F380031

General Info

Members Datasets Scaffolds Average Seq Length
274 171 548 175

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0010184|Ga0501044_0010184_3352_3960
Length 202
Sequence VLTRDPGAPHVRGDLGARLRDVYTARLVHTSDLDHETRDGARRMVIEAFGGDFTDADWEHALGGMHALICHHGARIAHGAVVQRRLLYRDTALRCGYLEGVAVREDWRGQGLATAVMDALEQVLRGAYQIGALSASEEGRPMYTSRGWLAWQGPTSVLQPAGLARTPDDDRSLFVLPIDLPNGVELDTTAELTCDWRDGDVW

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
34 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
47 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
56 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
57 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
61 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
64 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
73 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
74 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
75 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
79 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
157 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
158 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
159 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
160 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
163 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
166 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
167 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
168 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
169 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
170 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
171 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 0
Isolates 2.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.17
Nodule 0
Rhizoplane 4.38
Rhizosphere 70.07
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0010184 3300049823 Bacteria 10212
2 Ga0055540_1001558 3300003792 Bacteria 13420
3 Ga0070682_100124607 3300005337 Bacteria 1735
4 Ga0070673_100755155 3300005364 Bacteria 896
5 Ga0070709_10220114 3300005434 Bacteria 1353
6 Ga0070714_100050630 3300005435 Bacteria 3539
7 Ga0070714_100830820 3300005435 Bacteria 895
8 Ga0070710_10020877 3300005437 Bacteria 3404
9 Ga0070711_100126131 3300005439 Bacteria 1900
10 Ga0070711_100210965 3300005439 Bacteria 1504
11 Ga0070708_100155539 3300005445 Bacteria 2128
12 Ga0070706_100025553 3300005467 Bacteria 5436
13 Ga0070706_100281583 3300005467 Bacteria 1552
14 Ga0070707_100434774 3300005468 Bacteria 1273
15 Ga0070698_100014573 3300005471 Bacteria 8302
16 Ga0070699_100014090 3300005518 Bacteria 6879
17 Ga0070696_101103585 3300005546 Bacteria 667
18 Ga0070702_100786946 3300005615 Bacteria 734
19 Ga0081538_10003291 3300005981 Bacteria 15328
20 Ga0081539_10005595 3300005985 Bacteria 12672
21 Ga0070717_10118514 3300006028 Bacteria 2265
22 Ga0070717_10632784 3300006028 Bacteria 971
23 Ga0075365_10000793 3300006038 Bacteria 12938
24 Ga0075365_10030780 3300006038 Bacteria 3440
25 Ga0075365_10448042 3300006038 Bacteria 911
26 Ga0075368_10163584 3300006042 Bacteria 933
27 Ga0075363_100000890 3300006048 Bacteria 10519
28 Ga0075363_100007485 3300006048 Bacteria 5025
29 Ga0075364_10005669 3300006051 Bacteria 7277
30 Ga0075364_10079908 3300006051 Bacteria 2161
31 Ga0075364_10103164 3300006051 Bacteria 1899
32 Ga0075364_10324373 3300006051 Bacteria 1049
33 Ga0075362_10024296 3300006177 Bacteria 2570
34 Ga0075362_10027888 3300006177 Bacteria 2421
35 Ga0075367_10013505 3300006178 Bacteria 4393
36 Ga0075369_10003312 3300006186 Bacteria 5854
37 Ga0075369_10062107 3300006186 Bacteria 1631
38 Ga0075369_10122214 3300006186 Bacteria 1179
39 Ga0075369_10153650 3300006186 Bacteria 1053
40 Ga0075369_10209459 3300006186 Bacteria 901
41 Ga0075366_10192317 3300006195 Bacteria 1240
42 Ga0075370_10007027 3300006353 Bacteria 5709
43 Ga0075370_10044070 3300006353 Bacteria 2522
44 Ga0068871_100876447 3300006358 Bacteria 831
45 Ga0075435_100731213 3300007076 Bacteria 861
46 Ga0111539_10138895 3300009094 Bacteria 2846
47 Ga0114129_10370060 3300009147 Bacteria 1894
48 Ga0213875_10006039 3300021388 Bacteria 6413
49 Ga0207426_1076842 3300025302 Bacteria 916
50 Ga0209051_1001078 3300025303 Bacteria 25305
51 Ga0209051_1003789 3300025303 Bacteria 9688
52 Ga0209051_1020500 3300025303 Bacteria 2844
53 Ga0207692_10003086 3300025898 Bacteria 6470
54 Ga0207699_10108066 3300025906 Bacteria 1778
55 Ga0207684_10132257 3300025910 Bacteria 2141
56 Ga0207693_10154218 3300025915 Bacteria 1807
57 Ga0207663_10153207 3300025916 Bacteria 1619
58 Ga0207664_10097265 3300025929 Bacteria 2425
59 Ga0207664_10180025 3300025929 Bacteria 1814
60 Ga0207679_10839799 3300025945 Bacteria 838
61 Ga0207678_10087719 3300026067 Bacteria 2659
62 Ga0268265_10227691 3300028380 Bacteria 1636
63 Ga0307405_10575735 3300031731 Bacteria 915
64 Ga0307413_10009880 3300031824 Bacteria 4593
65 Ga0307413_10017312 3300031824 Bacteria 3750
66 Ga0307410_10013639 3300031852 Bacteria 4749
67 Ga0307410_10076988 3300031852 Bacteria 2330
68 Ga0307410_10323379 3300031852 Unclassified 1225
69 Ga0307410_10826926 3300031852 Bacteria 789
70 Ga0307406_10127495 3300031901 Bacteria 1781
71 Ga0307406_10430957 3300031901 Bacteria 1053
72 Ga0307406_10442160 3300031901 Bacteria 1041
73 Ga0307406_11280816 3300031901 Bacteria 639
74 Ga0307407_10046204 3300031903 Bacteria 2465
75 Ga0307407_10300477 3300031903 Bacteria 1119
76 Ga0307407_10832279 3300031903 Bacteria 704
77 Ga0307412_10233036 3300031911 Bacteria 1419
78 Ga0307409_100052392 3300031995 Bacteria 3128
79 Ga0307409_100281057 3300031995 Bacteria 1538
80 Ga0307409_100649531 3300031995 Bacteria 1049
81 Ga0307416_100343755 3300032002 Bacteria 1506
82 Ga0307416_100572621 3300032002 Bacteria 1205
83 Ga0307416_100844330 3300032002 Bacteria 1014
84 Ga0307414_10231676 3300032004 Bacteria 1523
85 Ga0307411_10041837 3300032005 Bacteria 2919
86 Ga0307411_10142270 3300032005 Bacteria 1770
87 Ga0307411_10375228 3300032005 Bacteria 1168
88 Ga0307411_10431094 3300032005 Bacteria 1098
89 Ga0307415_100070073 3300032126 Bacteria 2461
90 Ga0307415_100153481 3300032126 Bacteria 1775
91 Ga0373926_0008163 3300035083 Bacteria 3486
92 Ga0373944_0002366 3300035089 Bacteria 4803
93 Ga0373936_0044754 3300035113 Bacteria 1781
94 Ga0373945_0002765 3300035116 Bacteria 5510
95 Ga0373943_0004289 3300035170 Bacteria 6473
96 Ga0373943_0889163 3300035170 Bacteria 532
97 Ga0373946_0001298 3300035171 Bacteria 8645
98 Ga0373955_0534459 3300035172 Bacteria 717
99 Ga0373935_0034317 3300035692 Bacteria 3161
100 Ga0373935_0236109 3300035692 Bacteria 1275
101 Ga0373935_0543159 3300035692 Bacteria 847
102 Ga0373927_0035590 3300035695 Bacteria 3237
103 Ga0373933_0081892 3300035724 Bacteria 1980
104 Ga0373947_0010289 3300035725 Bacteria 5367
105 Ga0373937_0374937 3300036401 Bacteria 1349
106 Ga0316584_0057833 3300036712 Bacteria 2903
107 Ga0373925_0007939 3300037068 Bacteria 7727
108 Ga0395899_0260200 3300037312 Bacteria 1187
109 Ga0395900_0128396 3300037418 Bacteria 2599
110 Ga0436364_0052947 3300037853 Bacteria 7296
111 Ga0436364_0995512 3300037853 Bacteria 3889
112 Ga0395901_0009173 3300038443 Bacteria 10022
113 Ga0395901_0232752 3300038443 Bacteria 1923
114 Ga0436361_0871523 3300039447 Bacteria 1367
115 Ga0439461_0010562 3300041410 Bacteria 1697
116 Ga0439466_0003449 3300041411 Bacteria 6133
117 Ga0439465_0039950 3300041413 Bacteria 1515
118 Ga0439465_0107496 3300041413 Bacteria 968
119 Ga0439431_0003137 3300041997 Bacteria 3635
120 Ga0439445_0002798 3300042004 Bacteria 3895
121 Ga0439450_021396 3300042008 Bacteria 1388
122 Ga0439434_0007396 3300042435 Bacteria 3219
123 Ga0466969_0044928 3300044656 Bacteria 2194
124 Ga0466969_0118053 3300044656 Bacteria 1237
125 Ga0466972_0008530 3300044658 Bacteria 5144
126 Ga0466972_0040510 3300044658 Bacteria 2269
127 Ga0466972_0177630 3300044658 Bacteria 999
128 Ga0466965_0086689 3300044683 Bacteria 1588
129 Ga0466965_0150499 3300044683 Bacteria 1216
130 Ga0466966_0009832 3300044684 Bacteria 6339
131 Ga0466966_0020132 3300044684 Bacteria 4391
132 Ga0466966_0230087 3300044684 Bacteria 1118
133 Ga0466961_0018401 3300044693 Bacteria 4493
134 Ga0466961_0022349 3300044693 Bacteria 4068
135 Ga0466961_0029853 3300044693 Bacteria 3503
136 Ga0466963_0536986 3300044694 Bacteria 826
137 Ga0466964_0054464 3300044706 Bacteria 1649
138 Ga0466964_0089701 3300044706 Bacteria 1336
139 Ga0466964_0122978 3300044706 Bacteria 1172
140 Ga0466971_0008353 3300044719 Bacteria 4517
141 Ga0466968_0008522 3300044735 Bacteria 3927
142 Ga0466968_0008551 3300044735 Bacteria 3921
143 Ga0466968_0022933 3300044735 Bacteria 2540
144 Ga0466968_0066994 3300044735 Bacteria 1556
145 Ga0466970_0006021 3300044765 Bacteria 6048
146 Ga0466970_0009822 3300044765 Bacteria 4846
147 Ga0466970_0033213 3300044765 Bacteria 2728
148 Ga0466970_0035001 3300044765 Bacteria 2660
149 Ga0466957_0046234 3300044842 Bacteria 2642
150 Ga0466957_0047082 3300044842 Bacteria 2619
151 Ga0466957_0058616 3300044842 Bacteria 2359
152 Ga0466957_0123265 3300044842 Bacteria 1654
153 Ga0466957_0159149 3300044842 Bacteria 1466
154 Ga0466960_0068399 3300044901 Bacteria 1762
155 Ga0466959_0021756 3300045049 Bacteria 4733
156 Ga0466959_0046513 3300045049 Bacteria 3192
157 Ga0466959_0122721 3300045049 Bacteria 1845
158 Ga0466958_0013559 3300045836 Bacteria 4642
159 Ga0466958_0017498 3300045836 Bacteria 4145
160 Ga0466967_0198432 3300045976 Bacteria 1899
161 Ga0466967_0209690 3300045976 Bacteria 1847
162 Ga0466967_0807816 3300045976 Bacteria 931
163 Ga0495592_0592429 3300046454 Bacteria 677
164 Ga0495629_0177442 3300046459 Bacteria 1477
165 Ga0495638_0013403 3300046460 Bacteria 5581
166 Ga0495641_0149800 3300046461 Bacteria 1042
167 Ga0495651_0101559 3300046462 Bacteria 2140
168 Ga0495651_0130003 3300046462 Bacteria 1839
169 Ga0495653_0016161 3300046463 Bacteria 6080
170 Ga0495653_0168860 3300046463 Bacteria 1512
171 Ga0495582_0182277 3300046473 Bacteria 1196
172 Ga0495664_0035177 3300046477 Bacteria 2949
173 Ga0495664_0316268 3300046477 Bacteria 942
174 Ga0495608_0024726 3300046511 Bacteria 4104
175 Ga0495608_0369625 3300046511 Bacteria 880
176 Ga0495618_0040570 3300046514 Bacteria 2930
177 Ga0495628_0357151 3300046516 Bacteria 1073
178 Ga0495630_0032531 3300046517 Unclassified 3887
179 Ga0495630_0775577 3300046517 Bacteria 732
180 Ga0495640_0397891 3300046533 Bacteria 846
181 Ga0495640_0499034 3300046533 Bacteria 741
182 Ga0495645_0142892 3300046543 Bacteria 1668
183 Ga0495667_0015769 3300046559 Bacteria 5109
184 Ga0495667_0221822 3300046559 Bacteria 1206
185 Ga0495634_0021929 3300046642 Bacteria 4506
186 Ga0495635_0010427 3300046663 Bacteria 6500
187 Ga0495657_0012437 3300046675 Bacteria 6326
188 Ga0495657_0096034 3300046675 Bacteria 1894
189 Ga0495599_0095349 3300046678 Bacteria 1856
190 Ga0495599_0363699 3300046678 Bacteria 866
191 Ga0495624_0072823 3300046690 Bacteria 2137
192 Ga0495600_0380713 3300046809 Bacteria 880
193 Ga0495581_0109185 3300047315 Bacteria 1608
194 Ga0495674_0013551 3300047319 Bacteria 7662
195 Ga0495676_0106231 3300047321 Bacteria 2068
196 Ga0495680_0007964 3300047322 Bacteria 9662
197 Ga0495680_0018735 3300047322 Bacteria 5866
198 Ga0495684_0001486 3300047471 Bacteria 18770
199 Ga0495684_0013534 3300047471 Bacteria 6278
200 Ga0495686_0017597 3300047472 Bacteria 4809
201 Ga0495602_0285077 3300048088 Bacteria 1215
202 Ga0496100_0500751 3300048903 Bacteria 936
203 Ga0496101_0495477 3300048904 Bacteria 965
204 Ga0496101_0911579 3300048904 Bacteria 692
205 Ga0496101_0979874 3300048904 Bacteria 665
206 Ga0496108_1313194 3300048911 Bacteria 608
207 Ga0496110_0331342 3300048913 Bacteria 1387
208 Ga0496112_0072274 3300048915 Bacteria 3410
209 Ga0496112_0220339 3300048915 Bacteria 1854
210 Ga0496113_0076776 3300048916 Bacteria 2553
211 Ga0496113_0364994 3300048916 Bacteria 1159
212 Ga0496114_1159535 3300048917 Bacteria 658
213 Ga0496115_0874709 3300048918 Bacteria 694
214 Ga0496121_0140230 3300048924 Bacteria 1795
215 Ga0496126_0078931 3300048929 Bacteria 2915
216 Ga0496126_0424831 3300048929 Bacteria 1074
217 Ga0501032_0018304 3300049569 Bacteria 4908
218 Ga0501032_0603048 3300049569 Bacteria 698
219 Ga0501033_0014259 3300049570 Bacteria 6040
220 Ga0501034_0022970 3300049571 Bacteria 6355
221 Ga0501034_0207056 3300049571 Bacteria 1918
222 Ga0501036_0012220 3300049572 Bacteria 7113
223 Ga0501037_0003444 3300049573 Bacteria 11493
224 Ga0501037_0388559 3300049573 Bacteria 958
225 Ga0501038_0068901 3300049574 Bacteria 3006
226 Ga0501039_0005370 3300049575 Bacteria 9692
227 Ga0501043_0000951 3300049579 Bacteria 25684
228 Ga0501047_0078798 3300049581 Bacteria 3168
229 Ga0501070_0004659 3300049586 Bacteria 11744
230 Ga0501073_0017493 3300049589 Bacteria 5193
231 Ga0501035_0001827 3300049822 Bacteria 21431
232 Ga0501044_0001203 3300049823 Bacteria 30701
233 Ga0501045_1050934 3300049824 Bacteria 596
234 nmdc:mga03n38_180276_c1 3300050490 Bacteria 1082
235 nmdc:mga03n38_27725_c1 3300050490 Bacteria 2353
236 nmdc:mga03n38_9173_c1 3300050490 Bacteria 3585
237 nmdc:mga00v17_160436_c1 3300050491 Bacteria 1447
238 nmdc:mga00v17_21468_c1 3300050491 Bacteria 3712
239 nmdc:mga00v17_41158_c1 3300050491 Bacteria 2774
240 nmdc:mga00v17_54624_c1 3300050491 Bacteria 2437
241 nmdc:mga00v17_584146_c1 3300050491 Bacteria 721
242 nmdc:mga0yw44_121045_c1 3300050492 Bacteria 1686
243 nmdc:mga0yw44_142208_c1 3300050492 Bacteria 1560
244 nmdc:mga0yw44_389559_c1 3300050492 Bacteria 941
245 nmdc:mga0yw44_448826_c1 3300050492 Bacteria 874
246 nmdc:mga0yw44_774925_c1 3300050492 Bacteria 651
247 nmdc:mga0k408_37967_c1 3300050493 Bacteria 2765
248 nmdc:mga06z11_48435_c1 3300050494 Bacteria 2163
249 nmdc:mga07m45_11115_c1 3300050496 Bacteria 3148
250 nmdc:mga07m45_215685_c1 3300050496 Bacteria 1116
251 nmdc:mga07m45_543_c1 3300050496 Bacteria 16013
252 nmdc:mga05p37_335619_c1 3300050507 Bacteria 1784
253 nmdc:mga0sz30_116768_c1 3300050516 Bacteria 1171
254 nmdc:mga0sz30_123164_c1 3300050516 Bacteria 1140
255 nmdc:mga0sz30_146905_c1 3300050516 Bacteria 1042
256 Ga0495612_0070978 3300053078 Bacteria 1452
257 Ga0500635_0010673 3300053080 Bacteria 2589
258 Ga0500643_002173 3300053087 Bacteria 10388
259 Ga0500643_051708 3300053087 Bacteria 1173
260 Ga0500650_0121947 3300053098 Bacteria 1215
261 Ga0500658_0028959 3300053134 Bacteria 2152
262 Ga0500559_0027915 3300053136 Bacteria 2410
263 Ga0500568_0091724 3300053139 Bacteria 1145
264 Ga0500588_0031240 3300053146 Bacteria 1535
265 Ga0500627_0008336 3300053158 Bacteria 3675
266 Ga0500645_000023 3300053730 Bacteria 128995
267 Ga0500645_062290 3300053730 Bacteria 1077
268 Ga0466962_0011461 3300061719 Bacteria 4268
269 2644638669 2643221715 Bacteria 6671032
270 2738702209 2738541274 Bacteria 6909446
271 2739331466 2738543028 Bacteria 6917070
272 2902802603 2902799365 Bacteria 5419524
273 2902811440 2902810491 Bacteria 6794147
274 2929212784 2929212328 Bacteria 7708288
275 Ga0501044_0010184
276 Ga0055540_1001558
277 Ga0070682_100124607
278 Ga0070673_100755155
279 Ga0070709_10220114
280 Ga0070714_100050630
281 Ga0070714_100830820
282 Ga0070710_10020877
283 Ga0070711_100126131
284 Ga0070711_100210965
285 Ga0070708_100155539
286 Ga0070706_100025553
287 Ga0070706_100281583
288 Ga0070707_100434774
289 Ga0070698_100014573
290 Ga0070699_100014090
291 Ga0070696_101103585
292 Ga0070702_100786946
293 Ga0081538_10003291
294 Ga0081539_10005595
295 Ga0070717_10118514
296 Ga0070717_10632784
297 Ga0075365_10000793
298 Ga0075365_10030780
299 Ga0075365_10448042
300 Ga0075368_10163584
301 Ga0075363_100000890
302 Ga0075363_100007485
303 Ga0075364_10005669
304 Ga0075364_10079908
305 Ga0075364_10103164
306 Ga0075364_10324373
307 Ga0075362_10024296
308 Ga0075362_10027888
309 Ga0075367_10013505
310 Ga0075369_10003312
311 Ga0075369_10062107
312 Ga0075369_10122214
313 Ga0075369_10153650
314 Ga0075369_10209459
315 Ga0075366_10192317
316 Ga0075370_10007027
317 Ga0075370_10044070
318 Ga0068871_100876447
319 Ga0075435_100731213
320 Ga0111539_10138895
321 Ga0114129_10370060
322 Ga0213875_10006039
323 Ga0207426_1076842
324 Ga0209051_1001078
325 Ga0209051_1003789
326 Ga0209051_1020500
327 Ga0207692_10003086
328 Ga0207699_10108066
329 Ga0207684_10132257
330 Ga0207693_10154218
331 Ga0207663_10153207
332 Ga0207664_10097265
333 Ga0207664_10180025
334 Ga0207679_10839799
335 Ga0207678_10087719
336 Ga0268265_10227691
337 Ga0307405_10575735
338 Ga0307413_10009880
339 Ga0307413_10017312
340 Ga0307410_10013639
341 Ga0307410_10076988
342 Ga0307410_10323379
343 Ga0307410_10826926
344 Ga0307406_10127495
345 Ga0307406_10430957
346 Ga0307406_10442160
347 Ga0307406_11280816
348 Ga0307407_10046204
349 Ga0307407_10300477
350 Ga0307407_10832279
351 Ga0307412_10233036
352 Ga0307409_100052392
353 Ga0307409_100281057
354 Ga0307409_100649531
355 Ga0307416_100343755
356 Ga0307416_100572621
357 Ga0307416_100844330
358 Ga0307414_10231676
359 Ga0307411_10041837
360 Ga0307411_10142270
361 Ga0307411_10375228
362 Ga0307411_10431094
363 Ga0307415_100070073
364 Ga0307415_100153481
365 Ga0373926_0008163
366 Ga0373944_0002366
367 Ga0373936_0044754
368 Ga0373945_0002765
369 Ga0373943_0004289
370 Ga0373943_0889163
371 Ga0373946_0001298
372 Ga0373955_0534459
373 Ga0373935_0034317
374 Ga0373935_0236109
375 Ga0373935_0543159
376 Ga0373927_0035590
377 Ga0373933_0081892
378 Ga0373947_0010289
379 Ga0373937_0374937
380 Ga0316584_0057833
381 Ga0373925_0007939
382 Ga0395899_0260200
383 Ga0395900_0128396
384 Ga0436364_0052947
385 Ga0436364_0995512
386 Ga0395901_0009173
387 Ga0395901_0232752
388 Ga0436361_0871523
389 Ga0439461_0010562
390 Ga0439466_0003449
391 Ga0439465_0039950
392 Ga0439465_0107496
393 Ga0439431_0003137
394 Ga0439445_0002798
395 Ga0439450_021396
396 Ga0439434_0007396
397 Ga0466969_0044928
398 Ga0466969_0118053
399 Ga0466972_0008530
400 Ga0466972_0040510
401 Ga0466972_0177630
402 Ga0466965_0086689
403 Ga0466965_0150499
404 Ga0466966_0009832
405 Ga0466966_0020132
406 Ga0466966_0230087
407 Ga0466961_0018401
408 Ga0466961_0022349
409 Ga0466961_0029853
410 Ga0466963_0536986
411 Ga0466964_0054464
412 Ga0466964_0089701
413 Ga0466964_0122978
414 Ga0466971_0008353
415 Ga0466968_0008522
416 Ga0466968_0008551
417 Ga0466968_0022933
418 Ga0466968_0066994
419 Ga0466970_0006021
420 Ga0466970_0009822
421 Ga0466970_0033213
422 Ga0466970_0035001
423 Ga0466957_0046234
424 Ga0466957_0047082
425 Ga0466957_0058616
426 Ga0466957_0123265
427 Ga0466957_0159149
428 Ga0466960_0068399
429 Ga0466959_0021756
430 Ga0466959_0046513
431 Ga0466959_0122721
432 Ga0466958_0013559
433 Ga0466958_0017498
434 Ga0466967_0198432
435 Ga0466967_0209690
436 Ga0466967_0807816
437 Ga0495592_0592429
438 Ga0495629_0177442
439 Ga0495638_0013403
440 Ga0495641_0149800
441 Ga0495651_0101559
442 Ga0495651_0130003
443 Ga0495653_0016161
444 Ga0495653_0168860
445 Ga0495582_0182277
446 Ga0495664_0035177
447 Ga0495664_0316268
448 Ga0495608_0024726
449 Ga0495608_0369625
450 Ga0495618_0040570
451 Ga0495628_0357151
452 Ga0495630_0032531
453 Ga0495630_0775577
454 Ga0495640_0397891
455 Ga0495640_0499034
456 Ga0495645_0142892
457 Ga0495667_0015769
458 Ga0495667_0221822
459 Ga0495634_0021929
460 Ga0495635_0010427
461 Ga0495657_0012437
462 Ga0495657_0096034
463 Ga0495599_0095349
464 Ga0495599_0363699
465 Ga0495624_0072823
466 Ga0495600_0380713
467 Ga0495581_0109185
468 Ga0495674_0013551
469 Ga0495676_0106231
470 Ga0495680_0007964
471 Ga0495680_0018735
472 Ga0495684_0001486
473 Ga0495684_0013534
474 Ga0495686_0017597
475 Ga0495602_0285077
476 Ga0496100_0500751
477 Ga0496101_0495477
478 Ga0496101_0911579
479 Ga0496101_0979874
480 Ga0496108_1313194
481 Ga0496110_0331342
482 Ga0496112_0072274
483 Ga0496112_0220339
484 Ga0496113_0076776
485 Ga0496113_0364994
486 Ga0496114_1159535
487 Ga0496115_0874709
488 Ga0496121_0140230
489 Ga0496126_0078931
490 Ga0496126_0424831
491 Ga0501032_0018304
492 Ga0501032_0603048
493 Ga0501033_0014259
494 Ga0501034_0022970
495 Ga0501034_0207056
496 Ga0501036_0012220
497 Ga0501037_0003444
498 Ga0501037_0388559
499 Ga0501038_0068901
500 Ga0501039_0005370
501 Ga0501043_0000951
502 Ga0501047_0078798
503 Ga0501070_0004659
504 Ga0501073_0017493
505 Ga0501035_0001827
506 Ga0501044_0001203
507 Ga0501045_1050934
508 nmdc:mga03n38_180276_c1
509 nmdc:mga03n38_27725_c1
510 nmdc:mga03n38_9173_c1
511 nmdc:mga00v17_160436_c1
512 nmdc:mga00v17_21468_c1
513 nmdc:mga00v17_41158_c1
514 nmdc:mga00v17_54624_c1
515 nmdc:mga00v17_584146_c1
516 nmdc:mga0yw44_121045_c1
517 nmdc:mga0yw44_142208_c1
518 nmdc:mga0yw44_389559_c1
519 nmdc:mga0yw44_448826_c1
520 nmdc:mga0yw44_774925_c1
521 nmdc:mga0k408_37967_c1
522 nmdc:mga06z11_48435_c1
523 nmdc:mga07m45_11115_c1
524 nmdc:mga07m45_215685_c1
525 nmdc:mga07m45_543_c1
526 nmdc:mga05p37_335619_c1
527 nmdc:mga0sz30_116768_c1
528 nmdc:mga0sz30_123164_c1
529 nmdc:mga0sz30_146905_c1
530 Ga0495612_0070978
531 Ga0500635_0010673
532 Ga0500643_002173
533 Ga0500643_051708
534 Ga0500650_0121947
535 Ga0500658_0028959
536 Ga0500559_0027915
537 Ga0500568_0091724
538 Ga0500588_0031240
539 Ga0500627_0008336
540 Ga0500645_000023
541 Ga0500645_062290
542 Ga0466962_0011461
543 2644638669
544 2738702209
545 2739331466
546 2902802603
547 2902811440
548 2929212784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

