237_11968691
351 Ga0105238_10293879
352 Ga0105032_108415
353 Ga0105239_10084830
354 Ga0105239_10805093
355 Ga0105246_10046465
356 Ga0157378_12608808
357 Ga0163162_12002206
358 Ga0157372_10589740
359 Ga0163163_10113027
360 Ga0163163_10711911
361 Ga0157377_10013380
362 Ga0157376_11928170
363 Ga0206350_11471106
364 Ga0224712_10269711
365 Ga0224712_10323111
366 Ga0207699_10083684
367 Ga0207645_10111531
368 Ga0207643_10072409
369 Ga0207671_10218254
370 Ga0207693_10143694
371 Ga0207663_10108275
372 Ga0207663_11493688
373 Ga0207660_10305597
374 Ga0207649_10021430
375 Ga0207652_11750727
376 Ga0207694_10480085
377 Ga0207650_10462141
378 Ga0207650_10725609
379 Ga0207659_10105547
380 Ga0207687_10046245
381 Ga0207700_11592542
382 Ga0207700_11753887
383 Ga0207664_10144012
384 Ga0207690_10059656
385 Ga0207706_11265271
386 Ga0207686_10621842
387 Ga0207704_11168077
388 Ga0207665_11135742
389 Ga0207689_10003509
390 Ga0207689_10827621
391 Ga0207661_10026201
392 Ga0207679_10014789
393 Ga0207668_10031345
394 Ga0207668_10614444
395 Ga0207640_10271315
396 Ga0207640_10654328
397 Ga0207658_10355463
398 Ga0207677_11666360
399 Ga0207703_10107606
400 Ga0207703_10275256
401 Ga0207639_10980513
402 Ga0207678_10119547
403 Ga0207708_10038435
404 Ga0207641_11403127
405 Ga0207674_10123910
406 Ga0207675_100376958
407 Ga0207675_100839510
408 Ga0207683_10260643
409 Ga0207698_10167117
410 Ga0209998_10054641
411 Ga0209974_10005748
412 Ga0207428_10026517
413 Ga0268266_10025429
414 Ga0268264_11146858
415 Ga0307515_10000149
416 Ga0307515_10006206
417 Ga0307515_10726510
418 Ga0307512_10040986
419 Ga0307513_10000693
420 Ga0307513_10117902
421 Ga0307513_10145923
422 Ga0307513_10281482
423 Ga0307513_10427548
424 Ga0307509_10642175
425 Ga0307408_101452833
426 Ga0307508_10005723
427 Ga0307508_10175178
428 Ga0307514_10429235
429 Ga0307516_10001431
430 Ga0307516_10002120
431 Ga0307516_10013428
432 Ga0307516_10015062
433 Ga0307516_10020984
434 Ga0307516_10056201
435 Ga0307405_11400259
436 Ga0307405_11745683
437 Ga0307405_12089848
438 Ga0307413_10719799
439 Ga0307413_11348099
440 Ga0307413_11350322
441 Ga0307413_12034561
442 Ga0307406_10131095
443 Ga0307406_10193455
444 Ga0307406_10412807
445 Ga0307406_10452215
446 Ga0307406_10744652
447 Ga0307407_10584451
448 Ga0307407_10923895
449 Ga0307407_10984410
450 Ga0307412_11162694
451 Ga0307409_100290270
452 Ga0307409_100690013
453 Ga0307409_100911570
454 Ga0307409_102181900
455 Ga0307416_100168611
456 Ga0307416_102551562
457 Ga0307415_100010172
458 Ga0307415_100032103
459 Ga0307415_100210377
460 Ga0307415_100850588
461 Ga0307507_10038998
462 Ga0307510_10412140
463 Ga0373930_0057935
464 Ga0373950_0067494
465 Ga0373959_0049715
466 Ga0373938_0138607
467 Ga0373929_0026235
468 Ga0373940_0004558
469 Ga0373932_0068767
470 Ga0373932_0119982
471 Ga0373941_0382959
472 Ga0373942_0028852
473 Ga0373962_0002306
474 Ga0373962_0282270
475 Ga0373931_0760971
476 Ga0373935_0337060
477 Ga0395900_1922251
478 Ga0395901_1173823
479 Ga0451791_0387691
480 Ga0451791_0644800
481 Ga0451795_0269440
482 Ga0451802_0075599
483 Ga0451802_1011527
484 Ga0451804_0670704
485 Ga0451841_1152729
486 Ga0451845_0800581
487 Ga0451849_0135873
488 Ga0451851_1207642
489 Ga0451843_0590563
490 Ga0451855_0037537
491 Ga0451853_3323476
492 Ga0466967_1518474
493 Ga0495629_0104245
494 Ga0495594_0141470
495 Ga0495610_0010209
496 Ga0495610_0201483
497 Ga0495632_0065606
498 Ga0495643_0099660
499 Ga0495625_0001839
500 Ga0495671_0581553
501 Ga0495649_0627854
502 Ga0495686_0027234
503 Ga0496104_0508166
504 Ga0496108_0000056
505 Ga0496108_0343265
506 Ga0496110_0057808
507 Ga0496112_0360013
508 Ga0496112_1510354
509 Ga0496124_0576997
510 nmdc:mga03n38_608598_c1
511 nmdc:mga0k408_485624_c1
512 nmdc:mga07m45_265887_c1
513 nmdc:mga09592_631845_c1
514 nmdc:mga0qj67_334035_c1
515 nmdc:mga06r32_926074_c1
516 nmdc:mga08y16_236963_c1
517 Ga0500644_0187596
518 Ga0500644_0493551
519 Ga0500651_0631560
520 Ga0500641_0201133
521 Ga0500650_0138547
522 Ga0500652_058424
523 Ga0500658_0046285
524 Ga0500573_0303695
525 Ga0500579_064928
526 Ga0500630_126215
527 Ga0500633_0219402
528 Ga0500611_026595
529 Ga0500587_007233
530 2587754732
531 2643947312
532 2644433217
533 2676483022
534 2753265896
535 2855673628
536 2855677935
537 2857291091
538 2858854024
539 2858887007
540 2858894490
541 2858896407
542 2867314875
543 2867322112
544 2869048903
545 2869066726
546 2869069373
547 2880495751
548 2880496595
549 2929231802
550 8054704848

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map