F380211

General Info

Members Datasets Scaffolds Average Seq Length
275 142 550 304

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100240144|Ga0070659_1002401442
Length 305
Sequence MNEVADPTEQAAPDLAGSPGQHVVLLSGLSGGGKTAAAKLFEDLAYTVVDNLPGELLPNLAELVLSDGRRFARVAVVLDVRAGDAETAYRAMRGALEGRGIRPQVFFLEASDEALIRRFSETRHRHPLANGRSTQAAIALERRLLDPIRAEADVVVDTTDLPLRELRERLFARIADLQPDTMTIQLISFGYKFGIPLESDLVFDTRFIQNPYYVPELRELSGLTEPVRTFVLAQPGAPEYLDLIDRMLEFTIPAFAEEGKSRLTVGIGCTGGRHRSIVFAEELARRLREEGHEPVEVFHRELERK

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
87 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
134 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
139 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.91
Rhizosphere 89.09
Stem 0
Stem Tuber 0
Unclassified 4.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100240144 3300005366 Bacteria 1499
2 JGI25406J46586_10037706 3300003203 Bacteria 1739
3 JGI25406J46586_10043924 3300003203 Bacteria 1551
4 Ga0070680_100000145 3300005336 Bacteria 43273
5 Ga0068868_100153196 3300005338 Bacteria 1900
6 Ga0070692_10029274 3300005345 Bacteria 2744
7 Ga0070659_100183874 3300005366 Bacteria 1716
8 Ga0070667_100077712 3300005367 Bacteria 2834
9 Ga0070705_100002461 3300005440 Bacteria 9313
10 Ga0070705_100024934 3300005440 Bacteria 3235
11 Ga0070694_100198362 3300005444 Bacteria 1494
12 Ga0070708_100008239 3300005445 Bacteria 8367
13 Ga0070708_100009857 3300005445 Bacteria 7718
14 Ga0070708_100024287 3300005445 Bacteria 5168
15 Ga0070708_100279279 3300005445 Bacteria 1572
16 Ga0070706_100001782 3300005467 Bacteria 22296
17 Ga0070706_100005800 3300005467 Bacteria 11735
18 Ga0070706_100009338 3300005467 Bacteria 9135
19 Ga0070706_100039883 3300005467 Bacteria 4335
20 Ga0070706_100065228 3300005467 Bacteria 3367
21 Ga0070707_100006916 3300005468 Bacteria 10510
22 Ga0070707_100014976 3300005468 Bacteria 7278
23 Ga0070707_100023517 3300005468 Bacteria 5829
24 Ga0070698_100005711 3300005471 Bacteria 13621
25 Ga0070698_100022486 3300005471 Bacteria 6596
26 Ga0070698_100029683 3300005471 Bacteria 5677
27 Ga0070698_100108687 3300005471 Bacteria 2740
28 Ga0070698_100354714 3300005471 Bacteria 1398
29 Ga0070699_100006627 3300005518 Bacteria 10069
30 Ga0070699_100009815 3300005518 Bacteria 8283
31 Ga0070699_100022286 3300005518 Bacteria 5458
32 Ga0070699_100025587 3300005518 Bacteria 5087
33 Ga0070699_100143560 3300005518 Bacteria 2109
34 Ga0070699_100458441 3300005518 Bacteria 1156
35 Ga0070684_100085917 3300005535 Bacteria 2791
36 Ga0070697_100012764 3300005536 Bacteria 6581
37 Ga0070697_100027542 3300005536 Bacteria 4547
38 Ga0070697_100031312 3300005536 Bacteria 4278
39 Ga0070697_100112679 3300005536 Bacteria 2269
40 Ga0070697_100300859 3300005536 Unclassified 1379
41 Ga0070686_100030346 3300005544 Bacteria 3296
42 Ga0070686_100101031 3300005544 Bacteria 1949
43 Ga0070696_100002529 3300005546 Bacteria 12115
44 Ga0070696_100019349 3300005546 Bacteria 4611
45 Ga0070696_100036444 3300005546 Unclassified 3391
46 Ga0070696_100068476 3300005546 Bacteria 2492
47 Ga0070696_100068937 3300005546 Bacteria 2484
48 Ga0070696_100093931 3300005546 Bacteria 2139
49 Ga0070696_100169110 3300005546 Unclassified 1615
50 Ga0070704_100014994 3300005549 Bacteria 4855
51 Ga0070704_100047226 3300005549 Bacteria 3008
52 Ga0070704_100170685 3300005549 Bacteria 1729
53 Ga0070702_100151574 3300005615 Unclassified 1489
