F380101
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 274 | 223 | 261 | 204 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8055225921|8055226053 |
| Length | 201 |
| Sequence | LFETTDSSNALTVLSKDGRADYFPSIFESDRCAELFSALIDSLDWRVDQIYMFGKLVTTKRKVAWVGDAGCSYKYSGVKKEPQPWTPELLHIKNQLEKISQWKFNSCLLNLYHDGDEGMGWHSDDEPELDQSAPIASLSLGGERKFSFKHKTDKTNVSLILENGSVLLMHAPTQQFWQHSLVKTKRPVAPRMNLTFRAISL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 3 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 4 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 5 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 6 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 7 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 8 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 9 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 10 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 11 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 12 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 13 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 16 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 17 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 76 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 116 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 120 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 121 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 122 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 123 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 124 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 125 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 129 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 130 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 131 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 133 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 138 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 139 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 140 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 175 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 181 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 182 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 183 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 184 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 185 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 186 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 187 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 188 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 189 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 190 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 191 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 207 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 209 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 219 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 220 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 223 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.53 |
| Metatranscriptomes | 0.73 |
| Isolates | 4.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.93 |
| Nodule | 0 |
| Rhizoplane | 3.65 |
| Rhizosphere | 80.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1761633 | 2162886007 | Bacteria | 195701 |
| 2 | JGI24735J21928_10057591 | 3300002067 | Unclassified | 1118 |
| 3 | JGI25162J39368_1000549 | 3300002737 | Bacteria | 27776 |
| 4 | JGI25152J39213_1000034 | 3300002773 | Bacteria | 94987 |
| 5 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 6 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 7 | JGI25165J46597_1000609 | 3300003214 | Bacteria | 30520 |
| 8 | JGI25165J46597_1016493 | 3300003214 | Unclassified | 991 |
| 9 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 10 | rootH2_10099497 | 3300003320 | Bacteria | 9483 |
| 11 | rootL2_10045015 | 3300003322 | Unclassified | 1812 |
| 12 | rootL2_10113801 | 3300003322 | Bacteria | 1578 |
| 13 | rootL2_10263132 | 3300003322 | Bacteria | 2397 |
| 14 | rootH1_10064741 | 3300003323 | Bacteria | 7123 |
| 15 | rootH1_10087193 | 3300003323 | Bacteria | 8068 |
| 16 | rootH1_10096596 | 3300003323 | Bacteria | 8130 |
| 17 | Ga0055534_1004175 | 3300003784 | Bacteria | 4265 |
| 18 | Ga0065704_10000195 | 3300005289 | Bacteria | 195830 |
| 19 | Ga0065704_10109414 | 3300005289 | Bacteria | 2004 |
| 20 | Ga0070658_10013258 | 3300005327 | Bacteria | 6612 |
| 21 | Ga0068868_100414892 | 3300005338 | Archaea | 1164 |
| 22 | Ga0070660_100007758 | 3300005339 | Bacteria | 7484 |
| 23 | Ga0070660_100009868 | 3300005339 | Bacteria | 6733 |
| 24 | Ga0070674_100376093 | 3300005356 | Bacteria | 1154 |
| 25 | Ga0070659_100004632 | 3300005366 | Bacteria | 9825 |
| 26 | Ga0070659_100004962 | 3300005366 | Bacteria | 9522 |
| 27 | Ga0070714_100106722 | 3300005435 | Unclassified | 2474 |
| 28 | Ga0070713_100092798 | 3300005436 | Archaea | 2600 |
| 29 | Ga0070710_10042590 | 3300005437 | Archaea | 2511 |
| 30 | Ga0070710_10084503 | 3300005437 | Archaea | 1860 |
| 31 | Ga0070711_100037202 | 3300005439 | Archaea | 3264 |
