F380236

General Info

Members Datasets Scaffolds Average Seq Length
275 201 550 138

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100449648|Ga0070700_1004496481
Length 149
Sequence VTGAGHNVAMTFQDLMAGPPPTHLPPDPAADELAAGSEAVDVVRSHPESPVAWATLAEQALAGDADSVTDVTAYAYARVGYHRSLDQLRRNGWKGNGPVPWEHEPNRGFLRALAALAVAADRIGETPEAERCAGFLRDSSPAAYDALLG

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
89 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
90 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
91 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
94 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
121 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
122 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
196 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
197 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
198 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
199 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
200 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
201 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 1.45
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 4
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100449648 3300005441 Bacteria 980
2 Ga0070690_100174456 3300005330 Bacteria 1481
3 Ga0070670_101273437 3300005331 Bacteria 673
4 Ga0070687_100095555 3300005343 Bacteria 1653
5 Ga0070674_100326412 3300005356 Bacteria 1232
6 Ga0070673_100055072 3300005364 Bacteria 3132
7 Ga0070659_100039911 3300005366 Bacteria 3666
8 Ga0070709_10557558 3300005434 Bacteria 877
9 Ga0070709_10672276 3300005434 Bacteria 803
10 Ga0070714_100806191 3300005435 Bacteria 909
11 Ga0070714_100979189 3300005435 Bacteria 823
12 Ga0070714_101227618 3300005435 Bacteria 731
13 Ga0070714_101460411 3300005435 Bacteria 668
14 Ga0070710_10066741 3300005437 Bacteria 2063
15 Ga0070710_10205885 3300005437 Bacteria 1245
16 Ga0070710_10572837 3300005437 Bacteria 782
17 Ga0070711_100201422 3300005439 Bacteria 1536
18 Ga0070711_100552270 3300005439 Bacteria 956
19 Ga0070708_100007705 3300005445 Bacteria 8629
20 Ga0070708_100116859 3300005445 Bacteria 2456
21 Ga0070662_100305878 3300005457 Bacteria 1293
22 Ga0070706_100002348 3300005467 Bacteria 19095
23 Ga0070706_100022981 3300005467 Bacteria 5743
24 Ga0070706_100237889 3300005467 Bacteria 1700
25 Ga0070707_100044093 3300005468 Bacteria 4269
26 Ga0070707_100159925 3300005468 Bacteria 2195
27 Ga0070707_100826231 3300005468 Bacteria 890
28 Ga0070707_101301291 3300005468 Bacteria 693
29 Ga0070698_100005490 3300005471 Bacteria 13840
30 Ga0070698_100160770 3300005471 Bacteria 2190
31 Ga0070699_100001321 3300005518 Bacteria 22865
32 Ga0070679_100298257 3300005530 Bacteria 1562
33 Ga0070679_100565503 3300005530 Bacteria 1081
34 Ga0070684_100041613 3300005535 Bacteria 3962
35 Ga0070697_100462949 3300005536 Bacteria 1105
36 Ga0068853_100047290 3300005539 Bacteria 3691
37 Ga0070695_100045153 3300005545 Bacteria 2807
38 Ga0070696_100271550 3300005546 Bacteria 1289
39 Ga0068855_100020321 3300005563 Bacteria 7967
40 Ga0068855_100699847 3300005563 Bacteria 1084
41 Ga0070664_100736768 3300005564 Bacteria 919
