F379863

General Info

Members Datasets Scaffolds Average Seq Length
274 142 548 294

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0011964|Ga0316574_0011964_1770_2642
Length 290
Sequence MKGIILAGGSGTRLYPLTCAISKQLMPVYDKPLIYYPLSTLMLAGIRDILLITTPQDLPLFRKLLSDGSQLGLNIQFAEQAVPGGLAEAFLIGREFMAGEPVCLILGDNIFYGHGLASILQKMVASPRGGATVFAYRVRDPERYGVVEFSADGQVVNIEEKPQQPKSRYAVTGLYFYDRQVADIAAGLSRSARGELEITDLNNVYLAQQALRVELLGRGNAWLDTGTHESLLQAATFIEAIEQRQGLKIACIEEIAFRMGYISAAQLEELALPMRNNNYGAYLLELLKER

Samples

Sample ID Description Type Environment
1 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
80 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
81 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
84 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
85 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
86 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 0.73
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316574_0011964 3300035398 Bacteria 4949
2 Ga0070658_10109456 3300005327 Bacteria 2288
3 Ga0068869_100081439 3300005334 Bacteria 2417
4 Ga0070668_100014732 3300005347 Bacteria 5843
5 Ga0070671_100020113 3300005355 Bacteria 5440
6 Ga0070667_100092828 3300005367 Bacteria 2598
7 Ga0070700_100115788 3300005441 Bacteria 1789
8 Ga0070694_100104958 3300005444 Bacteria 2005
9 Ga0070694_100235638 3300005444 Bacteria 1379
10 Ga0070708_100124891 3300005445 Bacteria 2377
11 Ga0070708_100416285 3300005445 Bacteria 1267
12 Ga0070681_10050335 3300005458 Bacteria 4157
13 Ga0070685_10114089 3300005466 Bacteria 1669
14 Ga0070706_100013416 3300005467 Bacteria 7575
15 Ga0070707_100132297 3300005468 Bacteria 2426
16 Ga0070707_100168626 3300005468 Bacteria 2133
17 Ga0070698_100294002 3300005471 Bacteria 1555
18 Ga0070698_100329730 3300005471 Bacteria 1457
19 Ga0070699_100087724 3300005518 Bacteria 2716
20 Ga0070699_100136209 3300005518 Bacteria 2166
21 Ga0070699_100269148 3300005518 Bacteria 1524
22 Ga0070697_100011661 3300005536 Bacteria 6870
23 Ga0070697_100242712 3300005536 Bacteria 1539
24 Ga0070672_100037055 3300005543 Bacteria 3719
25 Ga0070704_100012624 3300005549 Bacteria 5224
26 Ga0070704_100013095 3300005549 Bacteria 5137
27 Ga0070704_100025551 3300005549 Bacteria 3890
28 Ga0068855_100297952 3300005563 Bacteria 1786
29 Ga0070664_100329883 3300005564 Bacteria 1384
30 Ga0068856_100196271 3300005614 Bacteria 2032
31 Ga0068859_100075864 3300005617 Bacteria 3403
32 Ga0068859_100089752 3300005617 Bacteria 3124
33 Ga0068861_100021945 3300005719 Bacteria 4594
34 Ga0068861_100046544 3300005719 Bacteria 3270
35 Ga0068861_100089808 3300005719 Bacteria 2422
36 Ga0068870_10172964 3300005840 Bacteria 1290
37 Ga0068863_100019838 3300005841 Bacteria 6430
38 Ga0068858_100007105 3300005842 Bacteria 10867
39 Ga0068858_100092151 3300005842 Bacteria 2820
40 Ga0068860_100455667 3300005843 Bacteria 1272
41 Ga0068862_100017449 3300005844 Bacteria 5978
42 Ga0068862_100495450 3300005844 Bacteria 1159
43 Ga0075432_10015928 3300006058 Bacteria 2567
44 Ga0075428_100007893 3300006844 Bacteria 11799
45 Ga0075428_100071302 3300006844 Bacteria 3797
46 Ga0075428_100090338 3300006844 Bacteria 3341
47 Ga0075428_100156952 3300006844 Bacteria 2471
48 Ga0075430_100000380 3300006846 Bacteria 32652
49 Ga0075430_100002531 3300006846 Bacteria 15234
50 Ga0075430_100025656 3300006846 Bacteria 5015
51 Ga0075430_100028973 3300006846 Bacteria 4700
52 Ga0075431_100000016 3300006847 Bacteria 85421
53 Ga0075431_100000127 3300006847 Bacteria 50561
54 Ga0075431_100000691 3300006847 Bacteria 29037
55 Ga0075431_100000906 3300006847 Bacteria 26122
56 Ga0075431_100032272 3300006847 Bacteria 5396
57 Ga0075431_100141313 3300006847 Bacteria 2481
58 Ga0075433_10076554 3300006852 Bacteria 2946
59 Ga0075434_100010470 3300006871 Bacteria 8695
60 Ga0075434_100187480 3300006871 Bacteria 2089
61 Ga0075429_100011292 3300006880 Bacteria 7733
62 Ga0075429_100031428 3300006880 Bacteria 4614
63 Ga0075429_100065868 3300006880 Bacteria 3154
64 Ga0075429_100136781 3300006880 Bacteria 2144
65 Ga0097620_100075862 3300006931 Bacteria 3403
66 Ga0097620_100089752 3300006931 Bacteria 3124
67 Ga0075435_100180962 3300007076 Bacteria 1781
68 Ga0099794_10016366 3300007265 Bacteria 3286
69 Ga0099794_10131485 3300007265 Bacteria 1264
70 Ga0105240_10021056 3300009093 Bacteria 8679
71 Ga0111539_10021719 3300009094 Bacteria 7892
72 Ga0111539_10022681 3300009094 Bacteria 7711
73 Ga0105247_10020160 3300009101 Bacteria 4009
74 Ga0114129_10000093 3300009147 Bacteria 85690
75 Ga0114129_10009697 3300009147 Bacteria 13741
76 Ga0114129_10011506 3300009147 Bacteria 12599
77 Ga0114129_10041341 3300009147 Bacteria 6497
78 Ga0114129_10049117 3300009147 Bacteria 5930
79 Ga0114129_10064130 3300009147 Bacteria 5127
80 Ga0114129_10068548 3300009147 Bacteria 4946
81 Ga0114129_10102080 3300009147 Bacteria 3967
82 Ga0114129_10404765 3300009147 Bacteria 1798
83 Ga0105243_10205915 3300009148 Bacteria 1729
84 Ga0105249_10048354 3300009553 Bacteria 3877
85 Ga0105249_10090257 3300009553 Bacteria 2865
86 Ga0163162_10041376 3300013306 Bacteria 4611
87 Ga0157380_10059861 3300014326 Bacteria 3041
88 Ga0213876_10093870 3300021384 Bacteria 1589
89 Ga0207710_10009412 3300025900 Bacteria 4112
90 Ga0207680_10166072 3300025903 Bacteria 1483
91 Ga0207643_10163083 3300025908 Bacteria 1342
92 Ga0207684_10030693 3300025910 Bacteria 4574
93 Ga0207707_10045045 3300025912 Bacteria 3845
94 Ga0207695_10055433 3300025913 Bacteria 4131
95 Ga0207660_10439722 3300025917 Bacteria 1054
96 Ga0207652_10089838 3300025921 Bacteria 2698
97 Ga0207652_10304684 3300025921 Bacteria 1438
98 Ga0207681_10003965 3300025923 Bacteria 9179
99 Ga0207681_10474308 3300025923 Bacteria 1021
100 Ga0207694_10275599 3300025924 Bacteria 1381
101 Ga0207709_10139768 3300025935 Bacteria 1663
102 Ga0207689_10126737 3300025942 Bacteria 2100
103 Ga0207667_10024459 3300025949 Bacteria 6631
104 Ga0207712_10083137 3300025961 Bacteria 2336
105 Ga0207658_10251286 3300025986 Bacteria 1502
106 Ga0207703_10010201 3300026035 Bacteria 7362
107 Ga0207703_10154481 3300026035 Bacteria 2004
108 Ga0207708_10028475 3300026075 Bacteria 4230
109 Ga0207702_10388656 3300026078 Bacteria 1343
110 Ga0207641_10063349 3300026088 Bacteria 3158
111 Ga0207675_100021851 3300026118 Bacteria 5957
112 Ga0207675_100048068 3300026118 Bacteria 3983
113 Ga0209966_1014483 3300027695 Bacteria 1473
114 Ga0207428_10000284 3300027907 Bacteria 68587
115 Ga0268265_10086853 3300028380 Bacteria 2487
116 Ga0268265_10204698 3300028380 Bacteria 1715
117 Ga0268264_10037549 3300028381 Bacteria 3994
118 Ga0268264_10102302 3300028381 Bacteria 2493
119 Ga0307408_100170113 3300031548 Bacteria 1739
120 Ga0265342_10064775 3300031712 Bacteria 2144
121 Ga0316576_10000961 3300031727 Bacteria 14787
122 Ga0316576_10126057 3300031727 Bacteria 1924
123 Ga0316578_10032353 3300031728 Bacteria 2988
124 Ga0307410_10137273 3300031852 Bacteria 1804
125 Ga0307409_100049947 3300031995 Bacteria 3192
126 Ga0307416_100006911 3300032002 Bacteria 7149
127 Ga0307416_100008624 3300032002 Bacteria 6598
128 Ga0307416_100182998 3300032002 Bacteria 1966
129 Ga0307416_100392117 3300032002 Bacteria 1423
130 Ga0373950_0000064 3300034818 Bacteria 58213
131 Ga0373940_0014531 3300035088 Bacteria 1922
132 Ga0373942_0046752 3300035207 Bacteria 1200
133 Ga0316574_0013644 3300035398 Bacteria 4676
134 Ga0373931_0005631 3300035691 Bacteria 5811
135 Ga0373931_0015516 3300035691 Bacteria 3738
136 Ga0373931_0121577 3300035691 Bacteria 1493
137 Ga0316584_0003132 3300036712 Bacteria 10694
138 Ga0316584_0376125 3300036712 Bacteria 1016
139 Ga0400485_00290 3300038735 Bacteria 29093
140 Ga0400486_16528 3300038742 Bacteria 16730
141 Ga0400487_42747 3300039110 Bacteria 44423
142 Ga0436365_0152411 3300039437 Bacteria 1197
143 Ga0436362_0856016 3300039453 Bacteria 1620
144 Ga0451577_0296666 3300042876 Bacteria 1465
145 Ga0453683_0013349 3300044673 Bacteria 5367
146 Ga0453683_0097332 3300044673 Bacteria 1847
147 Ga0453684_0002413 3300044712 Bacteria 45535
148 Ga0453684_0028971 3300044712 Bacteria 7879
149 Ga0453684_0119678 3300044712 Bacteria 3182
150 Ga0453684_0360327 3300044712 Bacteria 1637
151 Ga0453684_0820382 3300044712 Bacteria 1002
152 Ga0495644_0075922 3300046523 Bacteria 1266
153 Ga0495669_0011243 3300046684 Bacteria 3798
154 Ga0495672_0001819 3300047320 Bacteria 20400
155 Ga0496102_0057374 3300048905 Bacteria 3555
156 Ga0496103_0046220 3300048906 Bacteria 2687
157 Ga0496119_0001481 3300048922 Bacteria 28129
158 Ga0496120_0001190 3300048923 Bacteria 33086
159 Ga0496125_0002070 3300048928 Bacteria 27078
160 Ga0496125_0072325 3300048928 Bacteria 2687
161 Ga0496126_0146568 3300048929 Bacteria 2027
162 Ga0496126_0379327 3300048929 Bacteria 1151
163 Ga0501033_0039215 3300049570 Bacteria 3539
164 Ga0501034_0000354 3300049571 Bacteria 78713
165 Ga0501036_0016887 3300049572 Bacteria 6097
166 Ga0501036_0042807 3300049572 Bacteria 3834
167 Ga0501036_0085535 3300049572 Bacteria 2666
168 Ga0501037_0462974 3300049573 Bacteria 864
169 Ga0501038_0274378 3300049574 Bacteria 1329
170 Ga0501039_0085186 3300049575 Bacteria 2462
171 Ga0501039_0450979 3300049575 Bacteria 1010
172 Ga0501040_0004544 3300049576 Bacteria 9008
173 Ga0501040_0169215 3300049576 Bacteria 1547
174 Ga0501041_0016795 3300049577 Bacteria 4356
175 Ga0501041_0029298 3300049577 Bacteria 3321
176 Ga0501041_0129001 3300049577 Bacteria 1575
177 Ga0501041_0203218 3300049577 Bacteria 1242
178 Ga0501042_0024171 3300049578 Bacteria 4261
179 Ga0501042_0066485 3300049578 Bacteria 2577
180 Ga0501043_0002103 3300049579 Bacteria 17005
181 Ga0501043_0192857 3300049579 Bacteria 1584
182 Ga0501046_0000960 3300049580 Bacteria 28234
183 Ga0501046_0267403 3300049580 Bacteria 1255
184 Ga0501047_0000001 3300049581 Bacteria 658799
185 Ga0501048_0001331 3300049582 Bacteria 18722
186 Ga0501048_0184442 3300049582 Bacteria 1479
187 Ga0501048_0238684 3300049582 Bacteria 1290
188 Ga0501067_0053484 3300049583 Bacteria 2237
189 Ga0501068_0081338 3300049584 Bacteria 1988
190 Ga0501069_0228360 3300049585 Bacteria 1083
191 Ga0501070_0001313 3300049586 Bacteria 22270
192 Ga0501071_0059467 3300049587 Bacteria 2765
193 Ga0501072_0000019 3300049588 Bacteria 158156
194 Ga0501072_0004639 3300049588 Bacteria 10461
195 Ga0501072_0014354 3300049588 Bacteria 6073
196 Ga0501072_0022465 3300049588 Bacteria 4894
197 Ga0501072_0107353 3300049588 Bacteria 2221
198 Ga0501073_0155992 3300049589 Bacteria 1582
199 Ga0501074_0000342 3300049590 Bacteria 27192
200 Ga0501075_0003209 3300049591 Bacteria 10937
201 Ga0501075_0035616 3300049591 Bacteria 3712
202 Ga0501075_0220994 3300049591 Bacteria 1445
203 Ga0501075_0256220 3300049591 Bacteria 1333
204 Ga0501076_0005631 3300049592 Bacteria 9027
205 Ga0501076_0006185 3300049592 Bacteria 8663
206 Ga0501076_0097884 3300049592 Bacteria 2363
207 Ga0501077_0015718 3300049593 Bacteria 4766
208 Ga0501077_0135673 3300049593 Bacteria 1561
209 Ga0501079_0007032 3300049741 Bacteria 8489
210 Ga0501079_0013160 3300049741 Bacteria 6306
211 Ga0501079_0053705 3300049741 Bacteria 3108
212 Ga0501079_0124330 3300049741 Bacteria 2006
213 Ga0501079_0157375 3300049741 Bacteria 1771
214 Ga0501079_0168743 3300049741 Bacteria 1707
215 Ga0501080_0056608 3300049742 Bacteria 3651
216 Ga0501080_0143926 3300049742 Bacteria 2203
217 Ga0501080_0187618 3300049742 Bacteria 1901
218 Ga0501080_0218923 3300049742 Bacteria 1743
219 Ga0501081_0002998 3300049743 Bacteria 10716
220 Ga0501081_0004786 3300049743 Bacteria 8714
221 Ga0501081_0023753 3300049743 Bacteria 4111
222 Ga0501081_0254839 3300049743 Bacteria 1281
223 Ga0501083_0005049 3300049744 Bacteria 9348
224 Ga0501083_0082374 3300049744 Bacteria 2132
225 Ga0501045_0031455 3300049824 Bacteria 3844
226 nmdc:mga0k408_452489_c1 3300050493 Bacteria 762
227 nmdc:mga05p37_100_c1 3300050507 Bacteria 77275
228 nmdc:mga05p37_172083_c1 3300050507 Bacteria 2641
229 nmdc:mga05p37_260304_c2 3300050507 Bacteria 1490
230 nmdc:mga05p37_32611_c1 3300050507 Bacteria 6371
231 nmdc:mga05p37_54621_c1 3300050507 Bacteria 4913
232 nmdc:mga05p37_640008_c1 3300050507 Bacteria 1193
233 nmdc:mga05p37_65958_c1 3300050507 Bacteria 4454
234 nmdc:mga05p37_794_c1 3300050507 Bacteria 35161
235 nmdc:mga09592_27818_c1 3300050508 Bacteria 4693
236 nmdc:mga09592_38326_c1 3300050508 Bacteria 4023
237 nmdc:mga09592_40601_c1 3300050508 Bacteria 3909
238 nmdc:mga09592_447607_c1 3300050508 Bacteria 1114
239 nmdc:mga09592_7973_c1 3300050508 Bacteria 8606
240 nmdc:mga0qj67_1635_c1 3300050509 Bacteria 15766
241 nmdc:mga0qj67_199724_c1 3300050509 Bacteria 1625
242 nmdc:mga0qj67_22243_c1 3300050509 Bacteria 4869
243 nmdc:mga0qj67_263423_c1 3300050509 Bacteria 1398
244 nmdc:mga0qj67_520_c1 3300050509 Bacteria 26187
245 nmdc:mga0qj67_61238_c1 3300050509 Bacteria 2988
246 nmdc:mga06r32_115674_c1 3300050510 Bacteria 2642
247 nmdc:mga06r32_11635_c1 3300050510 Bacteria 7921
248 nmdc:mga06r32_117724_c1 3300050510 Bacteria 2619
249 nmdc:mga06r32_169008_c1 3300050510 Bacteria 2170
250 nmdc:mga06r32_24249_c1 3300050510 Bacteria 5627
251 nmdc:mga06r32_639_c1 3300050510 Bacteria 30459
252 nmdc:mga06r32_71165_c1 3300050510 Bacteria 3365
253 nmdc:mga08y16_113451_c1 3300050511 Bacteria 2821
254 nmdc:mga08y16_1725_c1 3300050511 Bacteria 22185
255 nmdc:mga0n895_130253_c1 3300050512 Bacteria 2540
256 nmdc:mga0n895_21935_c1 3300050512 Bacteria 5982
257 nmdc:mga08x19_108857_c1 3300050514 Bacteria 1846
258 nmdc:mga0a205_307324_c1 3300050515 Bacteria 1458
259 nmdc:mga0a205_37577_c1 3300050515 Bacteria 4656
260 Ga0500616_0000032 3300053153 Bacteria 403673
261 Ga0501084_0000509 3300054114 Bacteria 29788
262 Ga0501084_0010165 3300054114 Bacteria 7780
263 Ga0501084_0048831 3300054114 Bacteria 3542
264 Ga0501084_0055893 3300054114 Bacteria 3303
265 Ga0501084_0060263 3300054114 Bacteria 3177
266 Ga0501082_0005693 3300060353 Bacteria 10811
267 Ga0501082_0009676 3300060353 Bacteria 8300
268 Ga0501082_0064387 3300060353 Bacteria 3158
269 Ga0501082_0121546 3300060353 Bacteria 2263
270 Ga0501082_0129991 3300060353 Bacteria 2185
271 Ga0530510_0000604 3300061734 Bacteria 23092
272 Ga0530510_0005016 3300061734 Bacteria 9143
273 Ga0530510_0010587 3300061734 Bacteria 6466
274 Ga0530510_0074966 3300061734 Bacteria 2457
275 Ga0316574_0011964
276 Ga0070658_10109456
277 Ga0068869_100081439
278 Ga0070668_100014732
279 Ga0070671_100020113
280 Ga0070667_100092828
281 Ga0070700_100115788
282 Ga0070694_100104958
283 Ga0070694_100235638
284 Ga0070708_100124891
285 Ga0070708_100416285
286 Ga0070681_10050335
287 Ga0070685_10114089
288 Ga0070706_100013416
289 Ga0070707_100132297
290 Ga0070707_100168626
291 Ga0070698_100294002
292 Ga0070698_100329730
293 Ga0070699_100087724
294 Ga0070699_100136209
295 Ga0070699_100269148
296 Ga0070697_100011661
297 Ga0070697_100242712
298 Ga0070672_100037055
299 Ga0070704_100012624
300 Ga0070704_100013095
301 Ga0070704_100025551
302 Ga0068855_100297952
303 Ga0070664_100329883
304 Ga0068856_100196271
305 Ga0068859_100075864
306 Ga0068859_100089752
307 Ga0068861_100021945
308 Ga0068861_100046544
309 Ga0068861_100089808
310 Ga0068870_10172964
311 Ga0068863_100019838
312 Ga0068858_100007105
313 Ga0068858_100092151
314 Ga0068860_100455667
315 Ga0068862_100017449
316 Ga0068862_100495450
317 Ga0075432_10015928
318 Ga0075428_100007893
319 Ga0075428_100071302
320 Ga0075428_100090338
321 Ga0075428_100156952
322 Ga0075430_100000380
323 Ga0075430_100002531
324 Ga0075430_100025656
325 Ga0075430_100028973
326 Ga0075431_100000016
327 Ga0075431_100000127
328 Ga0075431_100000691
329 Ga0075431_100000906
330 Ga0075431_100032272
331 Ga0075431_100141313
332 Ga0075433_10076554
333 Ga0075434_100010470
334 Ga0075434_100187480
335 Ga0075429_100011292
336 Ga0075429_100031428
337 Ga0075429_100065868
338 Ga0075429_100136781
339 Ga0097620_100075862
340 Ga0097620_100089752
341 Ga0075435_100180962
342 Ga0099794_10016366
343 Ga0099794_10131485
344 Ga0105240_10021056
345 Ga0111539_10021719
346 Ga0111539_10022681
347 Ga0105247_10020160
348 Ga0114129_10000093
349 Ga0114129_10009697
350 Ga0114129_10011506
351 Ga0114129_10041341
352 Ga0114129_10049117
353 Ga0114129_10064130
354 Ga0114129_10068548
355 Ga0114129_10102080
356 Ga0114129_10404765
357 Ga0105243_10205915
358 Ga0105249_10048354
359 Ga0105249_10090257
360 Ga0163162_10041376
361 Ga0157380_10059861
362 Ga0213876_10093870
363 Ga0207710_10009412
364 Ga0207680_10166072
365 Ga0207643_10163083
366 Ga0207684_10030693
367 Ga0207707_10045045
368 Ga0207695_10055433
369 Ga0207660_10439722
370 Ga0207652_10089838
371 Ga0207652_10304684
372 Ga0207681_10003965
373 Ga0207681_10474308
374 Ga0207694_10275599
375 Ga0207709_10139768
376 Ga0207689_10126737
377 Ga0207667_10024459
378 Ga0207712_10083137
379 Ga0207658_10251286
380 Ga0207703_10010201
381 Ga0207703_10154481
382 Ga0207708_10028475
383 Ga0207702_10388656
384 Ga0207641_10063349
385 Ga0207675_100021851
386 Ga0207675_100048068
387 Ga0209966_1014483
388 Ga0207428_10000284
389 Ga0268265_10086853
390 Ga0268265_10204698
391 Ga0268264_10037549
392 Ga0268264_10102302
393 Ga0307408_100170113
394 Ga0265342_10064775
395 Ga0316576_10000961
396 Ga0316576_10126057
397 Ga0316578_10032353
398 Ga0307410_10137273
399 Ga0307409_100049947
400 Ga0307416_100006911
401 Ga0307416_100008624
402 Ga0307416_100182998
403 Ga0307416_100392117
404 Ga0373950_0000064
405 Ga0373940_0014531
406 Ga0373942_0046752
407 Ga0316574_0013644
408 Ga0373931_0005631
409 Ga0373931_0015516
410 Ga0373931_0121577
411 Ga0316584_0003132
412 Ga0316584_0376125
413 Ga0400485_00290
414 Ga0400486_16528
415 Ga0400487_42747
416 Ga0436365_0152411
417 Ga0436362_0856016
418 Ga0451577_0296666
419 Ga0453683_0013349
420 Ga0453683_0097332
421 Ga0453684_0002413
422 Ga0453684_0028971
423 Ga0453684_0119678
424 Ga0453684_0360327
425 Ga0453684_0820382
426 Ga0495644_0075922
427 Ga0495669_0011243
428 Ga0495672_0001819
429 Ga0496102_0057374
430 Ga0496103_0046220
431 Ga0496119_0001481
432 Ga0496120_0001190
433 Ga0496125_0002070
434 Ga0496125_0072325
435 Ga0496126_0146568
436 Ga0496126_0379327
437 Ga0501033_0039215
438 Ga0501034_0000354
439 Ga0501036_0016887
440 Ga0501036_0042807
441 Ga0501036_0085535
442 Ga0501037_0462974
443 Ga0501038_0274378
444 Ga0501039_0085186
445 Ga0501039_0450979
446 Ga0501040_0004544
447 Ga0501040_0169215
448 Ga0501041_0016795
449 Ga0501041_0029298
450 Ga0501041_0129001
451 Ga0501041_0203218
452 Ga0501042_0024171
453 Ga0501042_0066485
454 Ga0501043_0002103
455 Ga0501043_0192857
456 Ga0501046_0000960
457 Ga0501046_0267403
458 Ga0501047_0000001
459 Ga0501048_0001331
460 Ga0501048_0184442
461 Ga0501048_0238684
462 Ga0501067_0053484
463 Ga0501068_0081338
464 Ga0501069_0228360
465 Ga0501070_0001313
466 Ga0501071_0059467
467 Ga0501072_0000019
468 Ga0501072_0004639
469 Ga0501072_0014354
470 Ga0501072_0022465
471 Ga0501072_0107353
472 Ga0501073_0155992
473 Ga0501074_0000342
474 Ga0501075_0003209
475 Ga0501075_0035616
476 Ga0501075_0220994
477 Ga0501075_0256220
478 Ga0501076_0005631
479 Ga0501076_0006185
480 Ga0501076_0097884
481 Ga0501077_0015718
482 Ga0501077_0135673
483 Ga0501079_0007032
484 Ga0501079_0013160
485 Ga0501079_0053705
486 Ga0501079_0124330
487 Ga0501079_0157375
488 Ga0501079_0168743
489 Ga0501080_0056608
490 Ga0501080_0143926
491 Ga0501080_0187618
492 Ga0501080_0218923
493 Ga0501081_0002998
494 Ga0501081_0004786
495 Ga0501081_0023753
496 Ga0501081_0254839
497 Ga0501083_0005049
498 Ga0501083_0082374
499 Ga0501045_0031455
500 nmdc:mga0k408_452489_c1
501 nmdc:mga05p37_100_c1
502 nmdc:mga05p37_172083_c1
503 nmdc:mga05p37_260304_c2
504 nmdc:mga05p37_32611_c1
505 nmdc:mga05p37_54621_c1
506 nmdc:mga05p37_640008_c1
507 nmdc:mga05p37_65958_c1
508 nmdc:mga05p37_794_c1
509 nmdc:mga09592_27818_c1
510 nmdc:mga09592_38326_c1
511 nmdc:mga09592_40601_c1
512 nmdc:mga09592_447607_c1
513 nmdc:mga09592_7973_c1
514 nmdc:mga0qj67_1635_c1
515 nmdc:mga0qj67_199724_c1
516 nmdc:mga0qj67_22243_c1
517 nmdc:mga0qj67_263423_c1
518 nmdc:mga0qj67_520_c1
519 nmdc:mga0qj67_61238_c1
520 nmdc:mga06r32_115674_c1
521 nmdc:mga06r32_11635_c1
522 nmdc:mga06r32_117724_c1
523 nmdc:mga06r32_169008_c1
524 nmdc:mga06r32_24249_c1
525 nmdc:mga06r32_639_c1
526 nmdc:mga06r32_71165_c1
527 nmdc:mga08y16_113451_c1
528 nmdc:mga08y16_1725_c1
529 nmdc:mga0n895_130253_c1
530 nmdc:mga0n895_21935_c1
531 nmdc:mga08x19_108857_c1
532 nmdc:mga0a205_307324_c1
533 nmdc:mga0a205_37577_c1
534 Ga0500616_0000032
535 Ga0501084_0000509
536 Ga0501084_0010165
537 Ga0501084_0048831
538 Ga0501084_0055893
539 Ga0501084_0060263
540 Ga0501082_0005693
541 Ga0501082_0009676
542 Ga0501082_0064387
543 Ga0501082_0121546
544 Ga0501082_0129991
545 Ga0530510_0000604
546 Ga0530510_0005016
547 Ga0530510_0010587
548 Ga0530510_0074966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

241

0.98

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

196

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t38-assembly1.cif.gz_A pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9881 2 292
6t37-assembly2.cif.gz_C-3 pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9871 2 292
6tqg-assembly1.cif.gz_A pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9862 2 292
6tqg-assembly1.cif.gz_B pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.986 2 292
6t38-assembly1.cif.gz_C pseudomonas aeruginosa rmla in complex with allosteric inhibitor 0.9855 2 292
ID Description Score Start End Superfamily
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9852 2 292 3.90.550.10
4b2xA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9718 2 292 3.90.550.10
4ecmA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9405 1 238 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9216 1 223 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9091 1 223 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6I3TEG1-F1-model_v4 deleted 0.996 14 126
AF-W3YZ78-F1-model_v4 deleted 0.9935 34 243
AF-A0A359DFL1-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9933 55 226 GO:0008879
GO:0045226
AF-A0A836ZRB6-F1-model_v4 glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24) 0.9927 72 229 GO:0008879
GO:0045226
AF-A0A4Q3INY9-F1-model_v4 deleted 0.9909 31 287

Map