| 32 | Ga0070708_100111504 | 3300005445 | Archaea | 2515 |
| 33 | Ga0070698_100239725 | 3300005471 | Archaea | 1747 |
| 34 | Ga0070679_100227950 | 3300005530 | Unclassified | 1823 |
| 35 | Ga0070684_100612605 | 3300005535 | Archaea | 1013 |
| 36 | Ga0068855_100000933 | 3300005563 | Bacteria | 36379 |
| 37 | Ga0068855_100223391 | 3300005563 | Bacteria | 2111 |
| 38 | Ga0068855_100421897 | 3300005563 | Bacteria | 1459 |
| 39 | Ga0068857_100079384 | 3300005577 | Bacteria | 2929 |
| 40 | Ga0068854_100349946 | 3300005578 | Archaea | 1209 |
| 41 | Ga0068856_100026077 | 3300005614 | Bacteria | 5699 |
| 42 | Ga0070702_100068570 | 3300005615 | Archaea | 2088 |
| 43 | Ga0068870_10323639 | 3300005840 | Unclassified | 980 |
| 44 | Ga0068860_100009140 | 3300005843 | Bacteria | 9857 |
| 45 | Ga0068862_100082833 | 3300005844 | Bacteria | 2785 |
| 46 | Ga0081455_10012808 | 3300005937 | Archaea | 8334 |
| 47 | Ga0070717_10086656 | 3300006028 | Archaea | 2636 |
| 48 | Ga0070715_10009424 | 3300006163 | Archaea | 3441 |
| 49 | Ga0070716_100006904 | 3300006173 | Archaea | 5567 |
| 50 | Ga0070712_100079112 | 3300006175 | Archaea | 2375 |
| 51 | Ga0068871_100179060 | 3300006358 | Bacteria | 1821 |
| 52 | Ga0075436_100290324 | 3300006914 | Archaea | 1170 |
| 53 | Ga0075435_100062762 | 3300007076 | Archaea | 3016 |
| 54 | Ga0105251_10198649 | 3300009011 | Archaea | 904 |
| 55 | Ga0105244_10000001 | 3300009036 | Bacteria | 1034899 |
| 56 | Ga0105240_10092803 | 3300009093 | Bacteria | 3685 |
| 57 | Ga0105240_10200502 | 3300009093 | Unclassified | 2339 |
| 58 | Ga0105240_10333809 | 3300009093 | Bacteria | 1724 |
| 59 | Ga0105247_10096501 | 3300009101 | Archaea | 1884 |
| 60 | Ga0114129_10010598 | 3300009147 | Archaea | 13143 |
| 61 | Ga0114129_10195239 | 3300009147 | Archaea | 2745 |
| 62 | Ga0114129_11275543 | 3300009147 | Archaea | 912 |
| 63 | Ga0105241_10121088 | 3300009174 | Archaea | 2107 |
| 64 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 65 | Ga0105239_10031251 | 3300010375 | Bacteria | 5856 |
| 66 | Ga0105239_10438776 | 3300010375 | Bacteria | 1480 |
| 67 | Ga0105246_10026686 | 3300011119 | Archaea | 3778 |
| 68 | Ga0157373_10007333 | 3300013100 | Bacteria | 8213 |
| 69 | Ga0157371_10002095 | 3300013102 | Bacteria | 19477 |
| 70 | Ga0157371_10003503 | 3300013102 | Bacteria | 14190 |
| 71 | Ga0157371_10319372 | 3300013102 | Unclassified | 1127 |
| 72 | Ga0157370_10000018 | 3300013104 | Bacteria | 169223 |
| 73 | Ga0157370_10036431 | 3300013104 | Bacteria | 4773 |
| 74 | Ga0157369_10164647 | 3300013105 | Bacteria | 2339 |
| 75 | Ga0157369_10172132 | 3300013105 | Bacteria | 2281 |
| 76 | Ga0157369_10753097 | 3300013105 | Unclassified | 1002 |
| 77 | Ga0157369_10984741 | 3300013105 | Bacteria | 863 |
| 78 | Ga0157374_10344828 | 3300013296 | Bacteria | 1479 |
| 79 | Ga0157378_10036337 | 3300013297 | Archaea | 4359 |
| 80 | Ga0163162_10000141 | 3300013306 | Bacteria | 65597 |
| 81 | Ga0163162_10020576 | 3300013306 | Bacteria | 6483 |
| 82 | Ga0157372_10000048 | 3300013307 | Bacteria | 142757 |
| 83 | Ga0157372_10000254 | 3300013307 | Bacteria | 59194 |
| 84 | Ga0157372_10089045 | 3300013307 | Archaea | 3506 |
| 85 | Ga0157372_10214443 | 3300013307 | Unclassified | 2231 |
| 86 | Ga0157372_10956181 | 3300013307 | Bacteria | 993 |
| 87 | Ga0157375_10970210 | 3300013308 | Archaea | 991 |
| 88 | Ga0163163_10312378 | 3300014325 | Unclassified | 1625 |
| 89 | Ga0182008_10036839 | 3300014497 | Bacteria | 2447 |
| 90 | Ga0157376_10002675 | 3300014969 | Bacteria | 12106 |
| 91 | Ga0157376_10182832 | 3300014969 | Archaea | 1918 |
| 92 | Ga0182006_1000003 | 3300015261 | Bacteria | 826681 |
| 93 | Ga0183373_1001 | 3300015682 | Bacteria | 1410374 |
| 94 | Ga0163161_10000425 | 3300017792 | Bacteria | 35535 |
| 95 | Ga0163161_10663397 | 3300017792 | Bacteria | 865 |
| 96 | Ga0206351_10171182 | 3300020077 | Unclassified | 925 |
| 97 | Ga0206350_10573314 | 3300020080 | Unclassified | 993 |
| 98 | Ga0207427_100146 | 3300025231 | Bacteria | 81506 |
| 99 | Ga0209437_100096 | 3300025233 | Bacteria | 233558 |
| 100 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 101 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 102 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 103 | Ga0209233_1003070 | 3300025261 | Bacteria | 5945 |
| 104 | Ga0209675_1000053 | 3300025291 | Bacteria | 194511 |
| 105 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 106 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 107 | Ga0207655_1000013 | 3300025728 | Bacteria | 637510 |
| 108 | Ga0207692_10084629 | 3300025898 | Unclassified | 1704 |
| 109 | Ga0207688_10024695 | 3300025901 | Archaea | 3298 |
| 110 | Ga0207647_10008662 | 3300025904 | Bacteria | 7268 |
| 111 | Ga0207685_10274447 | 3300025905 | Archaea | 825 |
| 112 | Ga0207699_10007595 | 3300025906 | Archaea | 5307 |
| 113 | Ga0207705_10197081 | 3300025909 | Bacteria | 1525 |
| 114 | Ga0207654_10173132 | 3300025911 | Archaea | 1403 |
| 115 | Ga0207695_10099598 | 3300025913 | Bacteria | 2904 |
| 116 | Ga0207671_10070016 | 3300025914 | Bacteria | 2614 |