54 Ga0070702_100229322 3300005615 Bacteria 1247
55 Ga0068859_100081622 3300005617 Bacteria 3276
56 Ga0068864_100031232 3300005618 Bacteria 4519
57 Ga0068864_100241255 3300005618 Bacteria 1675
58 Ga0068860_100124900 3300005843 Bacteria 2466
59 Ga0068862_100037308 3300005844 Bacteria 4119
60 Ga0068862_100381889 3300005844 Bacteria 1314
61 Ga0081539_10002781 3300005985 Bacteria 23522
62 Ga0081539_10004082 3300005985 Bacteria 16687
63 Ga0075434_100083672 3300006871 Bacteria 3188
64 Ga0075434_100445726 3300006871 Bacteria 1316
65 Ga0068865_100234904 3300006881 Bacteria 1440
66 Ga0075436_100114082 3300006914 Bacteria 1887
67 Ga0097620_100081622 3300006931 Bacteria 3276
68 Ga0111539_10172900 3300009094 Bacteria 2524
69 Ga0105245_10284477 3300009098 Bacteria 1617
70 Ga0105247_10048630 3300009101 Bacteria 2605
71 Ga0114129_10008894 3300009147 Bacteria 14316
72 Ga0114129_10085475 3300009147 Bacteria 4377
73 Ga0105242_10241990 3300009176 Unclassified 1622
74 Ga0105248_10504732 3300009177 Bacteria 1364
75 Ga0105249_10108148 3300009553 Bacteria 2625
76 Ga0157378_10088654 3300013297 Bacteria 2808
77 Ga0157378_10201315 3300013297 Bacteria 1883
78 Ga0157378_10468472 3300013297 Bacteria 1253
79 Ga0157372_10626857 3300013307 Bacteria 1253
80 Ga0157375_10362707 3300013308 Bacteria 1615
81 Ga0163163_10138395 3300014325 Bacteria 2476
82 Ga0157380_10173108 3300014326 Bacteria 1888
83 Ga0182008_10083009 3300014497 Bacteria 1577
84 Ga0157379_10045656 3300014968 Bacteria 3910
85 Ga0207684_10000499 3300025910 Bacteria 49704
86 Ga0207684_10007085 3300025910 Bacteria 10135
87 Ga0207684_10021101 3300025910 Bacteria 5562
88 Ga0207684_10044655 3300025910 Bacteria 3758
89 Ga0207684_10057144 3300025910 Bacteria 3310
90 Ga0207660_10000001 3300025917 Bacteria 1034169
91 Ga0207657_10103208 3300025919 Bacteria 2364
92 Ga0207646_10007143 3300025922 Bacteria 11422
93 Ga0207646_10017157 3300025922 Bacteria 6780
94 Ga0207646_10021377 3300025922 Bacteria 5979
95 Ga0207646_10053404 3300025922 Bacteria 3614
96 Ga0207646_10412456 3300025922 Bacteria 1220
97 Ga0207687_10186124 3300025927 Bacteria 1612
98 Ga0207711_10339967 3300025941 Bacteria 1389
99 Ga0207711_10367381 3300025941 Bacteria 1334
100 Ga0207689_10268391 3300025942 Bacteria 1413
101 Ga0207640_10110857 3300025981 Unclassified 1945
102 Ga0207678_10234477 3300026067 Bacteria 1571
103 Ga0207708_10077281 3300026075 Bacteria 2555
104 Ga0207708_10462492 3300026075 Bacteria 1058
105 Ga0207676_10146396 3300026095 Bacteria 2029
106 Ga0207674_10331312 3300026116 Bacteria 1472
107 Ga0207683_10042065 3300026121 Bacteria 3990
108 Ga0207683_10106573 3300026121 Bacteria 2506
109 Ga0207683_10329510 3300026121 Unclassified 1399
110 Ga0209983_1012977 3300027665 Bacteria 1712
111 Ga0268265_10156338 3300028380 Bacteria 1930
112 Ga0265337_1008392 3300028556 Viruses 3759
113 Ga0265319_1003105 3300028563 Bacteria 8773
114 Ga0265319_1017339 3300028563 Bacteria 2739
115 Ga0265334_10025449 3300028573 Bacteria 2395
116 Ga0265318_10011992 3300028577 Bacteria 3703
117 Ga0265318_10040096 3300028577 Bacteria 1785
118 Ga0265322_10014992 3300028654 Bacteria 2240
119 Ga0265336_10028305 3300028666 Bacteria 1751
120 Ga0265324_10001727 3300029957 Bacteria 12011
121 Ga0265330_10016988 3300031235 Bacteria 3355
122 Ga0265330_10031460 3300031235 Bacteria 2379
123 Ga0265332_10055448 3300031238 Bacteria 1699
124 Ga0265320_10001258 3300031240 Bacteria 18579
