F380101

General Info

Members Datasets Scaffolds Average Seq Length
274 223 261 204

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055225921|8055226053
Length 201
Sequence LFETTDSSNALTVLSKDGRADYFPSIFESDRCAELFSALIDSLDWRVDQIYMFGKLVTTKRKVAWVGDAGCSYKYSGVKKEPQPWTPELLHIKNQLEKISQWKFNSCLLNLYHDGDEGMGWHSDDEPELDQSAPIASLSLGGERKFSFKHKTDKTNVSLILENGSVLLMHAPTQQFWQHSLVKTKRPVAPRMNLTFRAISL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
4 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
5 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
6 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
7 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
8 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
9 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
10 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
11 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
12 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
13 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
83 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
88 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
140 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
187 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
188 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
189 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
190 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
207 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
208 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
209 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0.73
Isolates 4.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0
Rhizoplane 3.65
Rhizosphere 80.29
Stem 0
Stem Tuber 0
Unclassified 9.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
2 JGI24735J21928_10057591 3300002067 Unclassified 1118
3 JGI25162J39368_1000549 3300002737 Bacteria 27776
4 JGI25152J39213_1000034 3300002773 Bacteria 94987
5 JGI25150J39212_1000001 3300002774 Bacteria 1318726
6 JGI25151J46595_10000001 3300003187 Bacteria 887211
7 JGI25165J46597_1000609 3300003214 Bacteria 30520
8 JGI25165J46597_1016493 3300003214 Unclassified 991
9 JGI25153J46596_10000001 3300003215 Bacteria 748985
10 rootH2_10099497 3300003320 Bacteria 9483
11 rootL2_10045015 3300003322 Unclassified 1812
12 rootL2_10113801 3300003322 Bacteria 1578
13 rootL2_10263132 3300003322 Bacteria 2397
14 rootH1_10064741 3300003323 Bacteria 7123
15 rootH1_10087193 3300003323 Bacteria 8068
16 rootH1_10096596 3300003323 Bacteria 8130
17 Ga0055534_1004175 3300003784 Bacteria 4265
18 Ga0065704_10000195 3300005289 Bacteria 195830
19 Ga0065704_10109414 3300005289 Bacteria 2004
20 Ga0070658_10013258 3300005327 Bacteria 6612
21 Ga0068868_100414892 3300005338 Archaea 1164
22 Ga0070660_100007758 3300005339 Bacteria 7484
23 Ga0070660_100009868 3300005339 Bacteria 6733
24 Ga0070674_100376093 3300005356 Bacteria 1154
25 Ga0070659_100004632 3300005366 Bacteria 9825
26 Ga0070659_100004962 3300005366 Bacteria 9522
27 Ga0070714_100106722 3300005435 Unclassified 2474
28 Ga0070713_100092798 3300005436 Archaea 2600
29 Ga0070710_10042590 3300005437 Archaea 2511
30 Ga0070710_10084503 3300005437 Archaea 1860
31 Ga0070711_100037202 3300005439 Archaea 3264
32 Ga0070708_100111504 3300005445 Archaea 2515
33 Ga0070698_100239725 3300005471 Archaea 1747
34 Ga0070679_100227950 3300005530 Unclassified 1823
35 Ga0070684_100612605 3300005535 Archaea 1013
36 Ga0068855_100000933 3300005563 Bacteria 36379
37 Ga0068855_100223391 3300005563 Bacteria 2111
38 Ga0068855_100421897 3300005563 Bacteria 1459
39 Ga0068857_100079384 3300005577 Bacteria 2929
40 Ga0068854_100349946 3300005578 Archaea 1209
41 Ga0068856_100026077 3300005614 Bacteria 5699
42 Ga0070702_100068570 3300005615 Archaea 2088
43 Ga0068870_10323639 3300005840 Unclassified 980
44 Ga0068860_100009140 3300005843 Bacteria 9857
45 Ga0068862_100082833 3300005844 Bacteria 2785
46 Ga0081455_10012808 3300005937 Archaea 8334
47 Ga0070717_10086656 3300006028 Archaea 2636
48 Ga0070715_10009424 3300006163 Archaea 3441
49 Ga0070716_100006904 3300006173 Archaea 5567