42 Ga0070664_101809597 3300005564 Bacteria 579
43 Ga0070702_100011959 3300005615 Bacteria 4332
44 Ga0068851_10019292 3300005834 Bacteria 3294
45 Ga0068870_10385973 3300005840 Bacteria 908
46 Ga0068862_100061299 3300005844 Bacteria 3233
47 Ga0081540_1000501 3300005983 Bacteria 38501
48 Ga0070717_10027815 3300006028 Bacteria 4521
49 Ga0070717_10078041 3300006028 Bacteria 2774
50 Ga0075365_10102909 3300006038 Bacteria 1957
51 Ga0075365_10611322 3300006038 Bacteria 771
52 Ga0070715_10236633 3300006163 Bacteria 947
53 Ga0070716_100018653 3300006173 Bacteria 3617
54 Ga0070712_100076426 3300006175 Bacteria 2411
55 Ga0070712_100634336 3300006175 Bacteria 907
56 Ga0068871_100084878 3300006358 Bacteria 2628
57 Ga0075431_100557416 3300006847 Bacteria 1133
58 Ga0075434_101904433 3300006871 Bacteria 600
59 Ga0075429_100018498 3300006880 Bacteria 6035
60 Ga0075435_100628713 3300007076 Bacteria 931
61 Ga0105251_10041420 3300009011 Bacteria 2242
62 Ga0105250_10226043 3300009092 Bacteria 795
63 Ga0105240_10055790 3300009093 Bacteria 4946
64 Ga0105240_10124890 3300009093 Bacteria 3094
65 Ga0105242_10237225 3300009176 Bacteria 1638
66 Ga0105248_11439239 3300009177 Bacteria 780
67 Ga0105248_12618975 3300009177 Bacteria 575
68 Ga0105238_10315106 3300009551 Bacteria 1550
69 Ga0105238_10362579 3300009551 Bacteria 1439
70 Ga0105239_11029280 3300010375 Bacteria 947
71 Ga0105246_10196305 3300011119 Bacteria 1566
72 Ga0157346_1011069 3300012480 Bacteria 664
73 Ga0157373_10125140 3300013100 Bacteria 1808
74 Ga0157371_10641716 3300013102 Bacteria 792
75 Ga0157370_10004912 3300013104 Bacteria 15148
76 Ga0157370_11347967 3300013104 Bacteria 642
77 Ga0157369_10081765 3300013105 Bacteria 3457
78 Ga0157374_10966239 3300013296 Bacteria 871
79 Ga0157372_11344032 3300013307 Bacteria 824
80 Ga0157375_10013638 3300013308 Bacteria 7243
81 Ga0182008_10147509 3300014497 Bacteria 1179
82 Ga0157379_10719509 3300014968 Bacteria 938
83 Ga0197907_10989865 3300020069 Bacteria 985
84 Ga0206356_10118909 3300020070 Bacteria 1051
85 Ga0206353_10336350 3300020082 Bacteria 1074
86 Ga0206353_11608682 3300020082 Bacteria 716
87 Ga0213873_10033116 3300021358 Bacteria 1295
88 Ga0213873_10082974 3300021358 Bacteria 900
89 Ga0213875_10000279 3300021388 Bacteria 50175
90 Ga0213875_10000937 3300021388 Bacteria 20973
91 Ga0213875_10124920 3300021388 Bacteria 1202
92 Ga0213875_10164744 3300021388 Bacteria 1040
93 Ga0213875_10296855 3300021388 Bacteria 764
94 Ga0207692_10052334 3300025898 Bacteria 2075
95 Ga0207692_10240343 3300025898 Bacteria 1081
96 Ga0207692_10553475 3300025898 Bacteria 735
97 Ga0207642_10046202 3300025899 Bacteria 1938
98 Ga0207645_10700980 3300025907 Bacteria 688
99 Ga0207684_10002992 3300025910 Bacteria 16750
100 Ga0207684_10019262 3300025910 Bacteria 5839
101 Ga0207684_10186977 3300025910 Bacteria 1786
102 Ga0207654_10679783 3300025911 Bacteria 739
103 Ga0207707_11238079 3300025912 Bacteria 602
104 Ga0207695_10217674 3300025913 Bacteria 1818
105 Ga0207693_10124706 3300025915 Bacteria 2024
106 Ga0207693_10220828 3300025915 Bacteria 1489
107 Ga0207662_10006370 3300025918 Bacteria 6368
108 Ga0207652_10721530 3300025921 Bacteria 888