125 Ga0265320_10003544 3300031240 Bacteria 10449
126 Ga0265325_10010846 3300031241 Bacteria 5254
127 Ga0265340_10003354 3300031247 Bacteria 9058
128 Ga0265339_10013932 3300031249 Bacteria 4863
129 Ga0265339_10086745 3300031249 Bacteria 1646
130 Ga0265339_10125288 3300031249 Bacteria 1317
131 Ga0265331_10047553 3300031250 Bacteria 2064
132 Ga0265316_10015454 3300031344 Bacteria 6675
133 Ga0265316_10044663 3300031344 Bacteria 3522
134 Ga0265313_10049416 3300031595 Bacteria 2024
135 Ga0265314_10016212 3300031711 Bacteria 5898
136 Ga0265314_10087385 3300031711 Bacteria 2039
137 Ga0265342_10015780 3300031712 Bacteria 4958
138 Ga0265342_10020061 3300031712 Bacteria 4297
139 Ga0307405_10070203 3300031731 Bacteria 2249
140 Ga0307406_10043524 3300031901 Bacteria 2809
141 Ga0307412_10176844 3300031911 Bacteria 1601
142 Ga0307409_100059094 3300031995 Bacteria 2982
143 Ga0307409_100084622 3300031995 Bacteria 2576
144 Ga0307409_100125603 3300031995 Bacteria 2181
145 Ga0307416_100373470 3300032002 Bacteria 1453
146 Ga0307416_100576248 3300032002 Bacteria 1202
147 Ga0307411_10130152 3300032005 Bacteria 1838
148 Ga0307415_100275149 3300032126 Bacteria 1381
149 Ga0373946_0078369 3300035171 Bacteria 1442
150 Ga0395901_0323534 3300038443 Bacteria 1595
151 Ga0439448_0081089 3300042005 Unclassified 1090
152 Ga0450910_009840 3300042147 Bacteria 1356
153 Ga0439446_0024287 3300042156 Bacteria 1729
154 Ga0451577_0100156 3300042876 Bacteria 2588
155 Ga0495656_0104186 3300046615 Bacteria 1316
156 Ga0496102_0070542 3300048905 Bacteria 3208
157 Ga0496102_0080293 3300048905 Bacteria 3005
158 Ga0496102_0348337 3300048905 Bacteria 1395
159 Ga0496103_0309542 3300048906 Bacteria 1016
160 Ga0496104_0042380 3300048907 Bacteria 4271
161 Ga0496104_0091986 3300048907 Bacteria 2900
162 Ga0496104_0420046 3300048907 Unclassified 1249
163 Ga0496105_0011245 3300048908 Bacteria 7063
164 Ga0496105_0017133 3300048908 Bacteria 5801
165 Ga0496105_0279470 3300048908 Bacteria 1346
166 Ga0496106_0158629 3300048909 Bacteria 1788
167 Ga0496106_0238791 3300048909 Bacteria 1452
168 Ga0496107_0104581 3300048910 Bacteria 2078
169 Ga0496107_0135384 3300048910 Bacteria 1820
170 Ga0496107_0204564 3300048910 Unclassified 1467
171 Ga0496108_0008809 3300048911 Bacteria 8178
172 Ga0496108_0029513 3300048911 Bacteria 4542
173 Ga0496108_0046101 3300048911 Bacteria 3642
174 Ga0496109_0035483 3300048912 Bacteria 4499
175 Ga0496109_0043281 3300048912 Bacteria 4081
176 Ga0496109_0258553 3300048912 Unclassified 1640
177 Ga0496110_0037842 3300048913 Bacteria 4195
178 Ga0496110_0078755 3300048913 Bacteria 2934
179 Ga0496111_0030550 3300048914 Bacteria 3832
180 Ga0496112_0000010 3300048915 Bacteria 245046
181 Ga0496112_0039988 3300048915 Bacteria 4584
182 Ga0496112_0053963 3300048915 Bacteria 3948
183 Ga0496113_0055351 3300048916 Bacteria 2973
184 Ga0496113_0095998 3300048916 Bacteria 2291
185 Ga0496114_0023716 3300048917 Bacteria 5008
186 Ga0501031_0039627 3300049568 Bacteria 3075
187 Ga0501031_0067031 3300049568 Bacteria 2339
188 Ga0501031_0081939 3300049568 Bacteria 2103
189 Ga0501036_0135078 3300049572 Bacteria 2082
190 Ga0501036_0347143 3300049572 Bacteria 1239
191 Ga0501037_0033162 3300049573 Bacteria 3814
192 Ga0501038_0017692 3300049574 Bacteria 6442
193 Ga0501038_0088582 3300049574 Bacteria 2598
194 Ga0501039_0023456 3300049575 Bacteria 4736
195 Ga0501039_0071617 3300049575 Bacteria 2693
