F380189

General Info

Members Datasets Scaffolds Average Seq Length
275 215 262 230

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100530034|Ga0070680_1005300341
Length 260
Sequence VSGSRPLPGQPGPGTAANEEWASAGPSPRQPVPVVFVPGLLCTPRLYQDQIERLWPLGPVTIADHTRDDSVASIARRILHSAPPRFMLVGLSMGGYISFEILRQAPERVTRLALLDTTARPDAPEQAESRRALIALAGSGGFGEIADRLFASLVAPQHRDDGPLRQIVRTMARDVGPEAFVRQQNAIMGRPDSRPTLEQIRCPTLVLVGEQDALTPPERASEIAAGIRGSRLVSVAGCGHLSTLERPAEVSRALTELLQS

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
6 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
7 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
8 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
9 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
10 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
11 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
12 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
13 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
126 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
127 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
145 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
146 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
200 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
211 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
212 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 0
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 12
Nodule 0.36
Rhizoplane 2.91
Rhizosphere 76.36
Stem 0
Stem Tuber 0
Unclassified 7.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1014706 3300002741 Bacteria 969
2 JGI25151J46595_10000044 3300003187 Bacteria 170418
3 rootH2_10111590 3300003320 Bacteria 1152
4 rootH2_10162982 3300003320 Bacteria 2138
5 rootL2_10129054 3300003322 Bacteria 2435
6 Ga0055526_1000091 3300003771 Bacteria 82891
7 Ga0055531_10004091 3300003794 Bacteria 9029
8 Ga0055543_1005804 3300004625 Bacteria 3094
9 Ga0065165_1002439 3300005262 Bacteria 15748
10 Ga0065165_1025805 3300005262 Bacteria 1946
11 Ga0070683_100358729 3300005329 Bacteria 1388
12 Ga0070670_100080315 3300005331 Bacteria 2803
13 Ga0070666_10015005 3300005335 Bacteria 4937
14 Ga0070666_10442961 3300005335 Bacteria 937
15 Ga0070680_100530034 3300005336 Bacteria 1009
16 Ga0068868_100029298 3300005338 Bacteria 4215
17 Ga0068868_100231020 3300005338 Bacteria 1552
18 Ga0070668_100010477 3300005347 Bacteria 6891
19 Ga0070669_100030985 3300005353 Bacteria 3861
20 Ga0070671_100136958 3300005355 Bacteria 2064
21 Ga0070673_100044454 3300005364 Bacteria 3439
22 Ga0070673_100086808 3300005364 Bacteria 2550
23 Ga0070659_100006653 3300005366 Bacteria 8353
24 Ga0070659_100098723 3300005366 Bacteria 2348
25 Ga0070667_100000130 3300005367 Bacteria 95182
26 Ga0070667_100535482 3300005367 Unclassified 1075
27 Ga0070701_10150560 3300005438 Bacteria 1339
28 Ga0070711_100127179 3300005439 Bacteria 1893
29 Ga0070663_100229652 3300005455 Bacteria 1461
30 Ga0070678_100183268 3300005456 Bacteria 1716
31 Ga0070662_100064035 3300005457 Bacteria 2691
32 Ga0070681_10000669 3300005458 Bacteria 28356
33 Ga0070681_10069282 3300005458 Bacteria 3494
34 Ga0068867_100138659 3300005459 Bacteria 1899
35 Ga0070698_100046453 3300005471 Bacteria 4440
36 Ga0070698_100545046 3300005471 Bacteria 1099
37 Ga0070679_100004175 3300005530 Bacteria 13317
38 Ga0070679_100211396 3300005530 Bacteria 1904
39 Ga0070672_100164766 3300005543 Bacteria 1841
40 Ga0070665_100351859 3300005548 Bacteria 1479
41 Ga0068855_100019362 3300005563 Bacteria 8178
42 Ga0070664_100057544 3300005564 Bacteria 3305
43 Ga0070664_100062451 3300005564 Bacteria 3176
44 Ga0068857_100044800 3300005577 Bacteria 3925
45 Ga0068854_100366359 3300005578 Bacteria 1184
46 Ga0068856_100006229 3300005614 Bacteria 11707
47 Ga0068856_100095657 3300005614 Bacteria 2958
48 Ga0068856_100670293 3300005614 Bacteria 1058
49 Ga0068866_10035205 3300005718 Bacteria 2444
50 Ga0068863_100000029 3300005841 Bacteria 177191
51 Ga0068863_100198830 3300005841 Bacteria 1927
52 Ga0068860_100059997 3300005843 Bacteria 3616
53 Ga0081540_1007125 3300005983 Bacteria 8023
54 Ga0081540_1030754 3300005983 Bacteria 2968
55 Ga0081539_10004115 3300005985 Bacteria 16576
56 Ga0070717_10099378 3300006028 Bacteria 2469
57 Ga0075364_10055562 3300006051 Bacteria 2590
58 Ga0075364_10103476 3300006051 Bacteria 1896
59 Ga0075364_10107486 3300006051 Bacteria 1860
60 Ga0070712_100016574 3300006175 Bacteria 4760
61 Ga0070712_100500529 3300006175 Bacteria 1018
62 Ga0075362_10026425 3300006177 Bacteria 2479
63 Ga0075362_10034897 3300006177 Bacteria 2194
64 Ga0075362_10070545 3300006177 Bacteria 1595
65 Ga0075366_10028626 3300006195 Bacteria 3270
66 Ga0075428_100083811 3300006844 Bacteria 3478
67 Ga0075431_100243703 3300006847 Bacteria 1828
68 Ga0075433_10787529 3300006852 Bacteria 831
69 Ga0075429_100524587 3300006880 Bacteria 1038
70 Ga0068865_100067905 3300006881 Bacteria 2519
71 Ga0105251_10001747 3300009011 Bacteria 18146
72 Ga0105244_10021467 3300009036 Bacteria 3571
73 Ga0114129_10116927 3300009147 Bacteria 3674
74 Ga0105241_10140359 3300009174 Bacteria 1966
75 Ga0105241_10977786 3300009174 Unclassified 790
76 Ga0105248_10001357 3300009177 Bacteria 27293
77 Ga0105248_10072466 3300009177 Bacteria 3872
78 Ga0105238_10035615 3300009551 Bacteria 5059
79 Ga0105238_10040446 3300009551 Bacteria 4724
80 Ga0105249_10208748 3300009553 Bacteria 1915
81 Ga0105239_10108325 3300010375 Bacteria 3078
82 Ga0105239_10263807 3300010375 Bacteria 1936
83 Ga0105239_10649362 3300010375 Bacteria 1205
84 Ga0157371_10001847 3300013102 Bacteria 21300
85 Ga0157371_10052458 3300013102 Bacteria 2896
86 Ga0157371_10181924 3300013102 Bacteria 1503
87 Ga0157370_10001797 3300013104 Bacteria 26441
88 Ga0157369_10004191 3300013105 Bacteria 17079
89 Ga0157369_10025345 3300013105 Bacteria 6584
90 Ga0157374_10972454 3300013296 Unclassified 868
91 Ga0157378_10093342 3300013297 Bacteria 2739
92 Ga0157378_10156766 3300013297 Bacteria 2126
93 Ga0163162_10406362 3300013306 Bacteria 1494
94 Ga0157372_10023641 3300013307 Bacteria 6666
95 Ga0157372_10816391 3300013307 Bacteria 1083
96 Ga0157375_10213003 3300013308 Bacteria 2090
97 Ga0163163_10038024 3300014325 Bacteria 4686
98 Ga0163163_10040827 3300014325 Bacteria 4533
99 Ga0157376_10272909 3300014969 Bacteria 1589
100 Ga0213871_10099386 3300021441 Bacteria 850
101 Ga0209026_1002760 3300025250 Bacteria 6276
102 Ga0209564_1000017 3300025295 Bacteria 594063
103 Ga0209758_1000431 3300025297 Bacteria 71115
104 Ga0209050_1000098 3300025298 Bacteria 236717
105 Ga0209257_1000221 3300025304 Bacteria 134870
106 Ga0209257_1000638 3300025304 Bacteria 56121
107 Ga0207713_1018114 3300025735 Bacteria 3497
108 Ga0207642_10010674 3300025899 Bacteria 3249
109 Ga0207688_10464332 3300025901 Bacteria 790
110 Ga0207680_10011052 3300025903 Bacteria 4545
111 Ga0207699_10028168 3300025906 Bacteria 3119
112 Ga0207645_10017507 3300025907 Bacteria 4728
113 Ga0207705_10372226 3300025909 Bacteria 1103
114 Ga0207707_10000408 3300025912 Bacteria 45020
115 Ga0207707_10010675 3300025912 Bacteria 7981
116 Ga0207707_10057889 3300025912 Bacteria 3373
117 Ga0207695_10002946 3300025913 Bacteria 24559
118 Ga0207693_10018455 3300025915 Bacteria 5557
119 Ga0207663_10275274 3300025916 Bacteria 1248
120 Ga0207660_10032907 3300025917 Bacteria 3582
121 Ga0207657_10014657 3300025919 Bacteria 7639
122 Ga0207652_10012101 3300025921 Bacteria 6967
123 Ga0207681_10022283 3300025923 Bacteria 4039
124 Ga0207694_10008477 3300025924 Bacteria 7760
125 Ga0207694_10238119 3300025924 Bacteria 1487
126 Ga0207650_10130126 3300025925 Bacteria 1969
127 Ga0207700_10071342 3300025928 Bacteria 2674
128 Ga0207644_10184025 3300025931 Bacteria 1639
129 Ga0207690_10072330 3300025932 Bacteria 2381
130 Ga0207706_10081140 3300025933 Bacteria 2850
131 Ga0207706_10124392 3300025933 Bacteria 2269
132 Ga0207669_10043704 3300025937 Bacteria 2626
133 Ga0207711_10000843 3300025941 Bacteria 29642
134 Ga0207711_10075103 3300025941 Bacteria 2941
135 Ga0207679_10042320 3300025945 Bacteria 3273
136 Ga0207679_10201586 3300025945 Bacteria 1662
137 Ga0207667_10003991 3300025949 Bacteria 18133
138 Ga0207668_10003902 3300025972 Bacteria 8787
139 Ga0207640_10280529 3300025981 Bacteria 1308
140 Ga0207658_10000100 3300025986 Bacteria 95179
141 Ga0207677_10186237 3300026023 Bacteria 1638
142 Ga0207678_10128948 3300026067 Bacteria 2157
143 Ga0207678_10382961 3300026067 Unclassified 1216
144 Ga0207702_10004851 3300026078 Bacteria 11844
145 Ga0207702_10405163 3300026078 Bacteria 1316
146 Ga0207702_10634073 3300026078 Bacteria 1050
147 Ga0207641_10000049 3300026088 Bacteria 177222
148 Ga0207641_10056474 3300026088 Bacteria 3337
149 Ga0207676_10019141 3300026095 Bacteria 4989
150 Ga0207674_10039576 3300026116 Bacteria 4886
151 Ga0207683_10008827 3300026121 Bacteria 8596
152 Ga0207683_10060244 3300026121 Bacteria 3337
153 Ga0207698_10336569 3300026142 Bacteria 1420
154 Ga0209974_10071312 3300027876 Bacteria 1185
155 Ga0268264_10079608 3300028381 Bacteria 2796
156 Ga0307517_10000196 3300028786 Bacteria 102384
157 Ga0268256_1033721 3300030500 Bacteria 1207
158 Ga0314311_1051972 3300030733 Bacteria 3768
159 Ga0265331_10093848 3300031250 Unclassified 1385
160 Ga0307508_10227516 3300031616 Bacteria 1464
161 Ga0265314_10128119 3300031711 Bacteria 1587
162 Ga0373926_0087011 3300035083 Bacteria 1160
163 Ga0373944_0044560 3300035089 Bacteria 1382
164 Ga0373945_0020284 3300035116 Bacteria 2273
165 Ga0373960_0063203 3300035121 Bacteria 1128
166 Ga0373943_0028548 3300035170 Bacteria 2629
167 Ga0373942_0030491 3300035207 Bacteria 1421
168 Ga0373935_0235295 3300035692 Bacteria 1277
169 Ga0373927_0195998 3300035695 Bacteria 1325
170 Ga0373925_0295748 3300037068 Bacteria 1306
171 Ga0395905_0004068 3300037471 Bacteria 15326
172 Ga0395905_0013681 3300037471 Bacteria 7772
173 Ga0395905_0087249 3300037471 Bacteria 2925
174 Ga0237819_00331 3300038705 Bacteria 17340
175 Ga0436365_1181058 3300039437 Bacteria 3361
176 Ga0436363_0733387 3300039450 Bacteria 4276
177 Ga0436363_0746016 3300039450 Bacteria 1521
178 Ga0439436_0008302 3300041404 Bacteria 3191
179 Ga0439447_000864 3300041407 Bacteria 11127
180 Ga0439466_0079879 3300041411 Bacteria 1032
181 Ga0439432_001445 3300042006 Bacteria 8920
182 Ga0439452_000774 3300042010 Bacteria 15217
183 Ga0439446_0007778 3300042156 Bacteria 2825
184 Ga0453684_0116896 3300044712 Bacteria 3228
185 Ga0451576_0078324 3300045051 Bacteria 3440
186 Ga0495629_0017418 3300046459 Bacteria 5149
187 Ga0495629_0417317 3300046459 Unclassified 911
188 Ga0495638_0021946 3300046460 Bacteria 4196
189 Ga0495653_0241592 3300046463 Bacteria 1203
190 Ga0495650_0001375 3300046471 Bacteria 24009
191 Ga0495650_0015683 3300046471 Bacteria 3876
192 Ga0495639_0205805 3300046475 Bacteria 964
193 Ga0495662_0009013 3300046476 Bacteria 4899
194 Ga0495664_0000314 3300046477 Bacteria 23280
195 Ga0495583_0010839 3300046506 Bacteria 5277
196 Ga0495618_0162578 3300046514 Bacteria 1423
197 Ga0495618_0224996 3300046514 Bacteria 1182
198 Ga0495620_0069012 3300046515 Bacteria 1451
199 Ga0495630_0003906 3300046517 Bacteria 10422
200 Ga0495642_0013696 3300046528 Bacteria 3141
201 Ga0495642_0056283 3300046528 Bacteria 1624
202 Ga0495652_0123994 3300046529 Bacteria 2056
203 Ga0495640_0202753 3300046533 Bacteria 1256
204 Ga0495586_0129441 3300046535 Bacteria 1413
205 Ga0495586_0358849 3300046535 Bacteria 837
206 Ga0495645_0002928 3300046543 Bacteria 11575
207 Ga0495668_0225871 3300046616 Bacteria 1025
208 Ga0495634_0031190 3300046642 Bacteria 3672
209 Ga0495625_0278689 3300046660 Bacteria 1076
210 Ga0495635_0009928 3300046663 Bacteria 6655
211 Ga0495635_0166919 3300046663 Bacteria 1497
212 Ga0495646_0148270 3300046680 Bacteria 1307
213 Ga0495669_0190160 3300046684 Bacteria 980
214 Ga0495624_0049722 3300046690 Bacteria 2658
215 Ga0495600_0344532 3300046809 Bacteria 934
216 Ga0495674_0041537 3300047319 Bacteria 4107
217 Ga0495672_0018455 3300047320 Bacteria 4629
218 Ga0495677_0054434 3300047445 Bacteria 1476
219 Ga0495684_0108298 3300047471 Bacteria 2098
220 Ga0495686_0015225 3300047472 Bacteria 5262
221 Ga0496102_0067331 3300048905 Bacteria 3285
222 Ga0496107_0640409 3300048910 Bacteria 784
223 Ga0496108_0017567 3300048911 Bacteria 5853
224 Ga0496109_0229961 3300048912 Bacteria 1744
225 Ga0496110_0094835 3300048913 Bacteria 2672
226 Ga0496111_0641404 3300048914 Bacteria 775
227 Ga0496112_0035659 3300048915 Bacteria 4848
228 Ga0496112_0169740 3300048915 Bacteria 2147
229 Ga0496125_0001016 3300048928 Bacteria 43614
230 Ga0496126_0039603 3300048929 Bacteria 4372
231 Ga0496126_0189697 3300048929 Bacteria 1742
232 Ga0496126_0508542 3300048929 Bacteria 961
233 Ga0501034_0113927 3300049571 Bacteria 2693
234 Ga0501034_0237539 3300049571 Bacteria 1769
235 Ga0501034_0307318 3300049571 Bacteria 1521
236 Ga0501072_0001534 3300049588 Bacteria 17271
237 Ga0501073_0380354 3300049589 Bacteria 975
238 Ga0501225_0001698 3300049705 Bacteria 6887
239 Ga0501080_0789097 3300049742 Bacteria 834
240 Ga0501083_0167687 3300049744 Bacteria 1435
241 nmdc:mga03n38_77151_c1 3300050490 Bacteria 1556
242 nmdc:mga00v17_12875_c1 3300050491 Bacteria 4628
243 nmdc:mga00v17_204606_c1 3300050491 Bacteria 1276
244 nmdc:mga0yw44_113864_c1 3300050492 Bacteria 1736
245 nmdc:mga04h51_96905_c1 3300050495 Unclassified 1069
246 nmdc:mga07m45_88460_c1 3300050496 Bacteria 1773
247 nmdc:mga05p37_73244_c1 3300050507 Bacteria 4215
248 Ga0495601_0024429 3300053077 Bacteria 3721
249 Ga0495601_0156487 3300053077 Bacteria 1488
250 Ga0495612_0157779 3300053078 Bacteria 989
251 Ga0495619_0003483 3300053085 Bacteria 10158
252 Ga0495619_0004137 3300053085 Bacteria 9273
253 Ga0500646_0020125 3300053090 Bacteria 1771
254 Ga0500651_0219380 3300053093 Bacteria 1116
255 Ga0500641_0024019 3300053096 Bacteria 2349
256 Ga0500562_001023 3300053108 Bacteria 6847
257 Ga0500595_010608 3300053119 Bacteria 3652
258 Ga0500559_0244396 3300053136 Bacteria 846
259 Ga0500604_0007143 3300053151 Bacteria 2956
260 Ga0500637_0000593 3300053178 Bacteria 14222
261 Ga0500645_001044 3300053730 Bacteria 15423
262 Ga0501082_0000025 3300060353 Bacteria 103262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025916 Ga0207663_10275274 Ga0207663_102752741 168
2 3300025915 Ga0207693_10018455 Ga0207693_100184558 176
3 3300046475 Ga0495639_0205805 Ga0495639_0205805_287_898 179
4 3300046535 Ga0495586_0358849 Ga0495586_0358849_96_707 179
5 3300048910 Ga0496107_0640409 Ga0496107_0640409_185_757 190
6 3300005439 Ga0070711_100127179 Ga0070711_1001271792 192
7 3300006175 Ga0070712_100016574 Ga0070712_1000165741 192
8 3300025933 Ga0207706_10124392 Ga0207706_101243921 201
9 3300046459 Ga0495629_0417317 Ga0495629_0417317_174_815 205
10 3300025906 Ga0207699_10028168 Ga0207699_100281682 209
11 3300025928 Ga0207700_10071342 Ga0207700_100713422 209
12 3300035083 Ga0373926_0087011 Ga0373926_0087011_242_952 210
13 3300035089 Ga0373944_0044560 Ga0373944_0044560_518_1228 210
14 3300035116 Ga0373945_0020284 Ga0373945_0020284_52_762 210
15 3300035170 Ga0373943_0028548 Ga0373943_0028548_127_837 210
16 3300035692 Ga0373935_0235295 Ga0373935_0235295_360_1070 210
17 3300035695 Ga0373927_0195998 Ga0373927_0195998_360_1070 210
18 3300037068 Ga0373925_0295748 Ga0373925_0295748_447_1157 210
19 3300046459 Ga0495629_0017418 Ga0495629_0017418_146_856 210
20 3300046463 Ga0495653_0241592 Ga0495653_0241592_315_1025 210
21 3300046476 Ga0495662_0009013 Ga0495662_0009013_149_859 210
22 3300046477 Ga0495664_0000314 Ga0495664_0000314_3941_4651 210
23 3300046514 Ga0495618_0224996 Ga0495618_0224996_344_1054 210
24 3300046517 Ga0495630_0003906 Ga0495630_0003906_3516_4226 210
25 3300046529 Ga0495652_0123994 Ga0495652_0123994_342_1052 210
26 3300046533 Ga0495640_0202753 Ga0495640_0202753_360_1070 210
27 3300046543 Ga0495645_0002928 Ga0495645_0002928_1792_2502 210
28 3300046642 Ga0495634_0031190 Ga0495634_0031190_2619_3329 210
29 3300046663 Ga0495635_0009928 Ga0495635_0009928_1030_1740 210
30 3300046680 Ga0495646_0148270 Ga0495646_0148270_137_847 210
31 3300046690 Ga0495624_0049722 Ga0495624_0049722_268_978 210
32 3300046809 Ga0495600_0344532 Ga0495600_0344532_199_909 210
33 3300047319 Ga0495674_0041537 Ga0495674_0041537_826_1536 210
34 3300047471 Ga0495684_0108298 Ga0495684_0108298_1045_1755 210
35 3300053077 Ga0495601_0024429 Ga0495601_0024429_1321_2031 210
36 3300053078 Ga0495612_0157779 Ga0495612_0157779_151_861 210
37 3300053085 Ga0495619_0004137 Ga0495619_0004137_7650_8360 210
38 3300046663 Ga0495635_0166919 Ga0495635_0166919_817_1452 211
39 3300047445 Ga0495677_0054434 Ga0495677_0054434_817_1455 211
40 3300050507 nmdc:mga05p37_73244_c1 nmdc:mga05p37_73244_c1_25_660 211
41 3300053136 Ga0500559_0244396 Ga0500559_0244396_168_803 211
42 3300025909 Ga0207705_10372226 Ga0207705_103722262 214
43 3300009551 Ga0105238_10035615 Ga0105238_100356153 215
44 3300010375 Ga0105239_10649362 Ga0105239_106493622 215
45 3300013104 Ga0157370_10001797 Ga0157370_100017977 215
46 3300013105 Ga0157369_10025345 Ga0157369_100253454 215
47 3300037471 Ga0395905_0004068 Ga0395905_0004068_12632_13279 215
48 3300046616 Ga0495668_0225871 Ga0495668_0225871_14_682 222
49 3300049742 Ga0501080_0789097 Ga0501080_0789097_69_740 223
50 3300014325 Ga0163163_10038024 Ga0163163_100380243 225
51 3300046514 Ga0495618_0162578 Ga0495618_0162578_562_1239 225
52 3300046535 Ga0495586_0129441 Ga0495586_0129441_601_1278 225
53 3300039437 Ga0436365_1181058 Ga0436365_1181058_614_1294 226
54 3300039450 Ga0436363_0733387 Ga0436363_0733387_3234_3914 226
55 3300049705 Ga0501225_0001698 Ga0501225_0001698_1235_1915 226
56 iso_pu_bacteria 2510065053 2510283094 227
57 iso_pu_bacteria 2510065055 2510293768 227
58 iso_pu_bacteria 2510065058 2510310626 227
59 iso_pu_bacteria 2523231067 2523469246 227
60 iso_pu_bacteria 2773857672 2774131207 227
61 iso_pu_bacteria 2917832318 2917836489 227
62 iso_pu_bacteria 2919125081 2919126484 227
63 iso_pu_bacteria 2974298342 2974302725 227
64 iso_pu_bacteria 2984499530 2984499689 227
65 3300005335 Ga0070666_10015005 Ga0070666_100150056 228
66 3300005347 Ga0070668_100010477 Ga0070668_1000104771 228
67 3300005353 Ga0070669_100030985 Ga0070669_1000309854 228
68 3300005367 Ga0070667_100000130 Ga0070667_10000013033 228
69 3300005841 Ga0068863_100000029 Ga0068863_100000029103 228
70 3300005843 Ga0068860_100059997 Ga0068860_1000599974 228
71 3300025903 Ga0207680_10011052 Ga0207680_100110525 228
72 3300025923 Ga0207681_10022283 Ga0207681_100222832 228
73 3300025972 Ga0207668_10003902 Ga0207668_100039028 228
74 3300025986 Ga0207658_10000100 Ga0207658_1000010061 228
75 3300026088 Ga0207641_10000049 Ga0207641_10000049103 228
76 3300027876 Ga0209974_10071312 Ga0209974_100713121 228
77 3300028381 Ga0268264_10079608 Ga0268264_100796083 228
78 3300046471 Ga0495650_0001375 Ga0495650_0001375_13012_13704 228
79 3300049571 Ga0501034_0237539 Ga0501034_0237539_227_916 228
80 3300003187 JGI25151J46595_10000044 JGI25151J46595_1000004420 229
81 3300003320 rootH2_10111590 rootH2_101115901 229
82 3300003320 rootH2_10162982 rootH2_101629822 229
83 3300003771 Ga0055526_1000091 Ga0055526_10000917 229
84 3300005338 Ga0068868_100029298 Ga0068868_1000292982 229
85 3300005366 Ga0070659_100006653 Ga0070659_1000066534 229
86 3300005366 Ga0070659_100098723 Ga0070659_1000987232 229
87 3300005455 Ga0070663_100229652 Ga0070663_1002296521 229
88 3300005459 Ga0068867_100138659 Ga0068867_1001386592 229
89 3300005543 Ga0070672_100164766 Ga0070672_1001647662 229
90 3300005548 Ga0070665_100351859 Ga0070665_1003518591 229
91 3300005564 Ga0070664_100062451 Ga0070664_1000624512 229
92 3300005577 Ga0068857_100044800 Ga0068857_1000448002 229
93 3300005614 Ga0068856_100095657 Ga0068856_1000956572 229
94 3300006051 Ga0075364_10055562 Ga0075364_100555623 229
95 3300006051 Ga0075364_10107486 Ga0075364_101074862 229
96 3300006177 Ga0075362_10026425 Ga0075362_100264253 229
97 3300006177 Ga0075362_10034897 Ga0075362_100348972 229
98 3300006195 Ga0075366_10028626 Ga0075366_100286262 229
99 3300006881 Ga0068865_100067905 Ga0068865_1000679052 229
100 3300009011 Ga0105251_10001747 Ga0105251_1000174710 229
101 3300009036 Ga0105244_10021467 Ga0105244_100214672 229
102 3300009174 Ga0105241_10140359 Ga0105241_101403591 229
103 3300009174 Ga0105241_10977786 Ga0105241_109777861 229
104 3300009551 Ga0105238_10040446 Ga0105238_100404462 229
105 3300010375 Ga0105239_10108325 Ga0105239_101083252 229
106 3300010375 Ga0105239_10263807 Ga0105239_102638072 229
107 3300013102 Ga0157371_10001847 Ga0157371_100018474 229
108 3300013102 Ga0157371_10052458 Ga0157371_100524584 229
109 3300013102 Ga0157371_10181924 Ga0157371_101819242 229
110 3300013105 Ga0157369_10004191 Ga0157369_100041916 229
111 3300013296 Ga0157374_10972454 Ga0157374_109724541 229
112 3300013307 Ga0157372_10023641 Ga0157372_100236414 229
113 3300013307 Ga0157372_10816391 Ga0157372_108163912 229
114 3300025295 Ga0209564_1000017 Ga0209564_1000017125 229
115 3300025735 Ga0207713_1018114 Ga0207713_10181143 229
116 3300025907 Ga0207645_10017507 Ga0207645_100175072 229
117 3300025919 Ga0207657_10014657 Ga0207657_100146572 229
118 3300025924 Ga0207694_10238119 Ga0207694_102381192 229
119 3300025932 Ga0207690_10072330 Ga0207690_100723302 229
120 3300025937 Ga0207669_10043704 Ga0207669_100437042 229
121 3300025945 Ga0207679_10042320 Ga0207679_100423202 229
122 3300026067 Ga0207678_10382961 Ga0207678_103829612 229
123 3300026116 Ga0207674_10039576 Ga0207674_100395762 229
124 3300026142 Ga0207698_10336569 Ga0207698_103365691 229
125 3300030500 Ga0268256_1033721 Ga0268256_10337211 229
126 3300035121 Ga0373960_0063203 Ga0373960_0063203_223_915 229
127 3300035207 Ga0373942_0030491 Ga0373942_0030491_41_733 229
128 3300046528 Ga0495642_0056283 Ga0495642_0056283_77_769 229
129 3300048913 Ga0496110_0094835 Ga0496110_0094835_1080_1772 229
130 3300048914 Ga0496111_0641404 Ga0496111_0641404_17_709 229
131 3300048915 Ga0496112_0035659 Ga0496112_0035659_2121_2813 229
132 3300049571 Ga0501034_0113927 Ga0501034_0113927_1848_2540 229
133 3300050491 nmdc:mga00v17_12875_c1 nmdc:mga00v17_12875_c1_276_968 229
134 3300050491 nmdc:mga00v17_204606_c1 nmdc:mga00v17_204606_c1_133_825 229
135 3300050495 nmdc:mga04h51_96905_c1 nmdc:mga04h51_96905_c1_61_753 229
136 3300053077 Ga0495601_0156487 Ga0495601_0156487_788_1477 229
137 iso_pu_bacteria 2513237098 2513675270 229
138 iso_pu_bacteria 2885383462 2885389509 229
139 iso_pu_bacteria 2984504281 2984506840 229
140 iso_pu_bacteria 8016728285 8016731114 229
141 3300005458 Ga0070681_10000669 Ga0070681_100006696 230
142 3300005530 Ga0070679_100211396 Ga0070679_1002113962 230
143 3300025912 Ga0207707_10010675 Ga0207707_100106756 230
144 3300026078 Ga0207702_10405163 Ga0207702_104051632 230
145 3300038705 Ga0237819_00331 Ga0237819_00331_21_725 230
146 3300048929 Ga0496126_0039603 Ga0496126_0039603_2938_3687 230
147 3300050490 nmdc:mga03n38_77151_c1 nmdc:mga03n38_77151_c1_791_1489 230
148 3300053096 Ga0500641_0024019 Ga0500641_0024019_1625_2317 230
149 3300053108 Ga0500562_001023 Ga0500562_001023_1841_2533 230
150 3300005336 Ga0070680_100530034 Ga0070680_1005300341 231
151 3300005364 Ga0070673_100086808 Ga0070673_1000868082 231
152 3300005438 Ga0070701_10150560 Ga0070701_101505602 231
153 3300005458 Ga0070681_10069282 Ga0070681_100692822 231
154 3300005471 Ga0070698_100046453 Ga0070698_1000464533 231
155 3300005530 Ga0070679_100004175 Ga0070679_1000041752 231
156 3300005563 Ga0068855_100019362 Ga0068855_1000193626 231
157 3300005578 Ga0068854_100366359 Ga0068854_1003663592 231
158 3300005614 Ga0068856_100006229 Ga0068856_1000062297 231
159 3300005614 Ga0068856_100670293 Ga0068856_1006702932 231
160 3300005718 Ga0068866_10035205 Ga0068866_100352052 231
161 3300005983 Ga0081540_1007125 Ga0081540_100712510 231
162 3300005983 Ga0081540_1030754 Ga0081540_10307544 231
163 3300006051 Ga0075364_10103476 Ga0075364_101034763 231
164 3300006175 Ga0070712_100500529 Ga0070712_1005005291 231
165 3300006844 Ga0075428_100083811 Ga0075428_1000838112 231
166 3300006847 Ga0075431_100243703 Ga0075431_1002437032 231
167 3300006852 Ga0075433_10787529 Ga0075433_107875291 231
168 3300006880 Ga0075429_100524587 Ga0075429_1005245872 231
169 3300009147 Ga0114129_10116927 Ga0114129_101169274 231
170 3300009553 Ga0105249_10208748 Ga0105249_102087481 231
171 3300013297 Ga0157378_10093342 Ga0157378_100933422 231
172 3300013297 Ga0157378_10156766 Ga0157378_101567663 231
173 3300014969 Ga0157376_10272909 Ga0157376_102729092 231
174 3300025899 Ga0207642_10010674 Ga0207642_100106745 231
175 3300025901 Ga0207688_10464332 Ga0207688_104643321 231
176 3300025912 Ga0207707_10000408 Ga0207707_100004086 231
177 3300025912 Ga0207707_10057889 Ga0207707_100578893 231
178 3300025913 Ga0207695_10002946 Ga0207695_1000294619 231
179 3300025917 Ga0207660_10032907 Ga0207660_100329073 231
180 3300025921 Ga0207652_10012101 Ga0207652_100121015 231
181 3300025924 Ga0207694_10008477 Ga0207694_100084772 231
182 3300025949 Ga0207667_10003991 Ga0207667_100039916 231
183 3300025981 Ga0207640_10280529 Ga0207640_102805292 231
184 3300026067 Ga0207678_10128948 Ga0207678_101289483 231
185 3300026078 Ga0207702_10004851 Ga0207702_100048517 231
186 3300026078 Ga0207702_10634073 Ga0207702_106340732 231
187 3300026121 Ga0207683_10008827 Ga0207683_100088272 231
188 3300028786 Ga0307517_10000196 Ga0307517_1000019614 231
189 3300030733 Ga0314311_1051972 Ga0314311_10519724 231
190 3300031250 Ga0265331_10093848 Ga0265331_100938482 231
191 3300031711 Ga0265314_10128119 Ga0265314_101281192 231
192 3300046460 Ga0495638_0021946 Ga0495638_0021946_2970_3671 231
193 3300046471 Ga0495650_0015683 Ga0495650_0015683_2279_2974 231
194 3300046515 Ga0495620_0069012 Ga0495620_0069012_138_833 231
195 3300048905 Ga0496102_0067331 Ga0496102_0067331_316_1017 231
196 3300048928 Ga0496125_0001016 Ga0496125_0001016_33244_33951 231
197 3300048929 Ga0496126_0189697 Ga0496126_0189697_454_1155 231
198 3300048929 Ga0496126_0508542 Ga0496126_0508542_231_938 231
199 3300049571 Ga0501034_0307318 Ga0501034_0307318_226_927 231
200 3300049588 Ga0501072_0001534 Ga0501072_0001534_7081_7782 231
201 3300049589 Ga0501073_0380354 Ga0501073_0380354_158_859 231
202 3300049744 Ga0501083_0167687 Ga0501083_0167687_192_893 231
203 3300050492 nmdc:mga0yw44_113864_c1 nmdc:mga0yw44_113864_c1_35_736 231
204 3300053085 Ga0495619_0003483 Ga0495619_0003483_520_1221 231
205 3300053093 Ga0500651_0219380 Ga0500651_0219380_369_1070 231
206 3300053119 Ga0500595_010608 Ga0500595_010608_818_1513 231
207 3300053151 Ga0500604_0007143 Ga0500604_0007143_599_1300 231
208 3300053178 Ga0500637_0000593 Ga0500637_0000593_3969_4670 231
209 3300060353 Ga0501082_0000025 Ga0501082_0000025_78034_78735 231
210 3300003322 rootL2_10129054 rootL2_101290541 232
211 3300003794 Ga0055531_10004091 Ga0055531_100040911 232
212 3300005471 Ga0070698_100545046 Ga0070698_1005450462 232
213 3300021441 Ga0213871_10099386 Ga0213871_100993861 232
214 3300025297 Ga0209758_1000431 Ga0209758_10004312 232
215 3300025298 Ga0209050_1000098 Ga0209050_10000982 232
216 3300025304 Ga0209257_1000221 Ga0209257_100022133 232
217 3300039450 Ga0436363_0746016 Ga0436363_0746016_289_996 232
218 3300044712 Ga0453684_0116896 Ga0453684_0116896_1757_2461 232
219 3300045051 Ga0451576_0078324 Ga0451576_0078324_450_1154 232
220 3300053090 Ga0500646_0020125 Ga0500646_0020125_464_1168 232
221 3300041404 Ga0439436_0008302 Ga0439436_0008302_239_982 233
222 3300041407 Ga0439447_000864 Ga0439447_000864_5088_5831 233
223 3300041411 Ga0439466_0079879 Ga0439466_0079879_148_891 233
224 3300042006 Ga0439432_001445 Ga0439432_001445_6736_7479 233
225 3300042010 Ga0439452_000774 Ga0439452_000774_12293_13036 233
226 3300042156 Ga0439446_0007778 Ga0439446_0007778_610_1353 233
227 3300046506 Ga0495583_0010839 Ga0495583_0010839_4360_5061 233
228 3300046660 Ga0495625_0278689 Ga0495625_0278689_31_732 233
229 3300053730 Ga0500645_001044 Ga0500645_001044_14175_14876 233
230 3300004625 Ga0055543_1005804 Ga0055543_10058042 234
231 3300005262 Ga0065165_1002439 Ga0065165_100243915 234
232 3300005985 Ga0081539_10004115 Ga0081539_100041157 234
233 3300006028 Ga0070717_10099378 Ga0070717_100993783 234
234 3300006177 Ga0075362_10070545 Ga0075362_100705452 234
235 3300009177 Ga0105248_10001357 Ga0105248_100013573 234
236 3300025941 Ga0207711_10000843 Ga0207711_100008432 234
237 3300031616 Ga0307508_10227516 Ga0307508_102275162 234
238 3300047320 Ga0495672_0018455 Ga0495672_0018455_437_1150 234
239 3300047472 Ga0495686_0015225 Ga0495686_0015225_2712_3416 234
240 3300050496 nmdc:mga07m45_88460_c1 nmdc:mga07m45_88460_c1_13_723 234
241 3300002741 JGI25157J39369_1014706 JGI25157J39369_10147061 235
242 3300005262 Ga0065165_1025805 Ga0065165_10258052 235
243 3300005329 Ga0070683_100358729 Ga0070683_1003587292 235
244 3300005331 Ga0070670_100080315 Ga0070670_1000803153 235
245 3300005335 Ga0070666_10442961 Ga0070666_104429612 235
246 3300005338 Ga0068868_100231020 Ga0068868_1002310202 235
247 3300005355 Ga0070671_100136958 Ga0070671_1001369582 235
248 3300005364 Ga0070673_100044454 Ga0070673_1000444542 235
249 3300005367 Ga0070667_100535482 Ga0070667_1005354822 235
250 3300005456 Ga0070678_100183268 Ga0070678_1001832682 235
251 3300005457 Ga0070662_100064035 Ga0070662_1000640353 235
252 3300005564 Ga0070664_100057544 Ga0070664_1000575443 235
253 3300005841 Ga0068863_100198830 Ga0068863_1001988302 235
254 3300009177 Ga0105248_10072466 Ga0105248_100724665 235
255 3300013306 Ga0163162_10406362 Ga0163162_104063621 235
256 3300013308 Ga0157375_10213003 Ga0157375_102130033 235
257 3300014325 Ga0163163_10040827 Ga0163163_100408275 235
258 3300025250 Ga0209026_1002760 Ga0209026_10027602 235
259 3300025304 Ga0209257_1000638 Ga0209257_100063827 235
260 3300025925 Ga0207650_10130126 Ga0207650_101301262 235
261 3300025931 Ga0207644_10184025 Ga0207644_101840252 235
262 3300025933 Ga0207706_10081140 Ga0207706_100811402 235
263 3300025941 Ga0207711_10075103 Ga0207711_100751033 235
264 3300025945 Ga0207679_10201586 Ga0207679_102015862 235
265 3300026023 Ga0207677_10186237 Ga0207677_101862372 235
266 3300026088 Ga0207641_10056474 Ga0207641_100564743 235
267 3300026095 Ga0207676_10019141 Ga0207676_100191415 235
268 3300026121 Ga0207683_10060244 Ga0207683_100602442 235
269 3300037471 Ga0395905_0013681 Ga0395905_0013681_59_772 235
270 3300037471 Ga0395905_0087249 Ga0395905_0087249_103_873 235
271 3300046528 Ga0495642_0013696 Ga0495642_0013696_826_1542 235
272 3300046684 Ga0495669_0190160 Ga0495669_0190160_241_957 235
273 3300048911 Ga0496108_0017567 Ga0496108_0017567_3776_4492 235
274 3300048912 Ga0496109_0229961 Ga0496109_0229961_242_958 235
275 3300048915 Ga0496112_0169740 Ga0496112_0169740_116_832 235

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03096

Ndr

Ndr family

69

260

0.84

PF08386

Abhydrolase_4

TAP-like protein

183

260

0.81

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

50

247

0.69

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

7

253

0.6

Structural Annotation

Top 5 Hits

ID Description Score Start End
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.9098 4 234
2xua-assembly1.cif.gz_A crystal structure of the enol-lactonase from burkholderia xenovorans lb400 0.8959 1 231
4uhd-assembly1.cif.gz_A structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) 0.8913 4 234
3om8-assembly1.cif.gz_B the crystal structure of a hydrolase from pseudomonas aeruginosa pa01 0.89 3 230
7dq9-assembly4.cif.gz_D crystal structure of a type-a feruloyl esterase from gut alistipes shahii 0.8889 4 231
ID Description Score Start End Superfamily
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9075 4 233 3.40.50.1820
4uhfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8853 4 233 3.40.50.1820
af_Q5AMS7_12_264_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8734 4 231 3.40.50.1820
af_A0A0R0IG56_1_246_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8682 36 231 3.40.50.1820
3om8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8635 3 230 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7Y9VH29-F1-model_v4 deleted 0.994 1 230
AF-S0G7I8-F1-model_v4 Alpha/beta hydrolase fold protein 0.9875 1 230 GO:0016787
AF-A0A3S0IIC0-F1-model_v4 Alpha/beta fold hydrolase 0.9873 2 230 GO:0016787
AF-A0A165ZYA7-F1-model_v4 Putative aminoacrylate hydrolase RutD (EC 3.5.1.-) 0.9868 3 231 GO:0016787
AF-G8PFI6-F1-model_v4 Hydrolase, alpha/beta fold family protein 0.9867 3 231 GO:0016787

Feature Viewer

pLDDT pTM Quality
97.05 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map