109 Ga0207646_10021067 3300025922 Bacteria 6029
110 Ga0207646_10264542 3300025922 Bacteria 1554
111 Ga0207646_10831649 3300025922 Bacteria 821
112 Ga0207694_10633694 3300025924 Bacteria 900
113 Ga0207659_10100305 3300025926 Bacteria 2182
114 Ga0207700_10466770 3300025928 Bacteria 1114
115 Ga0207664_10315826 3300025929 Bacteria 1378
116 Ga0207664_10321144 3300025929 Bacteria 1366
117 Ga0207664_10575663 3300025929 Bacteria 1011
118 Ga0207706_10016987 3300025933 Bacteria 6565
119 Ga0207691_10268342 3300025940 Bacteria 1470
120 Ga0207689_10036845 3300025942 Bacteria 4060
121 Ga0207661_10257595 3300025944 Bacteria 1553
122 Ga0207651_10773675 3300025960 Bacteria 850
123 Ga0207639_10227308 3300026041 Bacteria 1615
124 Ga0207683_10004443 3300026121 Bacteria 12114
125 Ga0207698_10407681 3300026142 Bacteria 1301
126 Ga0207698_11337588 3300026142 Bacteria 731
127 Ga0268265_10832322 3300028380 Bacteria 902
128 Ga0373930_0159978 3300034816 Bacteria 569
129 Ga0373950_0031848 3300034818 Bacteria 980
130 Ga0373959_0024479 3300034820 Bacteria 1180
131 Ga0373926_0021459 3300035083 Bacteria 2236
132 Ga0373934_0014899 3300035086 Bacteria 2945
133 Ga0373944_0007730 3300035089 Bacteria 2887
134 Ga0373923_0075689 3300035111 Bacteria 1452
135 Ga0373923_0459819 3300035111 Bacteria 618
136 Ga0373932_0015764 3300035112 Bacteria 1920
137 Ga0373932_0303552 3300035112 Bacteria 596
138 Ga0373936_0000544 3300035113 Bacteria 12913
139 Ga0373936_0338413 3300035113 Bacteria 684
140 Ga0373953_0001010 3300035117 Bacteria 7933
141 Ga0373954_0023910 3300035118 Bacteria 2783
142 Ga0373956_0124385 3300035119 Bacteria 1205
143 Ga0373957_0069027 3300035120 Bacteria 1379
144 Ga0373943_0006274 3300035170 Bacteria 5339
145 Ga0373946_0004710 3300035171 Bacteria 4900
146 Ga0373955_0004936 3300035172 Bacteria 5954
147 Ga0373924_0056462 3300035410 Bacteria 1635
148 Ga0373931_0194633 3300035691 Bacteria 1208
149 Ga0373931_0635126 3300035691 Bacteria 700
150 Ga0373935_0229717 3300035692 Bacteria 1291
151 Ga0373927_0014216 3300035695 Bacteria 5278
152 Ga0373933_0075800 3300035724 Bacteria 2053
153 Ga0373933_0356569 3300035724 Bacteria 950
154 Ga0373947_0009189 3300035725 Bacteria 5682
155 Ga0373947_0477283 3300035725 Bacteria 846
156 Ga0373937_0549127 3300036401 Bacteria 1097
157 Ga0373937_0834557 3300036401 Bacteria 870
158 Ga0373925_0008280 3300037068 Bacteria 7566
159 Ga0373925_0360523 3300037068 Bacteria 1182
160 Ga0395898_0081560 3300037466 Bacteria 3118
161 Ga0436364_0005923 3300037853 Bacteria 2011
162 Ga0436364_0173459 3300037853 Bacteria 740
163 Ga0436364_0326465 3300037853 Bacteria 22377
164 Ga0436364_0426348 3300037853 Bacteria 32972
165 Ga0436364_0873693 3300037853 Bacteria 15253
166 Ga0436364_0900861 3300037853 Bacteria 1613
167 Ga0436364_1534317 3300037853 Bacteria 2609
168 Ga0395901_0439584 3300038443 Bacteria 1335
169 Ga0436365_0785999 3300039437 Bacteria 1876
170 Ga0436365_1639234 3300039437 Bacteria 987
171 Ga0436360_0385516 3300039438 Bacteria 1477
172 Ga0436361_0418282 3300039447 Bacteria 522
173 Ga0436361_0906812 3300039447 Bacteria 515
174 Ga0436363_0120396 3300039450 Bacteria 992
175 Ga0436362_0606313 3300039453 Bacteria 1446