196 Ga0501039_0262066 3300049575 Bacteria 1358
197 Ga0501040_0009048 3300049576 Bacteria 6479
198 Ga0501040_0042874 3300049576 Bacteria 3083
199 Ga0501040_0074777 3300049576 Bacteria 2341
200 Ga0501041_0007068 3300049577 Bacteria 6584
201 Ga0501041_0034612 3300049577 Bacteria 3058
202 Ga0501041_0067520 3300049577 Bacteria 2192
203 Ga0501041_0102746 3300049577 Bacteria 1770
204 Ga0501042_0035338 3300049578 Bacteria 3545
205 Ga0501042_0167050 3300049578 Bacteria 1587
206 Ga0501043_0119244 3300049579 Bacteria 2069
207 Ga0501046_0092619 3300049580 Bacteria 2323
208 Ga0501048_0036037 3300049582 Bacteria 3557
209 Ga0501067_0026324 3300049583 Bacteria 3222
210 Ga0501068_0043209 3300049584 Bacteria 2711
211 Ga0501068_0061955 3300049584 Bacteria 2273
212 Ga0501069_0009242 3300049585 Bacteria 5204
213 Ga0501069_0039913 3300049585 Bacteria 2594
214 Ga0501070_0044012 3300049586 Bacteria 3715
215 Ga0501071_0011981 3300049587 Bacteria 5859
216 Ga0501071_0099232 3300049587 Bacteria 2146
217 Ga0501071_0108344 3300049587 Bacteria 2052
218 Ga0501071_0125175 3300049587 Bacteria 1907
219 Ga0501071_0178334 3300049587 Bacteria 1591
220 Ga0501071_0195563 3300049587 Bacteria 1518
221 Ga0501072_0021061 3300049588 Bacteria 5057
222 Ga0501072_0034399 3300049588 Bacteria 3972
223 Ga0501072_0036200 3300049588 Bacteria 3869
224 Ga0501072_0396228 3300049588 Bacteria 1095
225 Ga0501073_0006874 3300049589 Bacteria 8464
226 Ga0501074_0034919 3300049590 Bacteria 3644
227 Ga0501074_0142675 3300049590 Bacteria 1713
228 Ga0501074_0234115 3300049590 Bacteria 1307
229 Ga0501075_0009484 3300049591 Bacteria 6810
230 Ga0501075_0028309 3300049591 Bacteria 4136
231 Ga0501075_0093291 3300049591 Bacteria 2285
232 Ga0501075_0096676 3300049591 Bacteria 2241
233 Ga0501076_0018977 3300049592 Bacteria 5248
234 Ga0501076_0022936 3300049592 Bacteria 4803
235 Ga0501076_0118084 3300049592 Bacteria 2147
236 Ga0501076_0132050 3300049592 Bacteria 2025
237 Ga0501077_0006213 3300049593 Bacteria 7299
238 Ga0501079_0004253 3300049741 Bacteria 10618
239 Ga0501079_0008966 3300049741 Bacteria 7575
240 Ga0501079_0022084 3300049741 Bacteria 4876
241 Ga0501079_0370912 3300049741 Unclassified 1122
242 Ga0501079_0380450 3300049741 Bacteria 1107
243 Ga0501080_0013864 3300049742 Bacteria 7419
244 Ga0501080_0078298 3300049742 Bacteria 3075
245 Ga0501080_0083923 3300049742 Bacteria 2960
246 Ga0501080_0400748 3300049742 Bacteria 1234
247 Ga0501081_0008555 3300049743 Bacteria 6650
248 Ga0501083_0048285 3300049744 Bacteria 2873
249 Ga0501035_0011901 3300049822 Bacteria 8052
250 Ga0501035_0224519 3300049822 Bacteria 1603
251 Ga0501044_0106287 3300049823 Bacteria 2819
252 Ga0501045_0008937 3300049824 Bacteria 6997
253 Ga0501045_0014097 3300049824 Bacteria 5661
254 Ga0501045_0047451 3300049824 Bacteria 3129
255 Ga0501045_0101714 3300049824 Bacteria 2128
256 Ga0501045_0179680 3300049824 Bacteria 1577
257 Ga0501045_0202027 3300049824 Bacteria 1481
258 nmdc:mga05p37_153059_c1 3300050507 Bacteria 2820
259 nmdc:mga0n895_130845_c1 3300050512 Bacteria 2534
260 nmdc:mga0rr50_257135_c1 3300050513 Bacteria 1452
261 nmdc:mga08x19_272128_c1 3300050514 Bacteria 1172
262 nmdc:mga0a205_298132_c1 3300050515 Unclassified 1485
263 nmdc:mga0a205_83185_c1 3300050515 Bacteria 3091
264 Ga0501084_0088645 3300054114 Bacteria 2597
265 Ga0501084_0096832 3300054114 Bacteria 2477
266 Ga0501084_0146019 3300054114 Bacteria 1992