| 117 | Ga0207693_10025303 | 3300025915 | Archaea | 4707 |
| 118 | Ga0207693_10385351 | 3300025915 | Archaea | 1096 |
| 119 | Ga0207663_10006623 | 3300025916 | Archaea | 5951 |
| 120 | Ga0207663_10511222 | 3300025916 | Archaea | 934 |
| 121 | Ga0207657_10023261 | 3300025919 | Bacteria | 5773 |
| 122 | Ga0207657_10046945 | 3300025919 | Bacteria | 3780 |
| 123 | Ga0207646_10090934 | 3300025922 | Archaea | 2732 |
| 124 | Ga0207700_11062727 | 3300025928 | Archaea | 724 |
| 125 | Ga0207690_10003137 | 3300025932 | Bacteria | 9933 |
| 126 | Ga0207690_10003759 | 3300025932 | Bacteria | 9000 |
| 127 | Ga0207669_10191504 | 3300025937 | Bacteria | 1476 |
| 128 | Ga0207665_10017105 | 3300025939 | Archaea | 4762 |
| 129 | Ga0207665_10039795 | 3300025939 | Archaea | 3135 |
| 130 | Ga0207661_10139694 | 3300025944 | Unclassified | 2084 |
| 131 | Ga0207661_10341219 | 3300025944 | Archaea | 1350 |
| 132 | Ga0207667_10005086 | 3300025949 | Bacteria | 16061 |
| 133 | Ga0207667_10334106 | 3300025949 | Bacteria | 1547 |
| 134 | Ga0207677_10132479 | 3300026023 | Unclassified | 1895 |
| 135 | Ga0207702_10156068 | 3300026078 | Unclassified | 2080 |
| 136 | Ga0207676_10411123 | 3300026095 | Bacteria | 1267 |
| 137 | Ga0207675_100522261 | 3300026118 | Bacteria | 1184 |
| 138 | Ga0207683_10348712 | 3300026121 | Bacteria | 1358 |
| 139 | Ga0268265_10670917 | 3300028380 | Unclassified | 998 |
| 140 | Ga0268264_10023275 | 3300028381 | Bacteria | 5054 |
| 141 | Ga0307509_10274866 | 3300031507 | Bacteria | 1450 |
| 142 | Ga0307413_10037637 | 3300031824 | Bacteria | 2796 |
| 143 | Ga0307413_10800949 | 3300031824 | Unclassified | 792 |
| 144 | Ga0307416_100000017 | 3300032002 | Bacteria | 201722 |
| 145 | Ga0307414_10035270 | 3300032004 | Bacteria | 3327 |
| 146 | Ga0307414_10317524 | 3300032004 | Bacteria | 1324 |
| 147 | Ga0307415_101189927 | 3300032126 | Archaea | 718 |
| 148 | Ga0373934_0009437 | 3300035086 | Archaea | 3656 |
| 149 | Ga0373923_0004723 | 3300035111 | Archaea | 4549 |
| 150 | Ga0373936_0015078 | 3300035113 | Archaea | 2960 |
| 151 | Ga0373953_0000716 | 3300035117 | Archaea | 9164 |
| 152 | Ga0373954_0001773 | 3300035118 | Archaea | 8870 |
| 153 | Ga0373956_0001862 | 3300035119 | Archaea | 8693 |
| 154 | Ga0373957_0000560 | 3300035120 | Archaea | 9432 |
| 155 | Ga0373943_0029465 | 3300035170 | Bacteria | 2593 |
| 156 | Ga0373946_0243093 | 3300035171 | Archaea | 876 |
| 157 | Ga0373955_0001842 | 3300035172 | Archaea | 9130 |
| 158 | Ga0373924_0007549 | 3300035410 | Archaea | 3930 |
| 159 | Ga0373935_0064584 | 3300035692 | Archaea | 2347 |
| 160 | Ga0373933_0002737 | 3300035724 | Archaea | 9847 |
| 161 | Ga0373947_0230683 | 3300035725 | Archaea | 1219 |
| 162 | Ga0373937_0008517 | 3300036401 | Archaea | 8910 |
| 163 | Ga0373925_0284133 | 3300037068 | Archaea | 1333 |
| 164 | Ga0395901_0233708 | 3300038443 | Bacteria | 1919 |
| 165 | Ga0436361_0475062 | 3300039447 | Bacteria | 1465 |
| 166 | Ga0439436_0044520 | 3300041404 | Bacteria | 1265 |
| 167 | Ga0439443_015536 | 3300042003 | Archaea | 1156 |
| 168 | Ga0439460_0017863 | 3300042461 | Archaea | 1905 |
| 169 | Ga0451576_0005355 | 3300045051 | Bacteria | 16129 |
| 170 | Ga0451576_0234447 | 3300045051 | Bacteria | 1916 |
| 171 | Ga0495592_0005770 | 3300046454 | Archaea | 9167 |
| 172 | Ga0495651_0001886 | 3300046462 | Archaea | 16212 |
| 173 | Ga0495651_0032409 | 3300046462 | Bacteria | 4076 |
| 174 | Ga0495653_0013843 | 3300046463 | Archaea | 6574 |
| 175 | Ga0495606_0011966 | 3300046507 | Bacteria | 7011 |
| 176 | Ga0495608_0034789 | 3300046511 | Archaea | 3401 |
| 177 | Ga0495610_0000006 | 3300046512 | Bacteria | 856822 |
| 178 | Ga0495610_0000113 | 3300046512 | Bacteria | 94595 |
| 179 | Ga0495628_0048453 | 3300046516 | Archaea | 3368 |
| 180 | Ga0495630_0119079 | 3300046517 | Archaea | 2003 |
| 181 | Ga0495632_0003020 | 3300046519 | Bacteria | 12269 |
| 182 | Ga0495652_0008843 | 3300046529 | Archaea | 9164 |
| 183 | Ga0495652_0028737 | 3300046529 | Bacteria | 4890 |
| 184 | Ga0495640_0095019 | 3300046533 | Archaea | 1963 |
| 185 | Ga0495587_0004788 | 3300046536 | Archaea | 8890 |
| 186 | Ga0495645_0041845 | 3300046543 | Archaea | 3340 |
| 187 | Ga0495633_0000003 | 3300046558 | Bacteria | 472476 |
| 188 | Ga0495633_0000650 | 3300046558 | Bacteria | 32279 |
| 189 | Ga0495667_0006315 | 3300046559 | Archaea | 8042 |
| 190 | Ga0495668_0000301 | 3300046616 | Bacteria | 68097 |
| 191 | Ga0495625_0000825 | 3300046660 | Bacteria | 42700 |
| 192 | Ga0495635_0033330 | 3300046663 | Archaea | 3573 |
| 193 | Ga0495657_0008732 | 3300046675 | Archaea | 7736 |
| 194 | Ga0495599_0003368 | 3300046678 | Archaea | 9342 |
| 195 | Ga0495623_0023234 | 3300046679 | Archaea | 4001 |
| 196 | Ga0495646_0015034 | 3300046680 | Archaea | 4916 |
| 197 | Ga0495600_0058087 | 3300046809 | Archaea | 2527 |
| 198 | Ga0495604_0012865 | 3300047317 | Archaea | 6664 |
| 199 | Ga0495674_0068509 | 3300047319 | Archaea | 3071 |
| 200 | Ga0495680_0027024 | 3300047322 | Archaea | 4722 |
| 201 | Ga0495675_0007877 | 3300047444 | Archaea | 6583 |