176 Ga0436362_0729955 3300039453 Bacteria 525
177 Ga0436362_0806082 3300039453 Bacteria 1663
178 Ga0436362_0876501 3300039453 Bacteria 1187
179 Ga0451835_0908404 3300041492 Bacteria 662
180 Ga0451839_0993784 3300041496 Bacteria 546
181 Ga0439459_0130483 3300042438 Bacteria 642
182 Ga0466965_0086496 3300044683 Bacteria 1590
183 Ga0466965_0156145 3300044683 Bacteria 1195
184 Ga0466966_0253174 3300044684 Bacteria 1061
185 Ga0466961_0061664 3300044693 Bacteria 2383
186 Ga0466971_0014585 3300044719 Bacteria 3459
187 Ga0466959_0213974 3300045049 Bacteria 1338
188 Ga0466958_0016564 3300045836 Bacteria 4246
189 Ga0466967_0949036 3300045976 Bacteria 856
190 Ga0466967_1401135 3300045976 Bacteria 696
191 Ga0495603_0001892 3300046455 Bacteria 12351
192 Ga0495629_0005544 3300046459 Bacteria 9419
193 Ga0495641_0005485 3300046461 Bacteria 8552
194 Ga0495651_0145130 3300046462 Bacteria 1716
195 Ga0495653_0177915 3300046463 Bacteria 1462
196 Ga0495653_0362289 3300046463 Bacteria 930
197 Ga0495580_0006748 3300046472 Bacteria 9313
198 Ga0495582_0046527 3300046473 Bacteria 2389
199 Ga0495639_0001063 3300046475 Bacteria 12400
200 Ga0495662_0000331 3300046476 Bacteria 20613
201 Ga0495664_0289400 3300046477 Bacteria 989
202 Ga0495594_0185547 3300046499 Bacteria 1184
203 Ga0495618_0013485 3300046514 Bacteria 4971
204 Ga0495618_0240432 3300046514 Bacteria 1138
205 Ga0495628_0081723 3300046516 Bacteria 2509
206 Ga0495630_0042813 3300046517 Bacteria 3381
207 Ga0495666_0006810 3300046526 Bacteria 5738
208 Ga0495652_0043148 3300046529 Bacteria 3886
209 Ga0495652_0229567 3300046529 Bacteria 1389
210 Ga0495652_0416243 3300046529 Bacteria 948
211 Ga0495665_0008594 3300046531 Bacteria 5541
212 Ga0495640_0007962 3300046533 Bacteria 8333
213 Ga0495640_0702800 3300046533 Bacteria 606
214 Ga0495586_0032168 3300046535 Bacteria 2812
215 Ga0495587_0017414 3300046536 Bacteria 4464
216 Ga0495645_0019477 3300046543 Bacteria 4885
217 Ga0495667_0086305 3300046559 Bacteria 2035
218 Ga0495634_0006181 3300046642 Bacteria 9118
219 Ga0495635_0006990 3300046663 Bacteria 7883
220 Ga0495635_0195662 3300046663 Bacteria 1372
221 Ga0495657_0180341 3300046675 Bacteria 1296
222 Ga0495599_0008378 3300046678 Bacteria 6283
223 Ga0495599_0201539 3300046678 Bacteria 1222
224 Ga0495623_0070751 3300046679 Bacteria 2172
225 Ga0495646_0022166 3300046680 Bacteria 4007
226 Ga0495647_0025750 3300046681 Bacteria 2151
227 Ga0495658_0005576 3300046683 Bacteria 6184
228 Ga0495613_0017630 3300046689 Bacteria 5317
229 Ga0495624_0153787 3300046690 Bacteria 1406
230 Ga0495600_0029228 3300046809 Bacteria 3568
231 Ga0495581_0068087 3300047315 Bacteria 2058
232 Ga0495604_0007380 3300047317 Bacteria 8712
233 Ga0495674_0027719 3300047319 Bacteria 5172
234 Ga0495674_0134841 3300047319 Bacteria 2078
235 Ga0495674_0384827 3300047319 Bacteria 1134
236 Ga0495676_0018415 3300047321 Bacteria 6155
237 Ga0495680_0016896 3300047322 Bacteria 6249
238 Ga0495680_0018736 3300047322 Bacteria 5866
239 Ga0495675_0004807 3300047444 Bacteria 8212
240 Ga0495684_0025241 3300047471 Bacteria 4569
241 Ga0495684_0572890 3300047471 Bacteria 765
242 Ga0495593_0007423 3300047673 Bacteria 6417