267 Ga0590071_000821 3300059421 Bacteria 8665
268 Ga0590074_009323 3300059423 Bacteria 1635
269 Ga0590075_019134 3300059424 Bacteria 1697
270 Ga0501082_0035004 3300060353 Bacteria 4328
271 Ga0501082_0125686 3300060353 Bacteria 2224
272 Ga0501082_0131889 3300060353 Bacteria 2168
273 Ga0530510_0001749 3300061734 Bacteria 14798
274 Ga0530510_0071595 3300061734 Bacteria 2516
275 Ga0530510_0087044 3300061734 Bacteria 2276
276 Ga0070659_100240144
277 JGI25406J46586_10037706
278 JGI25406J46586_10043924
279 Ga0070680_100000145
280 Ga0068868_100153196
281 Ga0070692_10029274
282 Ga0070659_100183874
283 Ga0070667_100077712
284 Ga0070705_100002461
285 Ga0070705_100024934
286 Ga0070694_100198362
287 Ga0070708_100008239
288 Ga0070708_100009857
289 Ga0070708_100024287
290 Ga0070708_100279279
291 Ga0070706_100001782
292 Ga0070706_100005800
293 Ga0070706_100009338
294 Ga0070706_100039883
295 Ga0070706_100065228
296 Ga0070707_100006916
297 Ga0070707_100014976
298 Ga0070707_100023517
299 Ga0070698_100005711
300 Ga0070698_100022486
301 Ga0070698_100029683
302 Ga0070698_100108687
303 Ga0070698_100354714
304 Ga0070699_100006627
305 Ga0070699_100009815
306 Ga0070699_100022286
307 Ga0070699_100025587
308 Ga0070699_100143560
309 Ga0070699_100458441
310 Ga0070684_100085917
311 Ga0070697_100012764
312 Ga0070697_100027542
313 Ga0070697_100031312
314 Ga0070697_100112679
315 Ga0070697_100300859
316 Ga0070686_100030346
317 Ga0070686_100101031
318 Ga0070696_100002529
319 Ga0070696_100019349
320 Ga0070696_100036444
321 Ga0070696_100068476
322 Ga0070696_100068937
323 Ga0070696_100093931
324 Ga0070696_100169110
325 Ga0070704_100014994
326 Ga0070704_100047226
327 Ga0070704_100170685
328 Ga0070702_100151574
329 Ga0070702_100229322
330 Ga0068859_100081622
331 Ga0068864_100031232
332 Ga0068864_100241255
333 Ga0068860_100124900
334 Ga0068862_100037308
335 Ga0068862_100381889
336 Ga0081539_10002781
337 Ga0081539_10004082
338 Ga0075434_100083672
339 Ga0075434_100445726
340 Ga0068865_100234904
341 Ga0075436_100114082
342 Ga0097620_100081622
343 Ga0111539_10172900
344 Ga0105245_10284477
345 Ga0105247_10048630
346 Ga0114129_10008894
347 Ga0114129_10085475
348 Ga0105242_10241990
349 Ga0105248_10504732
350 Ga0105249_10108148
351 Ga0157378_10088654
352 Ga0157378_10201315
353 Ga0157378_10468472
354 Ga0157372_10626857
355 Ga0157375_10362707
356 Ga0163163_10138395
357 Ga0157380_10173108
358 Ga0182008_10083009
359 Ga0157379_10045656
360 Ga0207684_10000499
361 Ga0207684_10007085
362 Ga0207684_10021101
363 Ga0207684_10044655
364 Ga0207684_10057144
365 Ga0207660_10000001
366 Ga0207657_10103208
367 Ga0207646_10007143
368 Ga0207646_10017157
369 Ga0207646_10021377
370 Ga0207646_10053404
371 Ga0207646_10412456
372 Ga0207687_10186124
373 Ga0207711_10339967
374 Ga0207711_10367381
375 Ga0207689_10268391
376 Ga0207640_10110857
377 Ga0207678_10234477
378 Ga0207708_10077281
379 Ga0207708_10462492
380 Ga0207676_10146396
381 Ga0207674_10331312
382 Ga0207683_10042065
383 Ga0207683_10106573
384 Ga0207683_10329510
385 Ga0209983_1012977
386 Ga0268265_10156338
387 Ga0265337_1008392
388 Ga0265319_1003105
389 Ga0265319_1017339
390 Ga0265334_10025449
391 Ga0265318_10011992
392 Ga0265318_10040096
393 Ga0265322_10014992
394 Ga0265336_10028305
395 Ga0265324_10001727
396 Ga0265330_10016988
397 Ga0265330_10031460
398 Ga0265332_10055448
399 Ga0265320_10001258
400 Ga0265320_10003544
401 Ga0265325_10010846