50 Ga0070712_100079112 3300006175 Archaea 2375
51 Ga0068871_100179060 3300006358 Bacteria 1821
52 Ga0075436_100290324 3300006914 Archaea 1170
53 Ga0075435_100062762 3300007076 Archaea 3016
54 Ga0105251_10198649 3300009011 Archaea 904
55 Ga0105244_10000001 3300009036 Bacteria 1034899
56 Ga0105240_10092803 3300009093 Bacteria 3685
57 Ga0105240_10200502 3300009093 Unclassified 2339
58 Ga0105240_10333809 3300009093 Bacteria 1724
59 Ga0105247_10096501 3300009101 Archaea 1884
60 Ga0114129_10010598 3300009147 Archaea 13143
61 Ga0114129_10195239 3300009147 Archaea 2745
62 Ga0114129_11275543 3300009147 Archaea 912
63 Ga0105241_10121088 3300009174 Archaea 2107
64 Ga0105239_10000001 3300010375 Bacteria 617353
65 Ga0105239_10031251 3300010375 Bacteria 5856
66 Ga0105239_10438776 3300010375 Bacteria 1480
67 Ga0105246_10026686 3300011119 Archaea 3778
68 Ga0157373_10007333 3300013100 Bacteria 8213
69 Ga0157371_10002095 3300013102 Bacteria 19477
70 Ga0157371_10003503 3300013102 Bacteria 14190
71 Ga0157371_10319372 3300013102 Unclassified 1127
72 Ga0157370_10000018 3300013104 Bacteria 169223
73 Ga0157370_10036431 3300013104 Bacteria 4773
74 Ga0157369_10164647 3300013105 Bacteria 2339
75 Ga0157369_10172132 3300013105 Bacteria 2281
76 Ga0157369_10753097 3300013105 Unclassified 1002
77 Ga0157369_10984741 3300013105 Bacteria 863
78 Ga0157374_10344828 3300013296 Bacteria 1479
79 Ga0157378_10036337 3300013297 Archaea 4359
80 Ga0163162_10000141 3300013306 Bacteria 65597
81 Ga0163162_10020576 3300013306 Bacteria 6483
82 Ga0157372_10000048 3300013307 Bacteria 142757
83 Ga0157372_10000254 3300013307 Bacteria 59194
84 Ga0157372_10089045 3300013307 Archaea 3506
85 Ga0157372_10214443 3300013307 Unclassified 2231
86 Ga0157372_10956181 3300013307 Bacteria 993
87 Ga0157375_10970210 3300013308 Archaea 991
88 Ga0163163_10312378 3300014325 Unclassified 1625
89 Ga0182008_10036839 3300014497 Bacteria 2447
90 Ga0157376_10002675 3300014969 Bacteria 12106
91 Ga0157376_10182832 3300014969 Archaea 1918
92 Ga0182006_1000003 3300015261 Bacteria 826681
93 Ga0183373_1001 3300015682 Bacteria 1410374
94 Ga0163161_10000425 3300017792 Bacteria 35535
95 Ga0163161_10663397 3300017792 Bacteria 865
96 Ga0206351_10171182 3300020077 Unclassified 925
97 Ga0206350_10573314 3300020080 Unclassified 993
98 Ga0207427_100146 3300025231 Bacteria 81506
99 Ga0209437_100096 3300025233 Bacteria 233558
100 Ga0207425_1000002 3300025245 Bacteria 1362590
101 Ga0209129_1000002 3300025258 Bacteria 1359086
102 Ga0209233_1000029 3300025261 Bacteria 641642
103 Ga0209233_1003070 3300025261 Bacteria 5945
104 Ga0209675_1000053 3300025291 Bacteria 194511
105 Ga0209025_1000004 3300025294 Bacteria 1361782
106 Ga0209758_1000006 3300025297 Bacteria 1359562
107 Ga0207655_1000013 3300025728 Bacteria 637510
108 Ga0207692_10084629 3300025898 Unclassified 1704
109 Ga0207688_10024695 3300025901 Archaea 3298
110 Ga0207647_10008662 3300025904 Bacteria 7268
111 Ga0207685_10274447 3300025905 Archaea 825
112 Ga0207699_10007595 3300025906 Archaea 5307
113 Ga0207705_10197081 3300025909 Bacteria 1525
114 Ga0207654_10173132 3300025911 Archaea 1403
115 Ga0207695_10099598 3300025913 Bacteria 2904
116 Ga0207671_10070016 3300025914 Bacteria 2614
117 Ga0207693_10025303 3300025915 Archaea 4707
118 Ga0207693_10385351 3300025915 Archaea 1096
119 Ga0207663_10006623 3300025916 Archaea 5951
120 Ga0207663_10511222 3300025916 Archaea 934
121 Ga0207657_10023261 3300025919 Bacteria 5773
122 Ga0207657_10046945 3300025919 Bacteria 3780
123 Ga0207646_10090934 3300025922 Archaea 2732
124 Ga0207700_11062727 3300025928 Archaea 724
125 Ga0207690_10003137 3300025932 Bacteria 9933
126 Ga0207690_10003759 3300025932 Bacteria 9000
127 Ga0207669_10191504 3300025937 Bacteria 1476
128 Ga0207665_10017105 3300025939 Archaea 4762
129 Ga0207665_10039795 3300025939 Archaea 3135
130 Ga0207661_10139694 3300025944 Unclassified 2084
131 Ga0207661_10341219 3300025944 Archaea 1350
132 Ga0207667_10005086 3300025949 Bacteria 16061
133 Ga0207667_10334106 3300025949 Bacteria 1547