243 Ga0495602_0069583 3300048088 Bacteria 3016
244 Ga0495602_0715341 3300048088 Bacteria 678
245 Ga0495614_0008212 3300048089 Bacteria 4643
246 Ga0496100_0200137 3300048903 Bacteria 1455
247 Ga0496102_0099036 3300048905 Bacteria 2705
248 Ga0496103_0139240 3300048906 Bacteria 1551
249 Ga0496106_0428817 3300048909 Bacteria 1063
250 Ga0496108_0096701 3300048911 Bacteria 2515
251 Ga0496109_1732297 3300048912 Bacteria 558
252 Ga0496110_0029166 3300048913 Bacteria 4746
253 Ga0496111_0111147 3300048914 Bacteria 2018
254 Ga0496112_1793736 3300048915 Bacteria 525
255 Ga0496114_0164539 3300048917 Bacteria 1930
256 Ga0496114_1103526 3300048917 Bacteria 678
257 Ga0501032_0337778 3300049569 Bacteria 971
258 Ga0501046_0000725 3300049580 Bacteria 31884
259 Ga0501069_0176712 3300049585 Bacteria 1233
260 Ga0501070_0025146 3300049586 Bacteria 4993
261 nmdc:mga0yw44_70437_c1 3300050492 Bacteria 2168
262 nmdc:mga05p37_22826_c1 3300050507 Bacteria 7588
263 Ga0495601_0041046 3300053077 Bacteria 2899
264 Ga0495595_0018404 3300053084 Bacteria 3018
265 Ga0495619_0002584 3300053085 Bacteria 11827
266 Ga0500660_052689 3300053100 Bacteria 2004
267 Ga0500556_0000514 3300053104 Bacteria 26445
268 Ga0500593_001086 3300053117 Bacteria 9820
269 Ga0466962_0016922 3300061719 Bacteria 3513
270 2623585968 2622736626 Bacteria 7181580
271 2891556223 2891554331 Bacteria 8812224
272 2984578455 2984576629 Bacteria 4248407
273 2990259264 2990256926 Bacteria 4252839
274 8003832186 8003830390 Bacteria 6541657
275 8053953838 8053945823 Bacteria 8962862
276 Ga0070700_100449648
277 Ga0070690_100174456
278 Ga0070670_101273437
279 Ga0070687_100095555
280 Ga0070674_100326412
281 Ga0070673_100055072
282 Ga0070659_100039911
283 Ga0070709_10557558
284 Ga0070709_10672276
285 Ga0070714_100806191
286 Ga0070714_100979189
287 Ga0070714_101227618
288 Ga0070714_101460411
289 Ga0070710_10066741
290 Ga0070710_10205885
291 Ga0070710_10572837
292 Ga0070711_100201422
293 Ga0070711_100552270
294 Ga0070708_100007705
295 Ga0070708_100116859
296 Ga0070662_100305878
297 Ga0070706_100002348
298 Ga0070706_100022981
299 Ga0070706_100237889
300 Ga0070707_100044093
301 Ga0070707_100159925
302 Ga0070707_100826231
303 Ga0070707_101301291
304 Ga0070698_100005490
305 Ga0070698_100160770
306 Ga0070699_100001321
307 Ga0070679_100298257
308 Ga0070679_100565503
309 Ga0070684_100041613
310 Ga0070697_100462949
311 Ga0068853_100047290
312 Ga0070695_100045153
313 Ga0070696_100271550
314 Ga0068855_100020321
315 Ga0068855_100699847
316 Ga0070664_100736768
317 Ga0070664_101809597
318 Ga0070702_100011959
319 Ga0068851_10019292
320 Ga0068870_10385973
321 Ga0068862_100061299
322 Ga0081540_1000501
323 Ga0070717_10027815
324 Ga0070717_10078041
325 Ga0075365_10102909
326 Ga0075365_10611322
327 Ga0070715_10236633
328 Ga0070716_100018653
329 Ga0070712_100076426
330 Ga0070712_100634336
331 Ga0068871_100084878
332 Ga0075431_100557416
333 Ga0075434_101904433
334 Ga0075429_100018498
335 Ga0075435_100628713
336 Ga0105251_10041420
337 Ga0105250_10226043
338 Ga0105240_10055790
339 Ga0105240_10124890
340 Ga0105242_10237225
341 Ga0105248_11439239
342 Ga0105248_12618975
343 Ga0105238_10315106