29

150

0.86

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

33

158

0.81

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

32

148

0.75

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

63

148

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m4d-assembly1.cif.gz_B aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and tobramycin 0.9863 3 181
1m4d-assembly1.cif.gz_B aminoglycoside 2'-n-acetyltransferase from mycobacterium tuberculosis-complex with coenzyme a and tobramycin 0.9807 3 181
7csj-assembly1.cif.gz_A aminoglycoside 2'-n-acetyltransferase from mycolicibacterium smegmatis-complex with coenzyme a and gentamicin 0.9757 2 181
7cs0-assembly1.cif.gz_B aminoglycoside 2'-n-acetyltransferase from mycolicibacterium smegmatis-complex with coenzyme a and paromomycin 0.9654 4 181
7cs1-assembly1.cif.gz_B aminoglycoside 2'-n-acetyltransferase from mycolicibacterium smegmatis-complex with coenzyme a and neomycin 0.9652 2 181
ID Description Score Start End Superfamily
1m44A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9838 2 181 3.40.630.30
1m44A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9783 2 181 3.40.630.30
af_E0CYC6_80_216_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8237 49 132 3.40.630.30
af_Q54LP2_1_118_1.20.1250.40 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;RNA Polymerase II, Rpb4 subunit 0.8089 11 46 1.20.1250.40
af_E7EZI9_69_205_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8061 49 132 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7I7QMF1-F1-model_v4 Aminoglycoside 2'-N-acetyltransferase 0.9927 2 181 GO:0016747
AF-W9BMH6-F1-model_v4 Aminoglycoside 2'-N-acetyltransferase Aac 0.9919 1 181 GO:0016747
AF-A0A7I7RZI7-F1-model_v4 Aminoglycoside 2'-N-acetyltransferase 0.9916 2 181 GO:0016747
AF-A0A1E3T104-F1-model_v4 Aminoglycoside N-acetyltransferase AAC(2')-Ic 0.9905 1 181 GO:0016747
AF-A0A7J9Y0E7-F1-model_v4 GNAT family N-acetyltransferase 0.9902 21 181 GO:0016747

Map