134 Ga0207677_10132479 3300026023 Unclassified 1895
135 Ga0207702_10156068 3300026078 Unclassified 2080
136 Ga0207676_10411123 3300026095 Bacteria 1267
137 Ga0207675_100522261 3300026118 Bacteria 1184
138 Ga0207683_10348712 3300026121 Bacteria 1358
139 Ga0268265_10670917 3300028380 Unclassified 998
140 Ga0268264_10023275 3300028381 Bacteria 5054
141 Ga0307509_10274866 3300031507 Bacteria 1450
142 Ga0307413_10037637 3300031824 Bacteria 2796
143 Ga0307413_10800949 3300031824 Unclassified 792
144 Ga0307416_100000017 3300032002 Bacteria 201722
145 Ga0307414_10035270 3300032004 Bacteria 3327
146 Ga0307414_10317524 3300032004 Bacteria 1324
147 Ga0307415_101189927 3300032126 Archaea 718
148 Ga0373934_0009437 3300035086 Archaea 3656
149 Ga0373923_0004723 3300035111 Archaea 4549
150 Ga0373936_0015078 3300035113 Archaea 2960
151 Ga0373953_0000716 3300035117 Archaea 9164
152 Ga0373954_0001773 3300035118 Archaea 8870
153 Ga0373956_0001862 3300035119 Archaea 8693
154 Ga0373957_0000560 3300035120 Archaea 9432
155 Ga0373943_0029465 3300035170 Bacteria 2593
156 Ga0373946_0243093 3300035171 Archaea 876
157 Ga0373955_0001842 3300035172 Archaea 9130
158 Ga0373924_0007549 3300035410 Archaea 3930
159 Ga0373935_0064584 3300035692 Archaea 2347
160 Ga0373933_0002737 3300035724 Archaea 9847
161 Ga0373947_0230683 3300035725 Archaea 1219
162 Ga0373937_0008517 3300036401 Archaea 8910
163 Ga0373925_0284133 3300037068 Archaea 1333
164 Ga0395901_0233708 3300038443 Bacteria 1919
165 Ga0436361_0475062 3300039447 Bacteria 1465
166 Ga0439436_0044520 3300041404 Bacteria 1265
167 Ga0439443_015536 3300042003 Archaea 1156
168 Ga0439460_0017863 3300042461 Archaea 1905
169 Ga0451576_0005355 3300045051 Bacteria 16129
170 Ga0451576_0234447 3300045051 Bacteria 1916
171 Ga0495592_0005770 3300046454 Archaea 9167
172 Ga0495651_0001886 3300046462 Archaea 16212
173 Ga0495651_0032409 3300046462 Bacteria 4076
174 Ga0495653_0013843 3300046463 Archaea 6574
175 Ga0495606_0011966 3300046507 Bacteria 7011
176 Ga0495608_0034789 3300046511 Archaea 3401
177 Ga0495610_0000006 3300046512 Bacteria 856822
178 Ga0495610_0000113 3300046512 Bacteria 94595
179 Ga0495628_0048453 3300046516 Archaea 3368
180 Ga0495630_0119079 3300046517 Archaea 2003
181 Ga0495632_0003020 3300046519 Bacteria 12269
182 Ga0495652_0008843 3300046529 Archaea 9164
183 Ga0495652_0028737 3300046529 Bacteria 4890
184 Ga0495640_0095019 3300046533 Archaea 1963
185 Ga0495587_0004788 3300046536 Archaea 8890
186 Ga0495645_0041845 3300046543 Archaea 3340
187 Ga0495633_0000003 3300046558 Bacteria 472476
188 Ga0495633_0000650 3300046558 Bacteria 32279
189 Ga0495667_0006315 3300046559 Archaea 8042
190 Ga0495668_0000301 3300046616 Bacteria 68097
191 Ga0495625_0000825 3300046660 Bacteria 42700
192 Ga0495635_0033330 3300046663 Archaea 3573
193 Ga0495657_0008732 3300046675 Archaea 7736
194 Ga0495599_0003368 3300046678 Archaea 9342
195 Ga0495623_0023234 3300046679 Archaea 4001
196 Ga0495646_0015034 3300046680 Archaea 4916
197 Ga0495600_0058087 3300046809 Archaea 2527
198 Ga0495604_0012865 3300047317 Archaea 6664
199 Ga0495674_0068509 3300047319 Archaea 3071
200 Ga0495680_0027024 3300047322 Archaea 4722
201 Ga0495675_0007877 3300047444 Archaea 6583
202 Ga0495686_0000713 3300047472 Bacteria 44649
203 Ga0495686_0098946 3300047472 Bacteria 1761
204 Ga0495602_0012057 3300048088 Archaea 8910
205 Ga0496100_0632727 3300048903 Archaea 832
206 Ga0496102_0174433 3300048905 Bacteria 2024
207 Ga0496104_0122390 3300048907 Archaea 2498
208 Ga0496104_0257222 3300048907 Bacteria 1659
209 Ga0496106_0331177 3300048909 Archaea 1222
210 Ga0496107_0255631 3300048910 Archaea 1304
211 Ga0496110_0450773 3300048913 Unclassified 1172
212 Ga0496111_0248512 3300048914 Unclassified 1320
213 Ga0496112_0093887 3300048915 Archaea 2970
214 Ga0496113_0580009 3300048916 Archaea 898
215 Ga0496116_0000006 3300048919 Bacteria 811937
216 Ga0496117_0000027 3300048920 Bacteria 412234
217 Ga0496118_0000163 3300048921 Bacteria 119492
218 Ga0496119_0000006 3300048922 Bacteria 505999
219 Ga0496120_0042679 3300048923 Bacteria 2647