402 Ga0265340_10003354
403 Ga0265339_10013932
404 Ga0265339_10086745
405 Ga0265339_10125288
406 Ga0265331_10047553
407 Ga0265316_10015454
408 Ga0265316_10044663
409 Ga0265313_10049416
410 Ga0265314_10016212
411 Ga0265314_10087385
412 Ga0265342_10015780
413 Ga0265342_10020061
414 Ga0307405_10070203
415 Ga0307406_10043524
416 Ga0307412_10176844
417 Ga0307409_100059094
418 Ga0307409_100084622
419 Ga0307409_100125603
420 Ga0307416_100373470
421 Ga0307416_100576248
422 Ga0307411_10130152
423 Ga0307415_100275149
424 Ga0373946_0078369
425 Ga0395901_0323534
426 Ga0439448_0081089
427 Ga0450910_009840
428 Ga0439446_0024287
429 Ga0451577_0100156
430 Ga0495656_0104186
431 Ga0496102_0070542
432 Ga0496102_0080293
433 Ga0496102_0348337
434 Ga0496103_0309542
435 Ga0496104_0042380
436 Ga0496104_0091986
437 Ga0496104_0420046
438 Ga0496105_0011245
439 Ga0496105_0017133
440 Ga0496105_0279470
441 Ga0496106_0158629
442 Ga0496106_0238791
443 Ga0496107_0104581
444 Ga0496107_0135384
445 Ga0496107_0204564
446 Ga0496108_0008809
447 Ga0496108_0029513
448 Ga0496108_0046101
449 Ga0496109_0035483
450 Ga0496109_0043281
451 Ga0496109_0258553
452 Ga0496110_0037842
453 Ga0496110_0078755
454 Ga0496111_0030550
455 Ga0496112_0000010
456 Ga0496112_0039988
457 Ga0496112_0053963
458 Ga0496113_0055351
459 Ga0496113_0095998
460 Ga0496114_0023716
461 Ga0501031_0039627
462 Ga0501031_0067031
463 Ga0501031_0081939
464 Ga0501036_0135078
465 Ga0501036_0347143
466 Ga0501037_0033162
467 Ga0501038_0017692
468 Ga0501038_0088582
469 Ga0501039_0023456
470 Ga0501039_0071617
471 Ga0501039_0262066
472 Ga0501040_0009048
473 Ga0501040_0042874
474 Ga0501040_0074777
475 Ga0501041_0007068
476 Ga0501041_0034612
477 Ga0501041_0067520
478 Ga0501041_0102746
479 Ga0501042_0035338
480 Ga0501042_0167050
481 Ga0501043_0119244
482 Ga0501046_0092619
483 Ga0501048_0036037
484 Ga0501067_0026324
485 Ga0501068_0043209
486 Ga0501068_0061955
487 Ga0501069_0009242
488 Ga0501069_0039913
489 Ga0501070_0044012
490 Ga0501071_0011981
491 Ga0501071_0099232
492 Ga0501071_0108344
493 Ga0501071_0125175
494 Ga0501071_0178334
495 Ga0501071_0195563
496 Ga0501072_0021061
497 Ga0501072_0034399
498 Ga0501072_0036200
499 Ga0501072_0396228
500 Ga0501073_0006874
501 Ga0501074_0034919
502 Ga0501074_0142675
503 Ga0501074_0234115
504 Ga0501075_0009484
505 Ga0501075_0028309
506 Ga0501075_0093291
507 Ga0501075_0096676
508 Ga0501076_0018977
509 Ga0501076_0022936
510 Ga0501076_0118084
511 Ga0501076_0132050
512 Ga0501077_0006213
513 Ga0501079_0004253
514 Ga0501079_0008966
515 Ga0501079_0022084
516 Ga0501079_0370912
517 Ga0501079_0380450
518 Ga0501080_0013864
519 Ga0501080_0078298
520 Ga0501080_0083923
521 Ga0501080_0400748
522 Ga0501081_0008555
523 Ga0501083_0048285
524 Ga0501035_0011901
525 Ga0501035_0224519
526 Ga0501044_0106287
527 Ga0501045_0008937
528 Ga0501045_0014097
529 Ga0501045_0047451
530 Ga0501045_0101714
531 Ga0501045_0179680
532 Ga0501045_0202027
533 nmdc:mga05p37_153059_c1
534 nmdc:mga0n895_130845_c1
535 nmdc:mga0rr50_257135_c1
536 nmdc:mga08x19_272128_c1
537 nmdc:mga0a205_298132_c1
538 nmdc:mga0a205_83185_c1
539 Ga0501084_0088645
540 Ga0501084_0096832
541 Ga0501084_0146019
542 Ga0590071_000821
543 Ga0590074_009323
544 Ga0590075_019134
545 Ga0501082_0035004
546 Ga0501082_0125686
547 Ga0501082_0131889
548 Ga0530510_0001749
549 Ga0530510_0071595
550 Ga0530510_0087044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22740