| 202 | Ga0495686_0000713 | 3300047472 | Bacteria | 44649 |
| 203 | Ga0495686_0098946 | 3300047472 | Bacteria | 1761 |
| 204 | Ga0495602_0012057 | 3300048088 | Archaea | 8910 |
| 205 | Ga0496100_0632727 | 3300048903 | Archaea | 832 |
| 206 | Ga0496102_0174433 | 3300048905 | Bacteria | 2024 |
| 207 | Ga0496104_0122390 | 3300048907 | Archaea | 2498 |
| 208 | Ga0496104_0257222 | 3300048907 | Bacteria | 1659 |
| 209 | Ga0496106_0331177 | 3300048909 | Archaea | 1222 |
| 210 | Ga0496107_0255631 | 3300048910 | Archaea | 1304 |
| 211 | Ga0496110_0450773 | 3300048913 | Unclassified | 1172 |
| 212 | Ga0496111_0248512 | 3300048914 | Unclassified | 1320 |
| 213 | Ga0496112_0093887 | 3300048915 | Archaea | 2970 |
| 214 | Ga0496113_0580009 | 3300048916 | Archaea | 898 |
| 215 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 216 | Ga0496117_0000027 | 3300048920 | Bacteria | 412234 |
| 217 | Ga0496118_0000163 | 3300048921 | Bacteria | 119492 |
| 218 | Ga0496119_0000006 | 3300048922 | Bacteria | 505999 |
| 219 | Ga0496120_0042679 | 3300048923 | Bacteria | 2647 |
| 220 | Ga0496121_0286125 | 3300048924 | Bacteria | 1125 |
| 221 | Ga0496122_0000258 | 3300048925 | Bacteria | 119618 |
| 222 | Ga0496122_0001248 | 3300048925 | Bacteria | 42723 |
| 223 | Ga0496122_0024862 | 3300048925 | Bacteria | 5229 |
| 224 | Ga0496123_0000853 | 3300048926 | Bacteria | 48656 |
| 225 | Ga0496123_0028668 | 3300048926 | Bacteria | 4115 |
| 226 | Ga0496124_0005379 | 3300048927 | Bacteria | 14456 |
| 227 | Ga0496125_0002010 | 3300048928 | Bacteria | 27576 |
| 228 | Ga0496125_0012378 | 3300048928 | Bacteria | 8472 |
| 229 | Ga0496126_0011180 | 3300048929 | Bacteria | 9316 |
| 230 | Ga0501032_0158607 | 3300049569 | Archaea | 1486 |
| 231 | Ga0501033_0153479 | 3300049570 | Archaea | 1660 |
| 232 | Ga0501036_0014631 | 3300049572 | Archaea | 6537 |
| 233 | Ga0501037_0041371 | 3300049573 | Archaea | 3389 |
| 234 | Ga0501038_0009129 | 3300049574 | Archaea | 9097 |
| 235 | Ga0501039_0002180 | 3300049575 | Archaea | 14471 |
| 236 | Ga0501040_0005618 | 3300049576 | Archaea | 8103 |
| 237 | Ga0501041_0001142 | 3300049577 | Archaea | 14527 |
| 238 | Ga0501046_0002261 | 3300049580 | Archaea | 18179 |
| 239 | Ga0501048_0002972 | 3300049582 | Archaea | 12939 |
| 240 | Ga0501071_0000702 | 3300049587 | Archaea | 17554 |
| 241 | Ga0501072_0000102 | 3300049588 | Archaea | 62714 |
| 242 | Ga0501075_0002569 | 3300049591 | Archaea | 12100 |
| 243 | Ga0501076_0001503 | 3300049592 | Archaea | 15625 |
| 244 | Ga0501077_0004659 | 3300049593 | Archaea | 8333 |
| 245 | Ga0501214_004803 | 3300049659 | Unclassified | 1270 |
| 246 | Ga0501235_030173 | 3300049669 | Unclassified | 1222 |
| 247 | Ga0501221_044556 | 3300049704 | Unclassified | 980 |
| 248 | Ga0501225_0002148 | 3300049705 | Bacteria | 6114 |
| 249 | Ga0501079_0002871 | 3300049741 | Archaea | 12573 |
| 250 | Ga0501080_0130464 | 3300049742 | Archaea | 2327 |
| 251 | Ga0501081_0000102 | 3300049743 | Archaea | 35699 |
| 252 | Ga0501044_0976163 | 3300049823 | Archaea | 720 |
| 253 | Ga0501045_0001274 | 3300049824 | Archaea | 16734 |
| 254 | nmdc:mga05p37_1179240_c1 | 3300050507 | Archaea | 793 |
| 255 | nmdc:mga0rr50_266802_c1 | 3300050513 | Archaea | 1426 |
| 256 | Ga0495619_0004198 | 3300053085 | Archaea | 9193 |
| 257 | Ga0500583_0000013 | 3300053092 | Bacteria | 150087 |
| 258 | Ga0500588_0117472 | 3300053146 | Unclassified | 935 |
| 259 | Ga0501084_0001099 | 3300054114 | Archaea | 21089 |
| 260 | Ga0501082_0003317 | 3300060353 | Archaea | 14054 |
| 261 | Ga0530510_0000892 | 3300061734 | Archaea | 19685 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0005355 | Ga0451576_0005355_14607_15146 | 175 |
| 2 | 3300045051 | Ga0451576_0234447 | Ga0451576_0234447_260_799 | 175 |
| 3 | iso_pu_bacteria | 2582581278 | 2585142950 | 195 |
| 4 | iso_pu_bacteria | 2585428182 | 2588210184 | 195 |
| 5 | iso_pu_bacteria | 2585428183 | 2588214600 | 195 |
| 6 | iso_pu_bacteria | 2585428184 | 2588217823 | 195 |
| 7 | iso_pu_bacteria | 2585428185 | 2588222969 | 195 |
| 8 | iso_pu_bacteria | 2816332188 | 2816874305 | 195 |
| 9 | iso_pu_bacteria | 2857627736 | 2857629654 | 195 |
| 10 | iso_pu_bacteria | 2904445276 | 2904446742 | 195 |
| 11 | 3300009093 | Ga0105240_10092803 | Ga0105240_100928034 | 196 |
| 12 | iso_pu_bacteria | 2588254257 | 2590614003 | 196 |
| 13 | iso_pu_bacteria | 2772190705 | 2772606408 | 196 |
| 14 | iso_pu_bacteria | 2842083920 | 2842086037 | 196 |
| 15 | iso_pu_bacteria | 2889290771 | 2889295392 | 196 |
| 16 | 3300002067 | JGI24735J21928_10057591 | JGI24735J21928_100575912 | 197 |
| 17 | 3300003214 | JGI25165J46597_1016493 | JGI25165J46597_10164932 | 197 |
| 18 | 3300005366 | Ga0070659_100004962 | Ga0070659_1000049626 | 197 |
| 19 | 3300005563 | Ga0068855_100421897 | Ga0068855_1004218972 | 197 |
| 20 | 3300005577 | Ga0068857_100079384 | Ga0068857_1000793843 | 197 |
| 21 | 3300013100 | Ga0157373_10007333 | Ga0157373_1000733314 | 197 |
| 22 | 3300013102 | Ga0157371_10002095 | Ga0157371_100020953 | 197 |
| 23 | 3300013104 | Ga0157370_10036431 | Ga0157370_100364313 | 197 |
