F380164

General Info

Members Datasets Scaffolds Average Seq Length
275 186 550 180

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10005128|Ga0070658_1000512811
Length 204
Sequence VSKPPQQEDTWEQDQSTRSYYYDDAHGYEAYRPTIWTIGHSTRDLEEFIGLLSENGIELLVDVRSYPGSRKFPHFNKESLEVTLPAHGVEYVHLKQLGGRRRVRPGSKNTAWRSKAFQGYADYMETDDFREGIAELLEFSEDKPTAIMCSEAVWWRCHRSMISDYLKAGGASVLHILGAGTVQEHPYTSAAKIVNGELSYEDSA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
77 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
78 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
185 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0
Isolates 0.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.36
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 22.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10005128 3300005327 Bacteria 10663
2 MBSR1b_contig_10099357 2162886012 Bacteria 1033
3 JGI24738J21930_10068123 3300002075 Unclassified 735
4 JGI24035J26624_1003857 3300002126 Bacteria 1421
5 rootH2_10051197 3300003320 Bacteria 1127
6 Ga0065712_10243367 3300005290 Unclassified 978
7 Ga0065715_10005673 3300005293 Bacteria 3092
8 Ga0065715_10097021 3300005293 Unclassified 3775
9 Ga0065707_10160142 3300005295 Bacteria 1571
10 Ga0070676_10012528 3300005328 Bacteria 4633
11 Ga0070690_100130334 3300005330 Bacteria 1698
12 Ga0070670_100092196 3300005331 Bacteria 2605
13 Ga0070670_100306767 3300005331 Bacteria 1389
14 Ga0070677_10037368 3300005333 Bacteria 1894
15 Ga0070666_10114466 3300005335 Bacteria 1867
16 Ga0068868_100043465 3300005338 Unclassified 3509
17 Ga0068868_100075379 3300005338 Bacteria 2696
18 Ga0070689_100083085 3300005340 Unclassified 2517
19 Ga0070689_100631541 3300005340 Bacteria 930
20 Ga0070661_101171170 3300005344 Bacteria 642
21 Ga0070669_100090909 3300005353 Bacteria 2288
22 Ga0070675_100036626 3300005354 Bacteria 3994
23 Ga0070675_100310944 3300005354 Bacteria 1390
24 Ga0070671_100052525 3300005355 Unclassified 3388
25 Ga0070671_100109252 3300005355 Bacteria 2322
26 Ga0070671_100125486 3300005355 Bacteria 2161
27 Ga0070671_100145764 3300005355 Bacteria 1998
28 Ga0070674_100006712 3300005356 Bacteria 6735
29 Ga0070673_100035969 3300005364 Bacteria 3760
30 Ga0070673_100077668 3300005364 Bacteria 2683
31 Ga0070673_100085829 3300005364 Bacteria 2563
32 Ga0070673_100570934 3300005364 Bacteria 1029
33 Ga0070667_100079734 3300005367 Unclassified 2799
34 Ga0070667_100240987 3300005367 Bacteria 1614
35 Ga0070709_10028450 3300005434 Bacteria 3333
36 Ga0070709_10074028 3300005434 Bacteria 2207
37 Ga0070714_100000033 3300005435 Bacteria 131739
38 Ga0070713_100436845 3300005436 Unclassified 1227
39 Ga0070710_10544388 3300005437 Bacteria 801
40 Ga0070711_100029912 3300005439 Bacteria 3600
41 Ga0070705_100106579 3300005440 Bacteria 1782
42 Ga0070705_100134582 3300005440 Unclassified 1617
43 Ga0070700_100058987 3300005441 Unclassified 2414
44 Ga0070694_100162603 3300005444 Bacteria 1639
45 Ga0070708_100040302 3300005445 Bacteria 4090
46 Ga0070708_100575038 3300005445 Bacteria 1062
47 Ga0070708_101245516 3300005445 Bacteria 695
48 Ga0070678_100030158 3300005456 Bacteria 3724
49 Ga0070662_100035837 3300005457 Bacteria 3506