PapZ_C

RapZ C-terminal domain

182

303

0.98

PF03668

RapZ-like_N

RapZ-like N-terminal domain

21

178

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9682 185 307
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.953 185 307
1ko5-assembly1.cif.gz_B crystal structure of gluconate kinase 0.7282 20 178
1grq-assembly1.cif.gz_A chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae 0.714 25 175
4y0a-assembly1.cif.gz_A shikimate kinase from acinetobacter baumannii in complex with shikimate 0.6993 22 180
ID Description Score Start End Superfamily
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9683 192 306 3.40.50.720
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9064 192 306 3.40.50.720
af_Q10242_7_192_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7144 23 179 3.40.50.300
3umfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.704 22 178 3.40.50.300
4y0aA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6993 22 180 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A661PJU6-F1-model_v4 RapZ C-terminal domain-containing protein 0.9859 183 303 GO:0005524
AF-A0A2N3F0Z0-F1-model_v4 RNase adaptor protein RapZ 0.9815 201 307 GO:0005524
AF-A0A645DGX9-F1-model_v4 RNase adapter protein RapZ 0.9807 185 303 GO:0005524
AF-A0A661M354-F1-model_v4 RapZ C-terminal domain-containing protein 0.9792 185 306 GO:0005524
AF-A0A2V8R537-F1-model_v4 RNase adaptor protein RapZ 0.9792 183 303 GO:0005524

Map