| 24 | 3300013105 | Ga0157369_10164647 | Ga0157369_101646473 | 197 |
| 25 | 3300013105 | Ga0157369_10172132 | Ga0157369_101721324 | 197 |
| 26 | 3300013307 | Ga0157372_10000254 | Ga0157372_1000025452 | 197 |
| 27 | 3300025261 | Ga0209233_1003070 | Ga0209233_10030704 | 197 |
| 28 | 3300025904 | Ga0207647_10008662 | Ga0207647_100086622 | 197 |
| 29 | 3300025932 | Ga0207690_10003759 | Ga0207690_100037593 | 197 |
| 30 | 3300025949 | Ga0207667_10334106 | Ga0207667_103341062 | 197 |
| 31 | 3300028380 | Ga0268265_10670917 | Ga0268265_106709172 | 197 |
| 32 | 3300038443 | Ga0395901_0233708 | Ga0395901_0233708_606_1205 | 197 |
| 33 | iso_pu_bacteria | 8055225921 | 8055226053 | 197 |
| 34 | 3300005339 | Ga0070660_100007758 | Ga0070660_1000077586 | 198 |
| 35 | 3300005366 | Ga0070659_100004632 | Ga0070659_1000046327 | 198 |
| 36 | 3300005937 | Ga0081455_10012808 | Ga0081455_100128083 | 198 |
| 37 | 3300009147 | Ga0114129_10195239 | Ga0114129_101952392 | 198 |
| 38 | 3300009147 | Ga0114129_11275543 | Ga0114129_112755431 | 198 |
| 39 | 3300010375 | Ga0105239_10000001 | Ga0105239_10000001396 | 198 |
| 40 | 3300025919 | Ga0207657_10023261 | Ga0207657_100232616 | 198 |
| 41 | 3300025932 | Ga0207690_10003137 | Ga0207690_100031377 | 198 |
| 42 | 3300031824 | Ga0307413_10800949 | Ga0307413_108009491 | 198 |
| 43 | 3300042461 | Ga0439460_0017863 | Ga0439460_0017863_1033_1650 | 198 |
| 44 | 3300047472 | Ga0495686_0000713 | Ga0495686_0000713_404_1003 | 198 |
| 45 | 3300050507 | nmdc:mga05p37_1179240_c1 | nmdc:mga05p37_1179240_c1_63_689 | 198 |
| 46 | 2162886007 | SwRhRL2b_contig_1761633 | SwRhRL2b_0391.00006810 | 199 |
| 47 | 3300002737 | JGI25162J39368_1000549 | JGI25162J39368_10005495 | 199 |
| 48 | 3300002773 | JGI25152J39213_1000034 | JGI25152J39213_100003412 | 199 |
| 49 | 3300002774 | JGI25150J39212_1000001 | JGI25150J39212_1000001246 | 199 |
| 50 | 3300003187 | JGI25151J46595_10000001 | JGI25151J46595_10000001554 | 199 |
| 51 | 3300003214 | JGI25165J46597_1000609 | JGI25165J46597_10006097 | 199 |
| 52 | 3300003215 | JGI25153J46596_10000001 | JGI25153J46596_10000001443 | 199 |
| 53 | 3300003320 | rootH2_10099497 | rootH2_100994975 | 199 |
| 54 | 3300003322 | rootL2_10045015 | rootL2_100450153 | 199 |
| 55 | 3300003322 | rootL2_10113801 | rootL2_101138013 | 199 |
| 56 | 3300003322 | rootL2_10263132 | rootL2_102631321 | 199 |
| 57 | 3300003323 | rootH1_10064741 | rootH1_1006474110 | 199 |
| 58 | 3300003323 | rootH1_10087193 | rootH1_100871936 | 199 |
| 59 | 3300003323 | rootH1_10096596 | rootH1_100965965 | 199 |
| 60 | 3300003784 | Ga0055534_1004175 | Ga0055534_10041753 | 199 |
| 61 | 3300005289 | Ga0065704_10000195 | Ga0065704_10000195155 | 199 |
| 62 | 3300005289 | Ga0065704_10109414 | Ga0065704_101094142 | 199 |
| 63 | 3300005327 | Ga0070658_10013258 | Ga0070658_100132588 | 199 |
| 64 | 3300005338 | Ga0068868_100414892 | Ga0068868_1004148922 | 199 |
| 65 | 3300005339 | Ga0070660_100009868 | Ga0070660_1000098682 | 199 |
| 66 | 3300005356 | Ga0070674_100376093 | Ga0070674_1003760932 | 199 |
| 67 | 3300005435 | Ga0070714_100106722 | Ga0070714_1001067223 | 199 |
| 68 | 3300005436 | Ga0070713_100092798 | Ga0070713_1000927985 | 199 |
| 69 | 3300005437 | Ga0070710_10042590 | Ga0070710_100425903 | 199 |
| 70 | 3300005437 | Ga0070710_10084503 | Ga0070710_100845032 | 199 |
| 71 | 3300005439 | Ga0070711_100037202 | Ga0070711_1000372027 | 199 |
| 72 | 3300005445 | Ga0070708_100111504 | Ga0070708_1001115043 | 199 |
| 73 | 3300005471 | Ga0070698_100239725 | Ga0070698_1002397252 | 199 |
| 74 | 3300005530 | Ga0070679_100227950 | Ga0070679_1002279502 | 199 |
| 75 | 3300005535 | Ga0070684_100612605 | Ga0070684_1006126051 | 199 |
| 76 | 3300005563 | Ga0068855_100000933 | Ga0068855_10000093311 | 199 |
| 77 | 3300005563 | Ga0068855_100223391 | Ga0068855_1002233913 | 199 |
| 78 | 3300005578 | Ga0068854_100349946 | Ga0068854_1003499462 | 199 |
| 79 | 3300005614 | Ga0068856_100026077 | Ga0068856_1000260772 | 199 |
| 80 | 3300005615 | Ga0070702_100068570 | Ga0070702_1000685702 | 199 |
| 81 | 3300005840 | Ga0068870_10323639 | Ga0068870_103236392 | 199 |
| 82 | 3300005843 | Ga0068860_100009140 | Ga0068860_1000091404 | 199 |
| 83 | 3300005844 | Ga0068862_100082833 | Ga0068862_1000828332 | 199 |
| 84 | 3300006028 | Ga0070717_10086656 | Ga0070717_100866564 | 199 |
| 85 | 3300006163 | Ga0070715_10009424 | Ga0070715_100094247 | 199 |
| 86 | 3300006173 | Ga0070716_100006904 | Ga0070716_1000069043 | 199 |
| 87 | 3300006175 | Ga0070712_100079112 | Ga0070712_1000791125 | 199 |
| 88 | 3300006358 | Ga0068871_100179060 | Ga0068871_1001790602 | 199 |
| 89 | 3300006914 | Ga0075436_100290324 | Ga0075436_1002903241 | 199 |
| 90 | 3300007076 | Ga0075435_100062762 | Ga0075435_1000627623 | 199 |
| 91 | 3300009011 | Ga0105251_10198649 | Ga0105251_101986491 | 199 |
| 92 | 3300009036 | Ga0105244_10000001 | Ga0105244_10000001272 | 199 |
| 93 | 3300009093 | Ga0105240_10200502 | Ga0105240_102005022 | 199 |
| 94 | 3300009093 | Ga0105240_10333809 | Ga0105240_103338092 | 199 |
| 95 | 3300009101 | Ga0105247_10096501 | Ga0105247_100965011 | 199 |