344 Ga0105238_10362579
345 Ga0105239_11029280
346 Ga0105246_10196305
347 Ga0157346_1011069
348 Ga0157373_10125140
349 Ga0157371_10641716
350 Ga0157370_10004912
351 Ga0157370_11347967
352 Ga0157369_10081765
353 Ga0157374_10966239
354 Ga0157372_11344032
355 Ga0157375_10013638
356 Ga0182008_10147509
357 Ga0157379_10719509
358 Ga0197907_10989865
359 Ga0206356_10118909
360 Ga0206353_10336350
361 Ga0206353_11608682
362 Ga0213873_10033116
363 Ga0213873_10082974
364 Ga0213875_10000279
365 Ga0213875_10000937
366 Ga0213875_10124920
367 Ga0213875_10164744
368 Ga0213875_10296855
369 Ga0207692_10052334
370 Ga0207692_10240343
371 Ga0207692_10553475
372 Ga0207642_10046202
373 Ga0207645_10700980
374 Ga0207684_10002992
375 Ga0207684_10019262
376 Ga0207684_10186977
377 Ga0207654_10679783
378 Ga0207707_11238079
379 Ga0207695_10217674
380 Ga0207693_10124706
381 Ga0207693_10220828
382 Ga0207662_10006370
383 Ga0207652_10721530
384 Ga0207646_10021067
385 Ga0207646_10264542
386 Ga0207646_10831649
387 Ga0207694_10633694
388 Ga0207659_10100305
389 Ga0207700_10466770
390 Ga0207664_10315826
391 Ga0207664_10321144
392 Ga0207664_10575663
393 Ga0207706_10016987
394 Ga0207691_10268342
395 Ga0207689_10036845
396 Ga0207661_10257595
397 Ga0207651_10773675
398 Ga0207639_10227308
399 Ga0207683_10004443
400 Ga0207698_10407681
401 Ga0207698_11337588
402 Ga0268265_10832322
403 Ga0373930_0159978
404 Ga0373950_0031848
405 Ga0373959_0024479
406 Ga0373926_0021459
407 Ga0373934_0014899
408 Ga0373944_0007730
409 Ga0373923_0075689
410 Ga0373923_0459819
411 Ga0373932_0015764
412 Ga0373932_0303552
413 Ga0373936_0000544
414 Ga0373936_0338413
415 Ga0373953_0001010
416 Ga0373954_0023910
417 Ga0373956_0124385
418 Ga0373957_0069027
419 Ga0373943_0006274
420 Ga0373946_0004710
421 Ga0373955_0004936
422 Ga0373924_0056462
423 Ga0373931_0194633
424 Ga0373931_0635126
425 Ga0373935_0229717
426 Ga0373927_0014216
427 Ga0373933_0075800
428 Ga0373933_0356569
429 Ga0373947_0009189
430 Ga0373947_0477283
431 Ga0373937_0549127
432 Ga0373937_0834557
433 Ga0373925_0008280
434 Ga0373925_0360523
435 Ga0395898_0081560
436 Ga0436364_0005923
437 Ga0436364_0173459
438 Ga0436364_0326465
439 Ga0436364_0426348
440 Ga0436364_0873693
441 Ga0436364_0900861
442 Ga0436364_1534317
443 Ga0395901_0439584
444 Ga0436365_0785999
445 Ga0436365_1639234
446 Ga0436360_0385516
447 Ga0436361_0418282
448 Ga0436361_0906812
449 Ga0436363_0120396
450 Ga0436362_0606313
451 Ga0436362_0729955
452 Ga0436362_0806082
453 Ga0436362_0876501
454 Ga0451835_0908404
455 Ga0451839_0993784
456 Ga0439459_0130483
457 Ga0466965_0086496
458 Ga0466965_0156145
459 Ga0466966_0253174
460 Ga0466961_0061664
461 Ga0466971_0014585
462 Ga0466959_0213974
463 Ga0466958_0016564
464 Ga0466967_0949036
465 Ga0466967_1401135
466 Ga0495603_0001892
467 Ga0495629_0005544
468 Ga0495641_0005485
469 Ga0495651_0145130
470 Ga0495653_0177915
471 Ga0495653_0362289
472 Ga0495580_0006748
473 Ga0495582_0046527
474 Ga0495639_0001063
475 Ga0495662_0000331
476 Ga0495664_0289400
477 Ga0495594_0185547
478 Ga0495618_0013485
479 Ga0495618_0240432
480 Ga0495628_0081723
481 Ga0495630_0042813
482 Ga0495666_0006810
483 Ga0495652_0043148
484 Ga0495652_0229567
485 Ga0495652_0416243
486 Ga0495665_0008594
487 Ga0495640_0007962
488 Ga0495640_0702800
489 Ga0495586_0032168
490 Ga0495587_0017414
491 Ga0495645_0019477
492 Ga0495667_0086305
493 Ga0495634_0006181
494 Ga0495635_0006990
495 Ga0495635_0195662
496 Ga0495657_0180341
497 Ga0495599_0008378
498 Ga0495599_0201539
499 Ga0495623_0070751
500 Ga0495646_0022166
501 Ga0495647_0025750
502 Ga0495658_0005576
503 Ga0495613_0017630
504 Ga0495624_0153787
505 Ga0495600_0029228
506 Ga0495581_0068087
507 Ga0495604_0007380
508 Ga0495674_0027719
509 Ga0495674_0134841
510 Ga0495674_0384827
511 Ga0495676_0018415
512 Ga0495680_0016896
513 Ga0495680_0018736
514 Ga0495675_0004807
515 Ga0495684_0025241
516 Ga0495684_0572890
517 Ga0495593_0007423
518 Ga0495602_0069583
519 Ga0495602_0715341
520 Ga0495614_0008212
521 Ga0496100_0200137
522 Ga0496102_0099036
523 Ga0496103_0139240
524 Ga0496106_0428817
525 Ga0496108_0096701
526 Ga0496109_1732297
527 Ga0496110_0029166
528 Ga0496111_0111147
529 Ga0496112_1793736
530 Ga0496114_0164539
531 Ga0496114_1103526
532 Ga0501032_0337778
533 Ga0501046_0000725
534 Ga0501069_0176712
535 Ga0501070_0025146
536 nmdc:mga0yw44_70437_c1
537 nmdc:mga05p37_22826_c1
538 Ga0495601_0041046
539 Ga0495595_0018404
540 Ga0495619_0002584
541 Ga0500660_052689
542 Ga0500556_0000514
543 Ga0500593_001086
544 Ga0466962_0016922
545 2623585968
546 2891556223
547 2984578455
548 2990259264
549 8003832186
550 8053953838

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11349

DUF3151

Protein of unknown function (DUF3151)

17

146

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w3b-assembly1.cif.gz_B the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha. 0.9169 31 125
3w7t-assembly1.cif.gz_A escherichia coli k12 ygjk complexed with mannose 0.9133 96 126
5gw7-assembly1.cif.gz_A crystal structure of the glycosynthase mutant e727a of escherichia coli gh63 glycosidase in complex with glucose and lactose 0.9075 96 126
4wjw-assembly1.cif.gz_B crystal structure of the chs5-chs6 exomer cargo adaptor complex bound to portion of chs3 0.9037 42 123
5ca3-assembly1.cif.gz_A crystal structure of the glycosynthase mutant d324n of escherichia coli gh63 glycosidase in complex with glucose and lactose 0.8982 96 125
ID Description Score Start End Superfamily
af_O06310_16_142_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.9839 9 131 1.10.3450.10
af_E7EYP4_1_72_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9535 98 125 1.25.40.10
af_Q4DYR9_407_481_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9527 98 125 1.25.40.10
af_O06310_16_142_1.10.3450.10 Mainly Alpha;Orthogonal Bundle;Hyaluronidase domain-like;TTHA0068-like 0.9459 9 131 1.10.3450.10
af_Q9UJX3_332_450_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9419 40 125 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2T1A1T1-F1-model_v4 Uncharacterized protein DUF3151 0.991 7 138
AF-A0A5D0SCD7-F1-model_v4 DUF3151 domain-containing protein 0.9905 30 138
AF-A0A848UJ29-F1-model_v4 DUF3151 family protein 0.9881 57 126
AF-A0A429R2N7-F1-model_v4 deleted 0.9868 39 135
AF-A0A850CE49-F1-model_v4 DUF3151 domain-containing protein 0.9865 7 127

Map