220 Ga0496121_0286125 3300048924 Bacteria 1125
221 Ga0496122_0000258 3300048925 Bacteria 119618
222 Ga0496122_0001248 3300048925 Bacteria 42723
223 Ga0496122_0024862 3300048925 Bacteria 5229
224 Ga0496123_0000853 3300048926 Bacteria 48656
225 Ga0496123_0028668 3300048926 Bacteria 4115
226 Ga0496124_0005379 3300048927 Bacteria 14456
227 Ga0496125_0002010 3300048928 Bacteria 27576
228 Ga0496125_0012378 3300048928 Bacteria 8472
229 Ga0496126_0011180 3300048929 Bacteria 9316
230 Ga0501032_0158607 3300049569 Archaea 1486
231 Ga0501033_0153479 3300049570 Archaea 1660
232 Ga0501036_0014631 3300049572 Archaea 6537
233 Ga0501037_0041371 3300049573 Archaea 3389
234 Ga0501038_0009129 3300049574 Archaea 9097
235 Ga0501039_0002180 3300049575 Archaea 14471
236 Ga0501040_0005618 3300049576 Archaea 8103
237 Ga0501041_0001142 3300049577 Archaea 14527
238 Ga0501046_0002261 3300049580 Archaea 18179
239 Ga0501048_0002972 3300049582 Archaea 12939
240 Ga0501071_0000702 3300049587 Archaea 17554
241 Ga0501072_0000102 3300049588 Archaea 62714
242 Ga0501075_0002569 3300049591 Archaea 12100
243 Ga0501076_0001503 3300049592 Archaea 15625
244 Ga0501077_0004659 3300049593 Archaea 8333
245 Ga0501214_004803 3300049659 Unclassified 1270
246 Ga0501235_030173 3300049669 Unclassified 1222
247 Ga0501221_044556 3300049704 Unclassified 980
248 Ga0501225_0002148 3300049705 Bacteria 6114
249 Ga0501079_0002871 3300049741 Archaea 12573
250 Ga0501080_0130464 3300049742 Archaea 2327
251 Ga0501081_0000102 3300049743 Archaea 35699
252 Ga0501044_0976163 3300049823 Archaea 720
253 Ga0501045_0001274 3300049824 Archaea 16734
254 nmdc:mga05p37_1179240_c1 3300050507 Archaea 793
255 nmdc:mga0rr50_266802_c1 3300050513 Archaea 1426
256 Ga0495619_0004198 3300053085 Archaea 9193
257 Ga0500583_0000013 3300053092 Bacteria 150087
258 Ga0500588_0117472 3300053146 Unclassified 935
259 Ga0501084_0001099 3300054114 Archaea 21089
260 Ga0501082_0003317 3300060353 Archaea 14054
261 Ga0530510_0000892 3300061734 Archaea 19685

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0005355 Ga0451576_0005355_14607_15146 175
2 3300045051 Ga0451576_0234447 Ga0451576_0234447_260_799 175
3 iso_pu_bacteria 2582581278 2585142950 195
4 iso_pu_bacteria 2585428182 2588210184 195
5 iso_pu_bacteria 2585428183 2588214600 195
6 iso_pu_bacteria 2585428184 2588217823 195
7 iso_pu_bacteria 2585428185 2588222969 195
8 iso_pu_bacteria 2816332188 2816874305 195
9 iso_pu_bacteria 2857627736 2857629654 195
10 iso_pu_bacteria 2904445276 2904446742 195
11 3300009093 Ga0105240_10092803 Ga0105240_100928034 196
12 iso_pu_bacteria 2588254257 2590614003 196
13 iso_pu_bacteria 2772190705 2772606408 196
14 iso_pu_bacteria 2842083920 2842086037 196
15 iso_pu_bacteria 2889290771 2889295392 196
16 3300002067 JGI24735J21928_10057591 JGI24735J21928_100575912 197
17 3300003214 JGI25165J46597_1016493 JGI25165J46597_10164932 197
18 3300005366 Ga0070659_100004962 Ga0070659_1000049626 197
19 3300005563 Ga0068855_100421897 Ga0068855_1004218972 197
20 3300005577 Ga0068857_100079384 Ga0068857_1000793843 197
21 3300013100 Ga0157373_10007333 Ga0157373_1000733314 197
22 3300013102 Ga0157371_10002095 Ga0157371_100020953 197
23 3300013104 Ga0157370_10036431 Ga0157370_100364313 197
24 3300013105 Ga0157369_10164647 Ga0157369_101646473 197
25 3300013105 Ga0157369_10172132 Ga0157369_101721324 197
26 3300013307 Ga0157372_10000254 Ga0157372_1000025452 197
27 3300025261 Ga0209233_1003070 Ga0209233_10030704 197
28 3300025904 Ga0207647_10008662 Ga0207647_100086622 197
29 3300025932 Ga0207690_10003759 Ga0207690_100037593 197
30 3300025949 Ga0207667_10334106 Ga0207667_103341062 197
31 3300028380 Ga0268265_10670917 Ga0268265_106709172 197
32 3300038443 Ga0395901_0233708 Ga0395901_0233708_606_1205 197
33 iso_pu_bacteria 8055225921 8055226053 197
34 3300005339 Ga0070660_100007758 Ga0070660_1000077586 198
35 3300005366 Ga0070659_100004632 Ga0070659_1000046327 198
36 3300005937 Ga0081455_10012808 Ga0081455_100128083 198
37 3300009147 Ga0114129_10195239 Ga0114129_101952392 198
38 3300009147 Ga0114129_11275543 Ga0114129_112755431 198
39 3300010375 Ga0105239_10000001 Ga0105239_10000001396 198
40 3300025919 Ga0207657_10023261 Ga0207657_100232616 198
41 3300025932 Ga0207690_10003137 Ga0207690_100031377 198
42 3300031824 Ga0307413_10800949 Ga0307413_108009491 198
43 3300042461 Ga0439460_0017863 Ga0439460_0017863_1033_1650 198
44 3300047472 Ga0495686_0000713 Ga0495686_0000713_404_1003 198
45 3300050507 nmdc:mga05p37_1179240_c1 nmdc:mga05p37_1179240_c1_63_689 198
46 2162886007 SwRhRL2b_contig_1761633 SwRhRL2b_0391.00006810 199
47 3300002737 JGI25162J39368_1000549 JGI25162J39368_10005495 199
48 3300002773 JGI25152J39213_1000034 JGI25152J39213_100003412 199
49 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001246 199
50 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001554 199
51 3300003214 JGI25165J46597_1000609 JGI25165J46597_10006097 199
52 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001443 199
53 3300003320 rootH2_10099497 rootH2_100994975 199
54 3300003322 rootL2_10045015 rootL2_100450153 199
55 3300003322 rootL2_10113801 rootL2_101138013 199
56 3300003322 rootL2_10263132 rootL2_102631321 199
57 3300003323 rootH1_10064741 rootH1_1006474110 199
58 3300003323 rootH1_10087193 rootH1_100871936 199
59 3300003323 rootH1_10096596 rootH1_100965965 199
60 3300003784 Ga0055534_1004175 Ga0055534_10041753 199
61 3300005289 Ga0065704_10000195 Ga0065704_10000195155 199
62 3300005289 Ga0065704_10109414 Ga0065704_101094142 199
63 3300005327 Ga0070658_10013258 Ga0070658_100132588 199
64 3300005338 Ga0068868_100414892 Ga0068868_1004148922 199
65 3300005339 Ga0070660_100009868 Ga0070660_1000098682 199
66 3300005356 Ga0070674_100376093 Ga0070674_1003760932 199
67 3300005435 Ga0070714_100106722 Ga0070714_1001067223 199
68 3300005436 Ga0070713_100092798 Ga0070713_1000927985 199
69 3300005437 Ga0070710_10042590 Ga0070710_100425903 199
70 3300005437 Ga0070710_10084503 Ga0070710_100845032 199
71 3300005439 Ga0070711_100037202 Ga0070711_1000372027 199
72 3300005445 Ga0070708_100111504 Ga0070708_1001115043 199
73 3300005471 Ga0070698_100239725 Ga0070698_1002397252 199
74 3300005530 Ga0070679_100227950 Ga0070679_1002279502 199
75 3300005535 Ga0070684_100612605 Ga0070684_1006126051 199
76 3300005563 Ga0068855_100000933 Ga0068855_10000093311 199
77 3300005563 Ga0068855_100223391 Ga0068855_1002233913 199
78 3300005578 Ga0068854_100349946 Ga0068854_1003499462 199
79 3300005614 Ga0068856_100026077 Ga0068856_1000260772 199
80 3300005615 Ga0070702_100068570 Ga0070702_1000685702 199
81 3300005840 Ga0068870_10323639 Ga0068870_103236392 199
82 3300005843 Ga0068860_100009140 Ga0068860_1000091404 199
83 3300005844 Ga0068862_100082833 Ga0068862_1000828332 199
84 3300006028 Ga0070717_10086656 Ga0070717_100866564 199
85 3300006163 Ga0070715_10009424 Ga0070715_100094247 199
86 3300006173 Ga0070716_100006904 Ga0070716_1000069043 199
87 3300006175 Ga0070712_100079112 Ga0070712_1000791125 199
88 3300006358 Ga0068871_100179060 Ga0068871_1001790602 199
89 3300006914 Ga0075436_100290324 Ga0075436_1002903241 199
90 3300007076 Ga0075435_100062762 Ga0075435_1000627623 199
91 3300009011 Ga0105251_10198649 Ga0105251_101986491 199
92 3300009036 Ga0105244_10000001 Ga0105244_10000001272 199
93 3300009093 Ga0105240_10200502 Ga0105240_102005022 199
94 3300009093 Ga0105240_10333809 Ga0105240_103338092 199
95 3300009101 Ga0105247_10096501 Ga0105247_100965011 199
96 3300009147 Ga0114129_10010598 Ga0114129_100105985 199
97 3300009174 Ga0105241_10121088 Ga0105241_101210882 199
98 3300010375 Ga0105239_10031251 Ga0105239_100312514 199
99 3300010375 Ga0105239_10438776 Ga0105239_104387762 199
100 3300011119 Ga0105246_10026686 Ga0105246_100266862 199
101 3300013102 Ga0157371_10003503 Ga0157371_100035036 199
102 3300013102 Ga0157371_10319372 Ga0157371_103193722 199
103 3300013104 Ga0157370_10000018 Ga0157370_1000001884 199
104 3300013105 Ga0157369_10753097 Ga0157369_107530971 199
105 3300013105 Ga0157369_10984741 Ga0157369_109847412 199
106 3300013296 Ga0157374_10344828 Ga0157374_103448283 199
107 3300013297 Ga0157378_10036337 Ga0157378_100363374 199
108 3300013306 Ga0163162_10000141 Ga0163162_1000014114 199
109 3300013306 Ga0163162_10020576 Ga0163162_100205762 199
110 3300013307 Ga0157372_10000048 Ga0157372_1000004846 199
111 3300013307 Ga0157372_10089045 Ga0157372_100890452 199
112 3300013307 Ga0157372_10214443 Ga0157372_102144432 199
113 3300013307 Ga0157372_10956181 Ga0157372_109561812 199
114 3300013308 Ga0157375_10970210 Ga0157375_109702102 199
115 3300014325 Ga0163163_10312378 Ga0163163_103123782 199
116 3300014497 Ga0182008_10036839 Ga0182008_100368393 199
117 3300014969 Ga0157376_10002675 Ga0157376_100026756 199
118 3300014969 Ga0157376_10182832 Ga0157376_101828323 199
119 3300015261 Ga0182006_1000003 Ga0182006_1000003203 199
120 3300015682 Ga0183373_1001 Ga0183373_1001429 199
121 3300017792 Ga0163161_10000425 Ga0163161_1000042517 199
122 3300017792 Ga0163161_10663397 Ga0163161_106633971 199
123 3300020077 Ga0206351_10171182 Ga0206351_101711822 199
124 3300020080 Ga0206350_10573314 Ga0206350_105733141 199
125 3300025231 Ga0207427_100146 Ga0207427_10014649 199
126 3300025233 Ga0209437_100096 Ga0209437_10009685 199
127 3300025245 Ga0207425_1000002 Ga0207425_1000002919 199
128 3300025258 Ga0209129_1000002 Ga0209129_1000002919 199
129 3300025261 Ga0209233_1000029 Ga0209233_1000029461 199
130 3300025291 Ga0209675_1000053 Ga0209675_1000053173 199
131 3300025294 Ga0209025_1000004 Ga0209025_1000004271 199
132 3300025297 Ga0209758_1000006 Ga0209758_1000006271 199
133 3300025728 Ga0207655_1000013 Ga0207655_1000013398 199
134 3300025898 Ga0207692_10084629 Ga0207692_100846292 199
135 3300025901 Ga0207688_10024695 Ga0207688_100246955 199
136 3300025905 Ga0207685_10274447 Ga0207685_102744471 199
137 3300025906 Ga0207699_10007595 Ga0207699_100075953 199
138 3300025909 Ga0207705_10197081 Ga0207705_101970812 199
139 3300025911 Ga0207654_10173132 Ga0207654_101731322 199
140 3300025913 Ga0207695_10099598 Ga0207695_100995982 199
141 3300025914 Ga0207671_10070016 Ga0207671_100700162 199
142 3300025915 Ga0207693_10025303 Ga0207693_100253034 199
143 3300025915 Ga0207693_10385351 Ga0207693_103853511 199
144 3300025916 Ga0207663_10006623 Ga0207663_100066236 199
145 3300025916 Ga0207663_10511222 Ga0207663_105112221 199
146 3300025919 Ga0207657_10046945 Ga0207657_100469453 199
147 3300025922 Ga0207646_10090934 Ga0207646_100909343 199
148 3300025928 Ga0207700_11062727 Ga0207700_110627271 199
149 3300025937 Ga0207669_10191504 Ga0207669_101915042 199
150 3300025939 Ga0207665_10017105 Ga0207665_100171053 199
151 3300025939 Ga0207665_10039795 Ga0207665_100397954 199
152 3300025944 Ga0207661_10139694 Ga0207661_101396942 199
153 3300025944 Ga0207661_10341219 Ga0207661_103412191 199
154 3300025949 Ga0207667_10005086 Ga0207667_1000508611 199
155 3300026023 Ga0207677_10132479 Ga0207677_101324791 199
156 3300026078 Ga0207702_10156068 Ga0207702_101560682 199
157 3300026095 Ga0207676_10411123 Ga0207676_104111232 199
158 3300026118 Ga0207675_100522261 Ga0207675_1005222613 199
159 3300026121 Ga0207683_10348712 Ga0207683_103487123 199
160 3300028381 Ga0268264_10023275 Ga0268264_100232757 199
161 3300031507 Ga0307509_10274866 Ga0307509_102748663 199
162 3300031824 Ga0307413_10037637 Ga0307413_100376372 199
163 3300032002 Ga0307416_100000017 Ga0307416_100000017202 199
164 3300032004 Ga0307414_10035270 Ga0307414_100352702 199
165 3300032004 Ga0307414_10317524 Ga0307414_103175242 199
166 3300032126 Ga0307415_101189927 Ga0307415_1011899271 199
167 3300035086 Ga0373934_0009437 Ga0373934_0009437_708_1310 199
168 3300035111 Ga0373923_0004723 Ga0373923_0004723_1632_2234 199
169 3300035113 Ga0373936_0015078 Ga0373936_0015078_1504_2106 199
170 3300035117 Ga0373953_0000716 Ga0373953_0000716_6225_6827 199
171 3300035118 Ga0373954_0001773 Ga0373954_0001773_2345_2947 199
172 3300035119 Ga0373956_0001862 Ga0373956_0001862_5776_6378 199
173 3300035120 Ga0373957_0000560 Ga0373957_0000560_2312_2914 199
174 3300035170 Ga0373943_0029465 Ga0373943_0029465_1967_2569 199
175 3300035171 Ga0373946_0243093 Ga0373946_0243093_58_660 199
176 3300035172 Ga0373955_0001842 Ga0373955_0001842_6188_6790 199
177 3300035410 Ga0373924_0007549 Ga0373924_0007549_983_1585 199
178 3300035692 Ga0373935_0064584 Ga0373935_0064584_1278_1880 199
179 3300035724 Ga0373933_0002737 Ga0373933_0002737_6901_7503 199
180 3300035725 Ga0373947_0230683 Ga0373947_0230683_454_1056 199
181 3300036401 Ga0373937_0008517 Ga0373937_0008517_2344_2946 199
182 3300037068 Ga0373925_0284133 Ga0373925_0284133_38_640 199
183 3300039447 Ga0436361_0475062 Ga0436361_0475062_518_1129 199
184 3300041404 Ga0439436_0044520 Ga0439436_0044520_422_1255 199
185 3300042003 Ga0439443_015536 Ga0439443_015536_273_887 199
186 3300046454 Ga0495592_0005770 Ga0495592_0005770_2345_2947 199
187 3300046462 Ga0495651_0001886 Ga0495651_0001886_2345_2947 199
188 3300046462 Ga0495651_0032409 Ga0495651_0032409_2978_3580 199
189 3300046463 Ga0495653_0013843 Ga0495653_0013843_2317_2919 199
190 3300046507 Ga0495606_0011966 Ga0495606_0011966_4536_5150 199
191 3300046511 Ga0495608_0034789 Ga0495608_0034789_456_1058 199
192 3300046512 Ga0495610_0000006 Ga0495610_0000006_667008_667619 199
193 3300046512 Ga0495610_0000113 Ga0495610_0000113_27312_27944 199
194 3300046516 Ga0495628_0048453 Ga0495628_0048453_2339_2941 199
195 3300046517 Ga0495630_0119079 Ga0495630_0119079_615_1217 199
196 3300046519 Ga0495632_0003020 Ga0495632_0003020_964_1575 199
197 3300046529 Ga0495652_0008843 Ga0495652_0008843_2316_2918 199
198 3300046529 Ga0495652_0028737 Ga0495652_0028737_3100_3702 199
199 3300046533 Ga0495640_0095019 Ga0495640_0095019_678_1280 199
200 3300046536 Ga0495587_0004788 Ga0495587_0004788_5944_6546 199
201 3300046543 Ga0495645_0041845 Ga0495645_0041845_423_1025 199
202 3300046558 Ga0495633_0000003 Ga0495633_0000003_308223_308834 199
203 3300046558 Ga0495633_0000650 Ga0495633_0000650_14400_15011 199
204 3300046559 Ga0495667_0006315 Ga0495667_0006315_2345_2947 199
205 3300046616 Ga0495668_0000301 Ga0495668_0000301_37304_37924 199
206 3300046660 Ga0495625_0000825 Ga0495625_0000825_10387_10998 199
207 3300046663 Ga0495635_0033330 Ga0495635_0033330_1119_1721 199
208 3300046675 Ga0495657_0008732 Ga0495657_0008732_4816_5418 199
209 3300046678 Ga0495599_0003368 Ga0495599_0003368_6247_6849 199
210 3300046679 Ga0495623_0023234 Ga0495623_0023234_22_624 199
211 3300046680 Ga0495646_0015034 Ga0495646_0015034_1984_2586 199
212 3300046809 Ga0495600_0058087 Ga0495600_0058087_246_848 199
213 3300047317 Ga0495604_0012865 Ga0495604_0012865_3719_4321 199
214 3300047319 Ga0495674_0068509 Ga0495674_0068509_143_745 199
215 3300047322 Ga0495680_0027024 Ga0495680_0027024_1789_2391 199
216 3300047444 Ga0495675_0007877 Ga0495675_0007877_2285_2887 199
217 3300047472 Ga0495686_0098946 Ga0495686_0098946_748_1350 199
218 3300048088 Ga0495602_0012057 Ga0495602_0012057_2344_2946 199
219 3300048903 Ga0496100_0632727 Ga0496100_0632727_96_716 199
220 3300048905 Ga0496102_0174433 Ga0496102_0174433_157_768 199
221 3300048907 Ga0496104_0122390 Ga0496104_0122390_485_1105 199
222 3300048907 Ga0496104_0257222 Ga0496104_0257222_384_995 199
223 3300048909 Ga0496106_0331177 Ga0496106_0331177_271_891 199
224 3300048910 Ga0496107_0255631 Ga0496107_0255631_452_1072 199
225 3300048913 Ga0496110_0450773 Ga0496110_0450773_342_962 199
226 3300048914 Ga0496111_0248512 Ga0496111_0248512_494_1114 199
227 3300048915 Ga0496112_0093887 Ga0496112_0093887_2127_2747 199
228 3300048916 Ga0496113_0580009 Ga0496113_0580009_23_643 199
229 3300048919 Ga0496116_0000006 Ga0496116_0000006_200554_201165 199
230 3300048920 Ga0496117_0000027 Ga0496117_0000027_154016_154627 199
231 3300048921 Ga0496118_0000163 Ga0496118_0000163_94031_94642 199
232 3300048922 Ga0496119_0000006 Ga0496119_0000006_435467_436078 199
233 3300048923 Ga0496120_0042679 Ga0496120_0042679_718_1329 199
234 3300048924 Ga0496121_0286125 Ga0496121_0286125_387_998 199
235 3300048925 Ga0496122_0000258 Ga0496122_0000258_100789_101400 199
236 3300048925 Ga0496122_0001248 Ga0496122_0001248_1423_2034 199
237 3300048925 Ga0496122_0024862 Ga0496122_0024862_2710_3318 199
238 3300048926 Ga0496123_0000853 Ga0496123_0000853_25341_25952 199