| 96 | 3300009147 | Ga0114129_10010598 | Ga0114129_100105985 | 199 |
| 97 | 3300009174 | Ga0105241_10121088 | Ga0105241_101210882 | 199 |
| 98 | 3300010375 | Ga0105239_10031251 | Ga0105239_100312514 | 199 |
| 99 | 3300010375 | Ga0105239_10438776 | Ga0105239_104387762 | 199 |
| 100 | 3300011119 | Ga0105246_10026686 | Ga0105246_100266862 | 199 |
| 101 | 3300013102 | Ga0157371_10003503 | Ga0157371_100035036 | 199 |
| 102 | 3300013102 | Ga0157371_10319372 | Ga0157371_103193722 | 199 |
| 103 | 3300013104 | Ga0157370_10000018 | Ga0157370_1000001884 | 199 |
| 104 | 3300013105 | Ga0157369_10753097 | Ga0157369_107530971 | 199 |
| 105 | 3300013105 | Ga0157369_10984741 | Ga0157369_109847412 | 199 |
| 106 | 3300013296 | Ga0157374_10344828 | Ga0157374_103448283 | 199 |
| 107 | 3300013297 | Ga0157378_10036337 | Ga0157378_100363374 | 199 |
| 108 | 3300013306 | Ga0163162_10000141 | Ga0163162_1000014114 | 199 |
| 109 | 3300013306 | Ga0163162_10020576 | Ga0163162_100205762 | 199 |
| 110 | 3300013307 | Ga0157372_10000048 | Ga0157372_1000004846 | 199 |
| 111 | 3300013307 | Ga0157372_10089045 | Ga0157372_100890452 | 199 |
| 112 | 3300013307 | Ga0157372_10214443 | Ga0157372_102144432 | 199 |
| 113 | 3300013307 | Ga0157372_10956181 | Ga0157372_109561812 | 199 |
| 114 | 3300013308 | Ga0157375_10970210 | Ga0157375_109702102 | 199 |
| 115 | 3300014325 | Ga0163163_10312378 | Ga0163163_103123782 | 199 |
| 116 | 3300014497 | Ga0182008_10036839 | Ga0182008_100368393 | 199 |
| 117 | 3300014969 | Ga0157376_10002675 | Ga0157376_100026756 | 199 |
| 118 | 3300014969 | Ga0157376_10182832 | Ga0157376_101828323 | 199 |
| 119 | 3300015261 | Ga0182006_1000003 | Ga0182006_1000003203 | 199 |
| 120 | 3300015682 | Ga0183373_1001 | Ga0183373_1001429 | 199 |
| 121 | 3300017792 | Ga0163161_10000425 | Ga0163161_1000042517 | 199 |
| 122 | 3300017792 | Ga0163161_10663397 | Ga0163161_106633971 | 199 |
| 123 | 3300020077 | Ga0206351_10171182 | Ga0206351_101711822 | 199 |
| 124 | 3300020080 | Ga0206350_10573314 | Ga0206350_105733141 | 199 |
| 125 | 3300025231 | Ga0207427_100146 | Ga0207427_10014649 | 199 |
| 126 | 3300025233 | Ga0209437_100096 | Ga0209437_10009685 | 199 |
| 127 | 3300025245 | Ga0207425_1000002 | Ga0207425_1000002919 | 199 |
| 128 | 3300025258 | Ga0209129_1000002 | Ga0209129_1000002919 | 199 |
| 129 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029461 | 199 |
| 130 | 3300025291 | Ga0209675_1000053 | Ga0209675_1000053173 | 199 |
| 131 | 3300025294 | Ga0209025_1000004 | Ga0209025_1000004271 | 199 |
| 132 | 3300025297 | Ga0209758_1000006 | Ga0209758_1000006271 | 199 |
| 133 | 3300025728 | Ga0207655_1000013 | Ga0207655_1000013398 | 199 |
| 134 | 3300025898 | Ga0207692_10084629 | Ga0207692_100846292 | 199 |
| 135 | 3300025901 | Ga0207688_10024695 | Ga0207688_100246955 | 199 |
| 136 | 3300025905 | Ga0207685_10274447 | Ga0207685_102744471 | 199 |
| 137 | 3300025906 | Ga0207699_10007595 | Ga0207699_100075953 | 199 |
| 138 | 3300025909 | Ga0207705_10197081 | Ga0207705_101970812 | 199 |
| 139 | 3300025911 | Ga0207654_10173132 | Ga0207654_101731322 | 199 |
| 140 | 3300025913 | Ga0207695_10099598 | Ga0207695_100995982 | 199 |
| 141 | 3300025914 | Ga0207671_10070016 | Ga0207671_100700162 | 199 |
| 142 | 3300025915 | Ga0207693_10025303 | Ga0207693_100253034 | 199 |
| 143 | 3300025915 | Ga0207693_10385351 | Ga0207693_103853511 | 199 |
| 144 | 3300025916 | Ga0207663_10006623 | Ga0207663_100066236 | 199 |
| 145 | 3300025916 | Ga0207663_10511222 | Ga0207663_105112221 | 199 |
| 146 | 3300025919 | Ga0207657_10046945 | Ga0207657_100469453 | 199 |
| 147 | 3300025922 | Ga0207646_10090934 | Ga0207646_100909343 | 199 |
| 148 | 3300025928 | Ga0207700_11062727 | Ga0207700_110627271 | 199 |
| 149 | 3300025937 | Ga0207669_10191504 | Ga0207669_101915042 | 199 |
| 150 | 3300025939 | Ga0207665_10017105 | Ga0207665_100171053 | 199 |
| 151 | 3300025939 | Ga0207665_10039795 | Ga0207665_100397954 | 199 |
| 152 | 3300025944 | Ga0207661_10139694 | Ga0207661_101396942 | 199 |
| 153 | 3300025944 | Ga0207661_10341219 | Ga0207661_103412191 | 199 |
| 154 | 3300025949 | Ga0207667_10005086 | Ga0207667_1000508611 | 199 |
| 155 | 3300026023 | Ga0207677_10132479 | Ga0207677_101324791 | 199 |
| 156 | 3300026078 | Ga0207702_10156068 | Ga0207702_101560682 | 199 |
| 157 | 3300026095 | Ga0207676_10411123 | Ga0207676_104111232 | 199 |
| 158 | 3300026118 | Ga0207675_100522261 | Ga0207675_1005222613 | 199 |
| 159 | 3300026121 | Ga0207683_10348712 | Ga0207683_103487123 | 199 |
| 160 | 3300028381 | Ga0268264_10023275 | Ga0268264_100232757 | 199 |
| 161 | 3300031507 | Ga0307509_10274866 | Ga0307509_102748663 | 199 |
| 162 | 3300031824 | Ga0307413_10037637 | Ga0307413_100376372 | 199 |
| 163 | 3300032002 | Ga0307416_100000017 | Ga0307416_100000017202 | 199 |
| 164 | 3300032004 | Ga0307414_10035270 | Ga0307414_100352702 | 199 |
| 165 | 3300032004 | Ga0307414_10317524 | Ga0307414_103175242 | 199 |
| 166 | 3300032126 | Ga0307415_101189927 | Ga0307415_1011899271 | 199 |
| 167 | 3300035086 | Ga0373934_0009437 | Ga0373934_0009437_708_1310 | 199 |