50 Ga0070662_100392445 3300005457 Bacteria 1144
51 Ga0070685_10007588 3300005466 Bacteria 5548
52 Ga0070706_100005008 3300005467 Bacteria 12669
53 Ga0070707_100077133 3300005468 Unclassified 3215
54 Ga0070707_100299599 3300005468 Unclassified 1562
55 Ga0070698_100305239 3300005471 Unclassified 1522
56 Ga0070698_100337074 3300005471 Bacteria 1439
57 Ga0070698_100393671 3300005471 Bacteria 1318
58 Ga0070698_100641457 3300005471 Bacteria 1003
59 Ga0070698_101205636 3300005471 Bacteria 706
60 Ga0070699_100106256 3300005518 Unclassified 2462
61 Ga0070684_100067198 3300005535 Bacteria 3148
62 Ga0070697_100030510 3300005536 Bacteria 4331
63 Ga0070697_100398156 3300005536 Bacteria 1194
64 Ga0068853_100392777 3300005539 Unclassified 1297
65 Ga0068853_100904182 3300005539 Bacteria 848
66 Ga0070672_100032873 3300005543 Unclassified 3921
67 Ga0070672_100092173 3300005543 Bacteria 2446
68 Ga0070672_100364974 3300005543 Bacteria 1233
69 Ga0070672_101027067 3300005543 Bacteria 731
70 Ga0070686_100003577 3300005544 Bacteria 8529
71 Ga0070695_100093940 3300005545 Bacteria 2008
72 Ga0070695_100688935 3300005545 Unclassified 810
73 Ga0070696_100224861 3300005546 Bacteria 1409
74 Ga0070696_100643349 3300005546 Bacteria 859
75 Ga0070693_100096969 3300005547 Bacteria 1788
76 Ga0070665_100297569 3300005548 Bacteria 1616
77 Ga0070665_100615059 3300005548 Unclassified 1099
78 Ga0070664_100470560 3300005564 Bacteria 1155
79 Ga0070664_101129253 3300005564 Bacteria 738
80 Ga0068854_100011088 3300005578 Bacteria 5852
81 Ga0070702_100310263 3300005615 Bacteria 1095
82 Ga0068852_101418173 3300005616 Unclassified 717
83 Ga0068859_100068655 3300005617 Bacteria 3579
84 Ga0068859_100141186 3300005617 Bacteria 2482
85 Ga0068864_100324614 3300005618 Bacteria 1446
86 Ga0068866_10089152 3300005718 Unclassified 1676
87 Ga0068866_10099760 3300005718 Bacteria 1600
88 Ga0068861_100095350 3300005719 Bacteria 2356
89 Ga0068861_100209578 3300005719 Unclassified 1641
90 Ga0068870_10013018 3300005840 Bacteria 3898
91 Ga0068858_100095242 3300005842 Unclassified 2774
92 Ga0068860_100021224 3300005843 Bacteria 6290
93 Ga0068860_100995690 3300005843 Unclassified 856
94 Ga0081455_10163280 3300005937 Bacteria 1705
95 Ga0081540_1106783 3300005983 Bacteria 1193
96 Ga0081539_10022413 3300005985 Bacteria 4179
97 Ga0070716_100019080 3300006173 Unclassified 3581
98 Ga0070712_100029626 3300006175 Bacteria 3671
99 Ga0097621_100002178 3300006237 Bacteria 13408
100 Ga0097621_101288171 3300006237 Bacteria 690
101 Ga0068871_100008713 3300006358 Bacteria 7297
102 Ga0075428_100984243 3300006844 Bacteria 893
103 Ga0068865_100008322 3300006881 Bacteria 6407
104 Ga0068865_100040785 3300006881 Bacteria 3157
105 Ga0075436_100622379 3300006914 Unclassified 796
106 Ga0097620_100068655 3300006931 Bacteria 3579
107 Ga0097620_100141181 3300006931 Bacteria 2482
108 Ga0111539_10881649 3300009094 Bacteria 1041
109 Ga0105245_10179369 3300009098 Unclassified 2022
110 Ga0114129_11454735 3300009147 Bacteria 844
111 Ga0105243_10450927 3300009148 Unclassified 1207
112 Ga0105242_10076431 3300009176 Bacteria 2791
113 Ga0105242_10212189 3300009176 Bacteria 1726
114 Ga0105248_10023953 3300009177 Bacteria 6786
115 Ga0105032_100902 3300009979 Bacteria 2787
116 Ga0105029_103164 3300009984 Bacteria 1093
117 Ga0105028_108399 3300009993 Bacteria 1080
118 Ga0105239_10241553 3300010375 Bacteria 2027
119 Ga0105239_10284590 3300010375 Bacteria 1861
120 Ga0105246_10003721 3300011119 Bacteria 9233
121 Ga0157373_10150120 3300013100 Bacteria 1639
122 Ga0157373_10304550 3300013100 Bacteria 1131
123 Ga0157371_10059310 3300013102 Bacteria 2713
124 Ga0157374_10265873 3300013296 Bacteria 1690
125 Ga0157374_10396272 3300013296 Bacteria 1377
126 Ga0157378_10127316 3300013297 Unclassified 2354
127 Ga0157378_10932597 3300013297 Unclassified 900
128 Ga0157378_11388509 3300013297 Unclassified 745
129 Ga0163162_10063236 3300013306 Bacteria 3743
130 Ga0163162_10181921 3300013306 Bacteria 2228
131 Ga0157372_10197167 3300013307 Unclassified 2332
132 Ga0157372_10567357 3300013307 Bacteria 1323
133 Ga0157375_10064584 3300013308 Unclassified 3645
134 Ga0157375_10212727 3300013308 Bacteria 2091
135 Ga0157375_10314148 3300013308 Unclassified 1731
136 Ga0157375_10481394 3300013308 Unclassified 1406
137 Ga0163163_10007052 3300014325 Bacteria 9877
138 Ga0163163_10045316 3300014325 Bacteria 4316
139 Ga0163163_10374125 3300014325 Bacteria 1482
140 Ga0163163_12400521 3300014325 Unclassified 586
141 Ga0157380_10367275 3300014326 Unclassified 1353
142 Ga0157380_10633583 3300014326 Bacteria 1063
143 Ga0157380_10925531 3300014326 Unclassified 900
144 Ga0157376_10107906 3300014969 Bacteria 2445
145 Ga0163161_10021971 3300017792 Unclassified 4487
146 Ga0163161_10022289 3300017792 Bacteria 4459
147 Ga0213872_10033157 3300021361 Bacteria 2366
148 Ga0207697_10002354 3300025315 Bacteria 9846
149 Ga0207697_10040935 3300025315 Bacteria 1902
150 Ga0207682_10017479 3300025893 Bacteria 2801
151 Ga0207682_10081451 3300025893 Bacteria 1388
152 Ga0207692_10042318 3300025898 Bacteria 2260
153 Ga0207692_10323344 3300025898 Unclassified 944
154 Ga0207642_10088105 3300025899 Bacteria 1526
155 Ga0207688_10008650 3300025901 Bacteria 5540
156 Ga0207680_10020135 3300025903 Bacteria 3583
157 Ga0207685_10102945 3300025905 Bacteria 1224
158 Ga0207699_10060737 3300025906 Bacteria 2271
159 Ga0207699_10064200 3300025906 Bacteria 2221
160 Ga0207645_10007322 3300025907 Bacteria 7802
161 Ga0207643_10017317 3300025908 Bacteria 3939
162 Ga0207705_10003442 3300025909 Bacteria 12040
163 Ga0207684_10003308 3300025910 Bacteria 15817
164 Ga0207684_10076056 3300025910 Bacteria 2853
165 Ga0207684_10079386 3300025910 Bacteria 2792
166 Ga0207684_10133214 3300025910 Bacteria 2133
167 Ga0207684_10319542 3300025910 Bacteria 1338
168 Ga0207693_10001095 3300025915 Bacteria 24368
169 Ga0207693_10026409 3300025915 Unclassified 4596
170 Ga0207693_10616307 3300025915 Bacteria 844
171 Ga0207663_10082875 3300025916 Bacteria 2105
172 Ga0207646_10066185 3300025922 Unclassified 3226
173 Ga0207681_10060047 3300025923 Unclassified 2608
174 Ga0207659_10068234 3300025926 Bacteria 2586
175 Ga0207659_10446577 3300025926 Bacteria 1088
176 Ga0207687_10125420 3300025927 Unclassified 1927
177 Ga0207687_10459356 3300025927 Unclassified 1057
178 Ga0207700_10110439 3300025928 Bacteria 2211
179 Ga0207700_10277973 3300025928 Unclassified 1439
180 Ga0207664_10000382 3300025929 Bacteria 32092
181 Ga0207644_10062929 3300025931 Bacteria 2693
182 Ga0207644_10134250 3300025931 Bacteria 1898
183 Ga0207644_10447917 3300025931 Unclassified 1060
184 Ga0207706_10052483 3300025933 Bacteria 3600
185 Ga0207686_10030017 3300025934 Bacteria 3214
186 Ga0207686_10030503 3300025934 Bacteria 3193
187 Ga0207686_11009676 3300025934 Bacteria 675
188 Ga0207670_10158478 3300025936 Bacteria 1687
189 Ga0207669_10017108 3300025937 Unclassified 3709
190 Ga0207669_10081172 3300025937 Bacteria 2076
191 Ga0207669_10176740 3300025937 Bacteria 1526
192 Ga0207704_10049916 3300025938 Bacteria 2521
193 Ga0207665_10136179 3300025939 Unclassified 1748
194 Ga0207691_10009958 3300025940 Bacteria 9128
195 Ga0207691_10632992 3300025940 Bacteria 904
196 Ga0207691_10879464 3300025940 Bacteria 751
197 Ga0207711_10446144 3300025941 Unclassified 1204
198 Ga0207661_10324360 3300025944 Bacteria 1385
199 Ga0207679_10240850 3300025945 Bacteria 1533
200 Ga0207651_10107627 3300025960 Bacteria 2084
201 Ga0207651_10506975 3300025960 Bacteria 1044
202 Ga0207712_10049660 3300025961 Bacteria 2925
203 Ga0207668_10286798 3300025972 Unclassified 1353
204 Ga0207640_10189144 3300025981 Unclassified 1550
205 Ga0207640_10526180 3300025981 Bacteria 989
206 Ga0207658_10019465 3300025986 Bacteria 4695
207 Ga0207658_10676779 3300025986 Unclassified 931
208 Ga0207677_10046532 3300026023 Bacteria 2906
209 Ga0207703_10386729 3300026035 Unclassified 1295
210 Ga0207639_11122690 3300026041 Unclassified 737
211 Ga0207678_10329312 3300026067 Bacteria 1315
212 Ga0207678_10333144 3300026067 Bacteria 1307
213 Ga0207708_10014853 3300026075 Bacteria 5829
214 Ga0207648_10042614 3300026089 Bacteria 3984
215 Ga0207683_10003301 3300026121 Bacteria 14064
216 Ga0207683_10043559 3300026121 Bacteria 3923
217 Ga0268266_10497343 3300028379 Bacteria 1164
218 Ga0268264_10385696 3300028381 Bacteria 1343
219 Ga0268264_11110691 3300028381 Unclassified 799
220 Ga0307413_10001305 3300031824 Bacteria 9319
221 Ga0307407_10639615 3300031903 Bacteria 796
222 Ga0307414_10006932 3300032004 Bacteria 6347
223 Ga0373944_0079559 3300035089 Bacteria 1080
224 Ga0373939_0228698 3300035114 Unclassified 715
225 Ga0373945_0148246 3300035116 Bacteria 950
226 Ga0373946_0205575 3300035171 Bacteria 945
227 Ga0373935_0089884 3300035692 Bacteria 2009
228 Ga0373927_0028684 3300035695 Unclassified 3631
229 Ga0373927_0482109 3300035695 Unclassified 819
230 Ga0373947_0049637 3300035725 Bacteria 2521
231 Ga0373947_0060818 3300035725 Bacteria 2294
232 Ga0373925_0351227 3300037068 Bacteria 1197
233 Ga0436361_0533070 3300039447 Bacteria 3735
234 Ga0436361_1139798 3300039447 Bacteria 2847
235 Ga0451577_0158715 3300042876 Bacteria 2036
236 Ga0453684_0136003 3300044712 Bacteria 2943
237 Ga0453684_0977856 3300044712 Bacteria 901
238 Ga0495663_0086659 3300046525 Bacteria 1015
239 Ga0495598_0257186 3300046537 Bacteria 648
240 Ga0495621_0002786 3300046539 Bacteria 4752
241 Ga0495656_0024514 3300046615 Bacteria 2383
242 Ga0495669_0086625 3300046684 Bacteria 1442
243 Ga0495670_0024991 3300046691 Bacteria 2954
244 Ga0495636_0033398 3300047318 Bacteria 2113
245 Ga0495677_0062314 3300047445 Bacteria 1384