239 3300048926 Ga0496123_0028668 Ga0496123_0028668_169_780 199
240 3300048927 Ga0496124_0005379 Ga0496124_0005379_13559_14170 199
241 3300048928 Ga0496125_0002010 Ga0496125_0002010_6113_6724 199
242 3300048928 Ga0496125_0012378 Ga0496125_0012378_1736_2347 199
243 3300048929 Ga0496126_0011180 Ga0496126_0011180_274_885 199
244 3300049569 Ga0501032_0158607 Ga0501032_0158607_138_761 199
245 3300049570 Ga0501033_0153479 Ga0501033_0153479_204_827 199
246 3300049572 Ga0501036_0014631 Ga0501036_0014631_3106_3729 199
247 3300049573 Ga0501037_0041371 Ga0501037_0041371_2040_2663 199
248 3300049574 Ga0501038_0009129 Ga0501038_0009129_2435_3058 199
249 3300049575 Ga0501039_0002180 Ga0501039_0002180_2460_3083 199
250 3300049576 Ga0501040_0005618 Ga0501040_0005618_5853_6476 199
251 3300049577 Ga0501041_0001142 Ga0501041_0001142_2812_3435 199
252 3300049580 Ga0501046_0002261 Ga0501046_0002261_8405_9028 199
253 3300049582 Ga0501048_0002972 Ga0501048_0002972_11111_11734 199
254 3300049587 Ga0501071_0000702 Ga0501071_0000702_8167_8790 199
255 3300049588 Ga0501072_0000102 Ga0501072_0000102_408_1031 199
256 3300049591 Ga0501075_0002569 Ga0501075_0002569_9109_9732 199
257 3300049592 Ga0501076_0001503 Ga0501076_0001503_5853_6476 199
258 3300049593 Ga0501077_0004659 Ga0501077_0004659_1754_2377 199
259 3300049659 Ga0501214_004803 Ga0501214_004803_228_830 199
260 3300049669 Ga0501235_030173 Ga0501235_030173_97_699 199
261 3300049704 Ga0501221_044556 Ga0501221_044556_102_704 199
262 3300049705 Ga0501225_0002148 Ga0501225_0002148_1656_2267 199
263 3300049741 Ga0501079_0002871 Ga0501079_0002871_2814_3437 199
264 3300049742 Ga0501080_0130464 Ga0501080_0130464_64_687 199
265 3300049743 Ga0501081_0000102 Ga0501081_0000102_9130_9753 199
266 3300049823 Ga0501044_0976163 Ga0501044_0976163_70_693 199
267 3300049824 Ga0501045_0001274 Ga0501045_0001274_11384_12007 199
268 3300050513 nmdc:mga0rr50_266802_c1 nmdc:mga0rr50_266802_c1_502_1122 199
269 3300053085 Ga0495619_0004198 Ga0495619_0004198_2345_2947 199
270 3300053092 Ga0500583_0000013 Ga0500583_0000013_113104_113715 199
271 3300053146 Ga0500588_0117472 Ga0500588_0117472_117_728 199
272 3300054114 Ga0501084_0001099 Ga0501084_0001099_7825_8448 199
273 3300060353 Ga0501082_0003317 Ga0501082_0003317_10816_11439 199
274 3300061734 Ga0530510_0000892 Ga0530510_0000892_9909_10532 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

19

197

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rzl-assembly2.cif.gz_D duplex interrogation by a direct dna repair protein in the search of damage 0.9462 16 199
3btz-assembly1.cif.gz_A crystal structure of human abh2 cross-linked to dsdna 0.9459 8 199
3buc-assembly1.cif.gz_A x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg 0.9445 10 199
3rzg-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.9434 9 199
3s5a-assembly1.cif.gz_A abh2 cross-linked to undamaged dsdna-2 with cofactors 0.9423 9 199
ID Description Score Start End Superfamily
af_Q9SIE0_90_314_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9474 14 198 2.60.120.590
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.93 9 199 2.60.120.590
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9069 9 199 2.60.120.590
2iuwA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8996 16 199 2.60.120.590
af_A4IB22_54_194_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8807 88 199 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A2T4DAR1-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 1.003 101 199 GO:0006307
GO:0008198
GO:0035516
GO:0051747
AF-S7X5J3-F1-model_v4 DNA repair system specific for alkylated DNA 0.9997 81 199 GO:0006307
GO:0051213
AF-A0A3D9L1F1-F1-model_v4 2-oxoglutarate-Fe(II)-dependent oxygenase superfamily protein 0.9973 112 199 GO:0006307
GO:0008198
GO:0035516
GO:0051747
AF-A0A644SQM5-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9956 8 198 GO:0006307
GO:0051213
AF-A0A4Q1C2N9-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.994 8 197 GO:0006307
GO:0051213

Feature Viewer

pLDDT pTM Quality
90.06 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map