| 168 | 3300035111 | Ga0373923_0004723 | Ga0373923_0004723_1632_2234 | 199 |
| 169 | 3300035113 | Ga0373936_0015078 | Ga0373936_0015078_1504_2106 | 199 |
| 170 | 3300035117 | Ga0373953_0000716 | Ga0373953_0000716_6225_6827 | 199 |
| 171 | 3300035118 | Ga0373954_0001773 | Ga0373954_0001773_2345_2947 | 199 |
| 172 | 3300035119 | Ga0373956_0001862 | Ga0373956_0001862_5776_6378 | 199 |
| 173 | 3300035120 | Ga0373957_0000560 | Ga0373957_0000560_2312_2914 | 199 |
| 174 | 3300035170 | Ga0373943_0029465 | Ga0373943_0029465_1967_2569 | 199 |
| 175 | 3300035171 | Ga0373946_0243093 | Ga0373946_0243093_58_660 | 199 |
| 176 | 3300035172 | Ga0373955_0001842 | Ga0373955_0001842_6188_6790 | 199 |
| 177 | 3300035410 | Ga0373924_0007549 | Ga0373924_0007549_983_1585 | 199 |
| 178 | 3300035692 | Ga0373935_0064584 | Ga0373935_0064584_1278_1880 | 199 |
| 179 | 3300035724 | Ga0373933_0002737 | Ga0373933_0002737_6901_7503 | 199 |
| 180 | 3300035725 | Ga0373947_0230683 | Ga0373947_0230683_454_1056 | 199 |
| 181 | 3300036401 | Ga0373937_0008517 | Ga0373937_0008517_2344_2946 | 199 |
| 182 | 3300037068 | Ga0373925_0284133 | Ga0373925_0284133_38_640 | 199 |
| 183 | 3300039447 | Ga0436361_0475062 | Ga0436361_0475062_518_1129 | 199 |
| 184 | 3300041404 | Ga0439436_0044520 | Ga0439436_0044520_422_1255 | 199 |
| 185 | 3300042003 | Ga0439443_015536 | Ga0439443_015536_273_887 | 199 |
| 186 | 3300046454 | Ga0495592_0005770 | Ga0495592_0005770_2345_2947 | 199 |
| 187 | 3300046462 | Ga0495651_0001886 | Ga0495651_0001886_2345_2947 | 199 |
| 188 | 3300046462 | Ga0495651_0032409 | Ga0495651_0032409_2978_3580 | 199 |
| 189 | 3300046463 | Ga0495653_0013843 | Ga0495653_0013843_2317_2919 | 199 |
| 190 | 3300046507 | Ga0495606_0011966 | Ga0495606_0011966_4536_5150 | 199 |
| 191 | 3300046511 | Ga0495608_0034789 | Ga0495608_0034789_456_1058 | 199 |
| 192 | 3300046512 | Ga0495610_0000006 | Ga0495610_0000006_667008_667619 | 199 |
| 193 | 3300046512 | Ga0495610_0000113 | Ga0495610_0000113_27312_27944 | 199 |
| 194 | 3300046516 | Ga0495628_0048453 | Ga0495628_0048453_2339_2941 | 199 |
| 195 | 3300046517 | Ga0495630_0119079 | Ga0495630_0119079_615_1217 | 199 |
| 196 | 3300046519 | Ga0495632_0003020 | Ga0495632_0003020_964_1575 | 199 |
| 197 | 3300046529 | Ga0495652_0008843 | Ga0495652_0008843_2316_2918 | 199 |
| 198 | 3300046529 | Ga0495652_0028737 | Ga0495652_0028737_3100_3702 | 199 |
| 199 | 3300046533 | Ga0495640_0095019 | Ga0495640_0095019_678_1280 | 199 |
| 200 | 3300046536 | Ga0495587_0004788 | Ga0495587_0004788_5944_6546 | 199 |
| 201 | 3300046543 | Ga0495645_0041845 | Ga0495645_0041845_423_1025 | 199 |
| 202 | 3300046558 | Ga0495633_0000003 | Ga0495633_0000003_308223_308834 | 199 |
| 203 | 3300046558 | Ga0495633_0000650 | Ga0495633_0000650_14400_15011 | 199 |
| 204 | 3300046559 | Ga0495667_0006315 | Ga0495667_0006315_2345_2947 | 199 |
| 205 | 3300046616 | Ga0495668_0000301 | Ga0495668_0000301_37304_37924 | 199 |
| 206 | 3300046660 | Ga0495625_0000825 | Ga0495625_0000825_10387_10998 | 199 |
| 207 | 3300046663 | Ga0495635_0033330 | Ga0495635_0033330_1119_1721 | 199 |
| 208 | 3300046675 | Ga0495657_0008732 | Ga0495657_0008732_4816_5418 | 199 |
| 209 | 3300046678 | Ga0495599_0003368 | Ga0495599_0003368_6247_6849 | 199 |
| 210 | 3300046679 | Ga0495623_0023234 | Ga0495623_0023234_22_624 | 199 |
| 211 | 3300046680 | Ga0495646_0015034 | Ga0495646_0015034_1984_2586 | 199 |
| 212 | 3300046809 | Ga0495600_0058087 | Ga0495600_0058087_246_848 | 199 |
| 213 | 3300047317 | Ga0495604_0012865 | Ga0495604_0012865_3719_4321 | 199 |
| 214 | 3300047319 | Ga0495674_0068509 | Ga0495674_0068509_143_745 | 199 |
| 215 | 3300047322 | Ga0495680_0027024 | Ga0495680_0027024_1789_2391 | 199 |
| 216 | 3300047444 | Ga0495675_0007877 | Ga0495675_0007877_2285_2887 | 199 |
| 217 | 3300047472 | Ga0495686_0098946 | Ga0495686_0098946_748_1350 | 199 |
| 218 | 3300048088 | Ga0495602_0012057 | Ga0495602_0012057_2344_2946 | 199 |
| 219 | 3300048903 | Ga0496100_0632727 | Ga0496100_0632727_96_716 | 199 |
| 220 | 3300048905 | Ga0496102_0174433 | Ga0496102_0174433_157_768 | 199 |
| 221 | 3300048907 | Ga0496104_0122390 | Ga0496104_0122390_485_1105 | 199 |
| 222 | 3300048907 | Ga0496104_0257222 | Ga0496104_0257222_384_995 | 199 |
| 223 | 3300048909 | Ga0496106_0331177 | Ga0496106_0331177_271_891 | 199 |
| 224 | 3300048910 | Ga0496107_0255631 | Ga0496107_0255631_452_1072 | 199 |
| 225 | 3300048913 | Ga0496110_0450773 | Ga0496110_0450773_342_962 | 199 |
| 226 | 3300048914 | Ga0496111_0248512 | Ga0496111_0248512_494_1114 | 199 |
| 227 | 3300048915 | Ga0496112_0093887 | Ga0496112_0093887_2127_2747 | 199 |
| 228 | 3300048916 | Ga0496113_0580009 | Ga0496113_0580009_23_643 | 199 |
| 229 | 3300048919 | Ga0496116_0000006 | Ga0496116_0000006_200554_201165 | 199 |
| 230 | 3300048920 | Ga0496117_0000027 | Ga0496117_0000027_154016_154627 | 199 |
| 231 | 3300048921 | Ga0496118_0000163 | Ga0496118_0000163_94031_94642 | 199 |
| 232 | 3300048922 | Ga0496119_0000006 | Ga0496119_0000006_435467_436078 | 199 |