246 Ga0495684_0076935 3300047471 Bacteria 2534
247 Ga0496100_0011000 3300048903 Bacteria 5133
248 Ga0496101_0028625 3300048904 Unclassified 3891
249 Ga0496102_0046916 3300048905 Bacteria 3924
250 Ga0496102_0399684 3300048905 Bacteria 1292
251 Ga0496103_0008842 3300048906 Bacteria 5974
252 Ga0496104_0132444 3300048907 Bacteria 2395
253 Ga0496106_0014427 3300048909 Bacteria 5838
254 Ga0496107_0008093 3300048910 Bacteria 7263
255 Ga0496112_0086979 3300048915 Unclassified 3092
256 Ga0496113_0074176 3300048916 Bacteria 2594
257 Ga0496114_0198490 3300048917 Bacteria 1757
258 Ga0496115_0013345 3300048918 Bacteria 6214
259 Ga0501032_0081361 3300049569 Bacteria 2155
260 Ga0501034_0024026 3300049571 Bacteria 6202
261 Ga0501034_0148937 3300049571 Bacteria 2316
262 Ga0501036_0062607 3300049572 Bacteria 3151
263 Ga0501037_0010707 3300049573 Bacteria 6738
264 Ga0501038_0067280 3300049574 Bacteria 3048
265 Ga0501071_0733316 3300049587 Bacteria 761
266 Ga0501073_0132810 3300049589 Bacteria 1725
267 Ga0501035_0070673 3300049822 Bacteria 3091
268 Ga0501044_0047339 3300049823 Bacteria 4447
269 nmdc:mga08y16_271847_c1 3300050511 Bacteria 1749
270 nmdc:mga0rr50_663104_c1 3300050513 Unclassified 890
271 nmdc:mga0rr50_874663_c1 3300050513 Unclassified 766
272 nmdc:mga08x19_830089_c1 3300050514 Unclassified 656
273 Ga0495655_0021843 3300053083 Archaea 1454
274 Ga0590077_010267 3300059426 Bacteria 1926
275 2894415762 2894414249 Bacteria 4405451
276 Ga0070658_10005128
277 MBSR1b_contig_10099357
278 JGI24738J21930_10068123
279 JGI24035J26624_1003857
280 rootH2_10051197
281 Ga0065712_10243367
282 Ga0065715_10005673
283 Ga0065715_10097021
284 Ga0065707_10160142
285 Ga0070676_10012528
286 Ga0070690_100130334
287 Ga0070670_100092196
288 Ga0070670_100306767
289 Ga0070677_10037368
290 Ga0070666_10114466
291 Ga0068868_100043465
292 Ga0068868_100075379
293 Ga0070689_100083085
294 Ga0070689_100631541
295 Ga0070661_101171170
296 Ga0070669_100090909
297 Ga0070675_100036626
298 Ga0070675_100310944
299 Ga0070671_100052525
300 Ga0070671_100109252
301 Ga0070671_100125486
302 Ga0070671_100145764
303 Ga0070674_100006712
304 Ga0070673_100035969
305 Ga0070673_100077668
306 Ga0070673_100085829
307 Ga0070673_100570934
308 Ga0070667_100079734
309 Ga0070667_100240987
310 Ga0070709_10028450
311 Ga0070709_10074028
312 Ga0070714_100000033
313 Ga0070713_100436845
314 Ga0070710_10544388
315 Ga0070711_100029912
316 Ga0070705_100106579
317 Ga0070705_100134582
318 Ga0070700_100058987
319 Ga0070694_100162603
320 Ga0070708_100040302
321 Ga0070708_100575038
322 Ga0070708_101245516
323 Ga0070678_100030158
324 Ga0070662_100035837
325 Ga0070662_100392445
326 Ga0070685_10007588
327 Ga0070706_100005008
328 Ga0070707_100077133
329 Ga0070707_100299599
330 Ga0070698_100305239
331 Ga0070698_100337074
332 Ga0070698_100393671
333 Ga0070698_100641457
334 Ga0070698_101205636
335 Ga0070699_100106256
336 Ga0070684_100067198
337 Ga0070697_100030510
338 Ga0070697_100398156
339 Ga0068853_100392777
340 Ga0068853_100904182
341 Ga0070672_100032873
342 Ga0070672_100092173
343 Ga0070672_100364974
344 Ga0070672_101027067
345 Ga0070686_100003577
346 Ga0070695_100093940
347 Ga0070695_100688935
348 Ga0070696_100224861
349 Ga0070696_100643349
350 Ga0070693_100096969
351 Ga0070665_100297569
352 Ga0070665_100615059
353 Ga0070664_100470560
354 Ga0070664_101129253
355 Ga0068854_100011088
356 Ga0070702_100310263
357 Ga0068852_101418173
358 Ga0068859_100068655
359 Ga0068859_100141186
360 Ga0068864_100324614
361 Ga0068866_10089152
362 Ga0068866_10099760
363 Ga0068861_100095350
364 Ga0068861_100209578
365 Ga0068870_10013018
366 Ga0068858_100095242
367 Ga0068860_100021224
368 Ga0068860_100995690
369 Ga0081455_10163280
370 Ga0081540_1106783
371 Ga0081539_10022413
372 Ga0070716_100019080
373 Ga0070712_100029626
374 Ga0097621_100002178
375 Ga0097621_101288171
376 Ga0068871_100008713
377 Ga0075428_100984243
378 Ga0068865_100008322
379 Ga0068865_100040785
380 Ga0075436_100622379
381 Ga0097620_100068655
382 Ga0097620_100141181
383 Ga0111539_10881649
384 Ga0105245_10179369
385 Ga0114129_11454735
386 Ga0105243_10450927
387 Ga0105242_10076431
388 Ga0105242_10212189
389 Ga0105248_10023953
390 Ga0105032_100902
391 Ga0105029_103164
392 Ga0105028_108399
393 Ga0105239_10241553
394 Ga0105239_10284590
395 Ga0105246_10003721
396 Ga0157373_10150120
397 Ga0157373_10304550
398 Ga0157371_10059310
399 Ga0157374_10265873
400 Ga0157374_10396272
401 Ga0157378_10127316
402 Ga0157378_10932597
403 Ga0157378_11388509
404 Ga0163162_10063236
405 Ga0163162_10181921
406 Ga0157372_10197167
407 Ga0157372_10567357
408 Ga0157375_10064584
409 Ga0157375_10212727
410 Ga0157375_10314148
411 Ga0157375_10481394
412 Ga0163163_10007052
413 Ga0163163_10045316
414 Ga0163163_10374125
415 Ga0163163_12400521
416 Ga0157380_10367275
417 Ga0157380_10633583
418 Ga0157380_10925531
419 Ga0157376_10107906
420 Ga0163161_10021971
421 Ga0163161_10022289
422 Ga0213872_10033157
423 Ga0207697_10002354
424 Ga0207697_10040935
425 Ga0207682_10017479
426 Ga0207682_10081451
427 Ga0207692_10042318
428 Ga0207692_10323344
429 Ga0207642_10088105
430 Ga0207688_10008650
431 Ga0207680_10020135
432 Ga0207685_10102945
433 Ga0207699_10060737
434 Ga0207699_10064200
435 Ga0207645_10007322
436 Ga0207643_10017317
437 Ga0207705_10003442
438 Ga0207684_10003308
439 Ga0207684_10076056
440 Ga0207684_10079386
441 Ga0207684_10133214
442 Ga0207684_10319542
443 Ga0207693_10001095
444 Ga0207693_10026409
445 Ga0207693_10616307
446 Ga0207663_10082875
447 Ga0207646_10066185
448 Ga0207681_10060047
449 Ga0207659_10068234
450 Ga0207659_10446577
451 Ga0207687_10125420
452 Ga0207687_10459356
453 Ga0207700_10110439
454 Ga0207700_10277973
455 Ga0207664_10000382
456 Ga0207644_10062929
457 Ga0207644_10134250
458 Ga0207644_10447917
459 Ga0207706_10052483
460 Ga0207686_10030017
461 Ga0207686_10030503
462 Ga0207686_11009676
463 Ga0207670_10158478
464 Ga0207669_10017108
465 Ga0207669_10081172
466 Ga0207669_10176740
467 Ga0207704_10049916
468 Ga0207665_10136179
469 Ga0207691_10009958
470 Ga0207691_10632992
471 Ga0207691_10879464
472 Ga0207711_10446144
473 Ga0207661_10324360
474 Ga0207679_10240850
475 Ga0207651_10107627
476 Ga0207651_10506975
477 Ga0207712_10049660
478 Ga0207668_10286798
479 Ga0207640_10189144
480 Ga0207640_10526180
481 Ga0207658_10019465
482 Ga0207658_10676779
483 Ga0207677_10046532
484 Ga0207703_10386729
485 Ga0207639_11122690
486 Ga0207678_10329312
487 Ga0207678_10333144
488 Ga0207708_10014853
489 Ga0207648_10042614
490 Ga0207683_10003301
491 Ga0207683_10043559
492 Ga0268266_10497343
493 Ga0268264_10385696
494 Ga0268264_11110691
495 Ga0307413_10001305
496 Ga0307407_10639615
497 Ga0307414_10006932
498 Ga0373944_0079559
499 Ga0373939_0228698
500 Ga0373945_0148246
501 Ga0373946_0205575
502 Ga0373935_0089884
503 Ga0373927_0028684
504 Ga0373927_0482109
505 Ga0373947_0049637
506 Ga0373947_0060818
507 Ga0373925_0351227
508 Ga0436361_0533070
509 Ga0436361_1139798
510 Ga0451577_0158715
511 Ga0453684_0136003
512 Ga0453684_0977856
513 Ga0495663_0086659
514 Ga0495598_0257186
515 Ga0495621_0002786
516 Ga0495656_0024514
517 Ga0495669_0086625
518 Ga0495670_0024991
519 Ga0495636_0033398
520 Ga0495677_0062314
521 Ga0495684_0076935
522 Ga0496100_0011000
523 Ga0496101_0028625
524 Ga0496102_0046916
525 Ga0496102_0399684
526 Ga0496103_0008842
527 Ga0496104_0132444
528 Ga0496106_0014427
529 Ga0496107_0008093
530 Ga0496112_0086979
531 Ga0496113_0074176
532 Ga0496114_0198490
533 Ga0496115_0013345
534 Ga0501032_0081361
535 Ga0501034_0024026
536 Ga0501034_0148937
537 Ga0501036_0062607
538 Ga0501037_0010707
539 Ga0501038_0067280
540 Ga0501071_0733316
541 Ga0501073_0132810
542 Ga0501035_0070673
543 Ga0501044_0047339
544 nmdc:mga08y16_271847_c1
545 nmdc:mga0rr50_663104_c1
546 nmdc:mga0rr50_874663_c1
547 nmdc:mga08x19_830089_c1
548 Ga0495655_0021843
549 Ga0590077_010267
550 2894415762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04343

DUF488

Domain of unknown function DUF488

44

166

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lts-assembly1.cif.gz_C structure of the alpha-n-methyltransferase (sonm mutant r67a) and ripp precursor (sona) heteromeric complex (with sah) 0.6413 5 147
6pqz-assembly1.cif.gz_A p133g/s128a s. typhimurium siroheme synthase 0.6265 4 145
6pr0-assembly1.cif.gz_A p133h-s128a s. typhimurium siroheme synthase 0.6261 4 134
6pr1-assembly1.cif.gz_A r260a/s128a s. typhimurium siroheme synthase 0.62 4 145
8t1s-assembly1.cif.gz_A structure of the alpha-n-methyltransferase (sonm) and ripp precursor (sona with qsy deletion) heteromeric complex (bound to sah) 0.6197 5 147
ID Description Score Start End Superfamily
4r0sA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6861 22 143 3.90.190.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.642 4 145 3.40.1010.10
af_Q9CR25_265_367_3.40.50.11860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 3 0.6301 20 66 3.40.50.11860
af_A4I570_4_148_3.40.50.10330 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.6254 31 122 3.40.50.10330
af_Q59SJ9_292_391_3.40.50.11860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Diphthamide synthesis DPH1/DPH2 domain 3 0.6213 20 66 3.40.50.11860
ID Description Score Start End GO Terms
AF-A0A330MRC2-F1-model_v4 HhH-GPD domain-containing protein 0.9965 5 174
AF-A0A0J7J345-F1-model_v4 Fe-S cluster assembly protein HesB 0.9952 5 173
AF-A0A2D9QBK8-F1-model_v4 Fe-S cluster assembly protein HesB 0.995 5 173
AF-A0A3N5E7T3-F1-model_v4 DUF488 domain-containing protein 0.9937 4 173
AF-A0A838T7Z1-F1-model_v4 DUF488 domain-containing protein 0.992 6 174

Map