| 233 | 3300048923 | Ga0496120_0042679 | Ga0496120_0042679_718_1329 | 199 |
| 234 | 3300048924 | Ga0496121_0286125 | Ga0496121_0286125_387_998 | 199 |
| 235 | 3300048925 | Ga0496122_0000258 | Ga0496122_0000258_100789_101400 | 199 |
| 236 | 3300048925 | Ga0496122_0001248 | Ga0496122_0001248_1423_2034 | 199 |
| 237 | 3300048925 | Ga0496122_0024862 | Ga0496122_0024862_2710_3318 | 199 |
| 238 | 3300048926 | Ga0496123_0000853 | Ga0496123_0000853_25341_25952 | 199 |
| 239 | 3300048926 | Ga0496123_0028668 | Ga0496123_0028668_169_780 | 199 |
| 240 | 3300048927 | Ga0496124_0005379 | Ga0496124_0005379_13559_14170 | 199 |
| 241 | 3300048928 | Ga0496125_0002010 | Ga0496125_0002010_6113_6724 | 199 |
| 242 | 3300048928 | Ga0496125_0012378 | Ga0496125_0012378_1736_2347 | 199 |
| 243 | 3300048929 | Ga0496126_0011180 | Ga0496126_0011180_274_885 | 199 |
| 244 | 3300049569 | Ga0501032_0158607 | Ga0501032_0158607_138_761 | 199 |
| 245 | 3300049570 | Ga0501033_0153479 | Ga0501033_0153479_204_827 | 199 |
| 246 | 3300049572 | Ga0501036_0014631 | Ga0501036_0014631_3106_3729 | 199 |
| 247 | 3300049573 | Ga0501037_0041371 | Ga0501037_0041371_2040_2663 | 199 |
| 248 | 3300049574 | Ga0501038_0009129 | Ga0501038_0009129_2435_3058 | 199 |
| 249 | 3300049575 | Ga0501039_0002180 | Ga0501039_0002180_2460_3083 | 199 |
| 250 | 3300049576 | Ga0501040_0005618 | Ga0501040_0005618_5853_6476 | 199 |
| 251 | 3300049577 | Ga0501041_0001142 | Ga0501041_0001142_2812_3435 | 199 |
| 252 | 3300049580 | Ga0501046_0002261 | Ga0501046_0002261_8405_9028 | 199 |
| 253 | 3300049582 | Ga0501048_0002972 | Ga0501048_0002972_11111_11734 | 199 |
| 254 | 3300049587 | Ga0501071_0000702 | Ga0501071_0000702_8167_8790 | 199 |
| 255 | 3300049588 | Ga0501072_0000102 | Ga0501072_0000102_408_1031 | 199 |
| 256 | 3300049591 | Ga0501075_0002569 | Ga0501075_0002569_9109_9732 | 199 |
| 257 | 3300049592 | Ga0501076_0001503 | Ga0501076_0001503_5853_6476 | 199 |
| 258 | 3300049593 | Ga0501077_0004659 | Ga0501077_0004659_1754_2377 | 199 |
| 259 | 3300049659 | Ga0501214_004803 | Ga0501214_004803_228_830 | 199 |
| 260 | 3300049669 | Ga0501235_030173 | Ga0501235_030173_97_699 | 199 |
| 261 | 3300049704 | Ga0501221_044556 | Ga0501221_044556_102_704 | 199 |
| 262 | 3300049705 | Ga0501225_0002148 | Ga0501225_0002148_1656_2267 | 199 |
| 263 | 3300049741 | Ga0501079_0002871 | Ga0501079_0002871_2814_3437 | 199 |
| 264 | 3300049742 | Ga0501080_0130464 | Ga0501080_0130464_64_687 | 199 |
| 265 | 3300049743 | Ga0501081_0000102 | Ga0501081_0000102_9130_9753 | 199 |
| 266 | 3300049823 | Ga0501044_0976163 | Ga0501044_0976163_70_693 | 199 |
| 267 | 3300049824 | Ga0501045_0001274 | Ga0501045_0001274_11384_12007 | 199 |
| 268 | 3300050513 | nmdc:mga0rr50_266802_c1 | nmdc:mga0rr50_266802_c1_502_1122 | 199 |
| 269 | 3300053085 | Ga0495619_0004198 | Ga0495619_0004198_2345_2947 | 199 |
| 270 | 3300053092 | Ga0500583_0000013 | Ga0500583_0000013_113104_113715 | 199 |
| 271 | 3300053146 | Ga0500588_0117472 | Ga0500588_0117472_117_728 | 199 |
| 272 | 3300054114 | Ga0501084_0001099 | Ga0501084_0001099_7825_8448 | 199 |
| 273 | 3300060353 | Ga0501082_0003317 | Ga0501082_0003317_10816_11439 | 199 |
| 274 | 3300061734 | Ga0530510_0000892 | Ga0530510_0000892_9909_10532 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3rzl-assembly2.cif.gz_D | duplex interrogation by a direct dna repair protein in the search of damage | 0.9462 | 16 | 199 |
| 3btz-assembly1.cif.gz_A | crystal structure of human abh2 cross-linked to dsdna | 0.9459 | 8 | 199 |
| 3buc-assembly1.cif.gz_A | x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg | 0.9445 | 10 | 199 |
| 3rzg-assembly1.cif.gz_A | duplex interrogation by a direct dna repair protein in the search of damage | 0.9434 | 9 | 199 |
| 3s5a-assembly1.cif.gz_A | abh2 cross-linked to undamaged dsdna-2 with cofactors | 0.9423 | 9 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SIE0_90_314_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9474 | 14 | 198 | 2.60.120.590 |
| 3rzlA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.93 | 9 | 199 | 2.60.120.590 |
| 3rzlA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9069 | 9 | 199 | 2.60.120.590 |
| 2iuwA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8996 | 16 | 199 | 2.60.120.590 |
| af_A4IB22_54_194_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8807 | 88 | 199 | 2.60.120.590 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T4DAR1-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 1.003 | 101 | 199 |
GO:0006307
GO:0008198 GO:0035516 GO:0051747 |
| AF-S7X5J3-F1-model_v4 | DNA repair system specific for alkylated DNA | 0.9997 | 81 | 199 |
GO:0006307
GO:0051213 |
| AF-A0A3D9L1F1-F1-model_v4 | 2-oxoglutarate-Fe(II)-dependent oxygenase superfamily protein | 0.9973 | 112 | 199 |
GO:0006307
GO:0008198 GO:0035516 GO:0051747 |
| AF-A0A644SQM5-F1-model_v4 | Fe2OG dioxygenase domain-containing protein | 0.9956 | 8 | 198 |
GO:0006307
GO:0051213 |
| AF-A0A4Q1C2N9-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.994 | 8 | 197 |
GO:0006307
GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar