F379848

General Info

Members Datasets Scaffolds Average Seq Length
274 186 548 78

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100802117|Ga0307409_1008021172
Length 88
Sequence MTIVVKLDDVLYARRMTLTELSERVGITLANLSILKTGKAKAIRFSTLDAICRALGCQPGDLLEYEPSSGAAETPAEDDDAAPGERVA

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
126 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
127 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
141 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
142 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
143 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
172 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
182 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
183 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
184 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
185 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.82
Nodule 0
Rhizoplane 3.28
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100802117 3300031995 Bacteria 949
2 MBSR1b_contig_10007863 2162886012 Bacteria 1100
3 JGI24033J26618_1036437 3300002155 Bacteria 676
4 rootL2_10123001 3300003322 Bacteria 1443
5 Ga0065712_10790116 3300005290 Bacteria 515
6 Ga0065715_10156422 3300005293 Bacteria 1672
7 Ga0065715_10486544 3300005293 Bacteria 788
8 Ga0070676_10175504 3300005328 Bacteria 1389
9 Ga0070683_101109378 3300005329 Bacteria 760
10 Ga0070690_100022837 3300005330 Bacteria 3831
11 Ga0070670_100033980 3300005331 Bacteria 4390
12 Ga0070670_100064549 3300005331 Bacteria 3142
13 Ga0070670_100573462 3300005331 Bacteria 1008
14 Ga0070677_10011949 3300005333 Bacteria 3005
15 Ga0068869_100398434 3300005334 Bacteria 1131
16 Ga0070666_10000207 3300005335 Bacteria 40445
17 Ga0068868_100065620 3300005338 Bacteria 2884
18 Ga0070689_100179011 3300005340 Bacteria 1721
19 Ga0070687_100223079 3300005343 Bacteria 1156
20 Ga0070661_100036908 3300005344 Bacteria 3553
21 Ga0070661_101933552 3300005344 Bacteria 502
22 Ga0070668_101697645 3300005347 Bacteria 580
23 Ga0070669_100019230 3300005353 Bacteria 4878
24 Ga0070669_100023723 3300005353 Bacteria 4395
25 Ga0070675_101096143 3300005354 Bacteria 732
26 Ga0070671_100008256 3300005355 Bacteria 8334
27 Ga0070671_100065997 3300005355 Bacteria 3015
28 Ga0070671_101880746 3300005355 Unclassified 532
29 Ga0070674_100011000 3300005356 Bacteria 5489
30 Ga0070674_100274704 3300005356 Bacteria 1333
31 Ga0070673_100005800 3300005364 Bacteria 7950
32 Ga0070673_101625764 3300005364 Bacteria 611
33 Ga0070673_101930648 3300005364 Bacteria 560
34 Ga0070659_100141622 3300005366 Bacteria 1958
35 Ga0070667_100001528 3300005367 Bacteria 20692
36 Ga0070714_100693738 3300005435 Bacteria 982
37 Ga0070694_101334256 3300005444 Bacteria 604
38 Ga0070663_100006315 3300005455 Bacteria 7115
39 Ga0070663_100672063 3300005455 Bacteria 878
40 Ga0070662_100000521 3300005457 Bacteria 23178
41 Ga0070662_100101258 3300005457 Bacteria 2180
42 Ga0070662_100152470 3300005457 Bacteria 1801
43 Ga0070662_100612153 3300005457 Bacteria 917
44 Ga0070681_10434570 3300005458 Bacteria 1225
45 Ga0070681_11208473 3300005458 Bacteria 678
46 Ga0070679_100246578 3300005530 Bacteria 1743
47 Ga0068853_102079102 3300005539 Bacteria 551
48 Ga0070672_100163032 3300005543 Bacteria 1851
49 Ga0070672_100176439 3300005543 Bacteria 1779
50 Ga0070693_100517325 3300005547 Bacteria 849
51 Ga0070665_101173385 3300005548 Bacteria 779
52 Ga0070664_100018874 3300005564 Bacteria 5669
53 Ga0070664_100919099 3300005564 Bacteria 821
54 Ga0068859_100126650 3300005617 Bacteria 2623
55 Ga0068859_100590917 3300005617 Bacteria 1203
56 Ga0068864_100177624 3300005618 Bacteria 1945
57 Ga0068864_100181915 3300005618 Bacteria 1922
58 Ga0068866_10133739 3300005718 Bacteria 1414
59 Ga0068851_10546414 3300005834 Bacteria 700
60 Ga0068863_100061720 3300005841 Bacteria 3544
61 Ga0068863_100877891 3300005841 Bacteria 896
62 Ga0068858_100001012 3300005842 Bacteria 28969
63 Ga0068858_100011033 3300005842 Bacteria 8540
64 Ga0068858_100053190 3300005842 Bacteria 3746
65 Ga0068858_101527243 3300005842 Bacteria 659
66 Ga0068860_100079491 3300005843 Bacteria 3118
67 Ga0068860_100585211 3300005843 Bacteria 1120
68 Ga0068862_100318714 3300005844 Bacteria 1434
69 Ga0070716_101808625 3300006173 Bacteria 506
70 Ga0068871_100129177 3300006358 Bacteria 2141
71 Ga0075428_100273065 3300006844 Bacteria 1819
72 Ga0075431_100028287 3300006847 Bacteria 5757
73 Ga0075433_10034113 3300006852 Bacteria 4369
74 Ga0075433_10453960 3300006852 Bacteria 1130
75 Ga0075434_101166634 3300006871 Bacteria 783
76 Ga0075429_100012150 3300006880 Bacteria 7464
77 Ga0068865_100196625 3300006881 Bacteria 1563
78 Ga0097620_100126649 3300006931 Bacteria 2623
79 Ga0097620_100590913 3300006931 Bacteria 1203
80 Ga0075435_100110597 3300007076 Bacteria 2285
81 Ga0075435_101008910 3300007076 Unclassified 727
82 Ga0105240_10151155 3300009093 Bacteria 2765
83 Ga0111539_11893602 3300009094 Bacteria 691
84 Ga0105245_10226307 3300009098 Bacteria 1807
85 Ga0114129_11227125 3300009147 Bacteria 933
86 Ga0114129_13297741 3300009147 Bacteria 522
87 Ga0105243_11737593 3300009148 Bacteria 654
88 Ga0105241_10316128 3300009174 Bacteria 1345
89 Ga0105242_10571707 3300009176 Bacteria 1087
90 Ga0105248_10008508 3300009177 Bacteria 11267
91 Ga0105248_10352785 3300009177 Bacteria 1656
92 Ga0105248_10406429 3300009177 Bacteria 1533
93 Ga0105248_10422957 3300009177 Bacteria 1500
94 Ga0105237_10929660 3300009545 Bacteria 877
95 Ga0105238_10000545 3300009551 Bacteria 39378
96 Ga0105249_10148031 3300009553 Bacteria 2258
97 Ga0105246_10124766 3300011119 Bacteria 1914
98 Ga0157371_10619682 3300013102 Bacteria 806
99 Ga0157371_10658736 3300013102 Bacteria 782
100 Ga0157369_10296013 3300013105 Bacteria 1684
101 Ga0157374_10026954 3300013296 Bacteria 5176
102 Ga0157374_10038488 3300013296 Bacteria 4396
103 Ga0157374_10795109 3300013296 Bacteria 962
104 Ga0157378_10029429 3300013297 Bacteria 4848
105 Ga0157378_12459336 3300013297 Bacteria 573
106 Ga0163162_13473948 3300013306 Bacteria 502
107 Ga0157375_10209900 3300013308 Bacteria 2104
108 Ga0157377_10054439 3300014745 Bacteria 2265
109 Ga0157377_10874372 3300014745 Bacteria 669
110 Ga0157379_11568405 3300014968 Bacteria 642
111 Ga0207656_10367306 3300025321 Bacteria 720
112 Ga0207682_10001093 3300025893 Bacteria 12530
113 Ga0207642_10129439 3300025899 Bacteria 1315
114 Ga0207688_10991952 3300025901 Bacteria 531
115 Ga0207643_10509242 3300025908 Bacteria 770
116 Ga0207654_10621449 3300025911 Bacteria 772
117 Ga0207662_10204366 3300025918 Bacteria 1280
118 Ga0207657_10138565 3300025919 Bacteria 1989
119 Ga0207649_11634694 3300025920 Bacteria 510
120 Ga0207652_10242754 3300025921 Bacteria 1624
121 Ga0207681_10064026 3300025923 Bacteria 2537
122 Ga0207681_10072099 3300025923 Bacteria 2411
123 Ga0207694_10000424 3300025924 Bacteria 39415
124 Ga0207650_10233537 3300025925 Bacteria 1484
125 Ga0207650_10363509 3300025925 Bacteria 1192
126 Ga0207650_11575568 3300025925 Bacteria 558
127 Ga0207659_10965632 3300025926 Bacteria 733
128 Ga0207687_10418699 3300025927 Bacteria 1105
129 Ga0207644_10002917 3300025931 Bacteria 11016
130 Ga0207644_10018462 3300025931 Bacteria 4719
131 Ga0207706_10000106 3300025933 Bacteria 88479
132 Ga0207706_10036311 3300025933 Bacteria 4377
133 Ga0207706_10039615 3300025933 Bacteria 4178
134 Ga0207706_10089450 3300025933 Bacteria 2707
135 Ga0207706_10390924 3300025933 Bacteria 1206
136 Ga0207706_10669602 3300025933 Unclassified 888
137 Ga0207670_10145726 3300025936 Bacteria 1751
138 Ga0207669_10016762 3300025937 Bacteria 3735
139 Ga0207704_10648944 3300025938 Bacteria 869
140 Ga0207691_10178355 3300025940 Bacteria 1857
141 Ga0207711_10000639 3300025941 Bacteria 35104
142 Ga0207689_10419768 3300025942 Bacteria 1116
143 Ga0207689_10561159 3300025942 Bacteria 959
144 Ga0207651_10003199 3300025960 Bacteria 8002
145 Ga0207651_10257096 3300025960 Bacteria 1432
146 Ga0207651_11723954 3300025960 Bacteria 564
147 Ga0207712_10047846 3300025961 Bacteria 2972
148 Ga0207712_10365265 3300025961 Bacteria 1204
149 Ga0207668_10232484 3300025972 Bacteria 1487
150 Ga0207658_10001050 3300025986 Bacteria 22409
151 Ga0207677_10022980 3300026023 Bacteria 3842
152 Ga0207677_10024103 3300026023 Bacteria 3774
153 Ga0207703_10014570 3300026035 Bacteria 6135
154 Ga0207703_10073682 3300026035 Bacteria 2825
155 Ga0207703_10514258 3300026035 Bacteria 1125
156 Ga0207703_11615811 3300026035 Bacteria 624
157 Ga0207678_10005815 3300026067 Bacteria 10993
158 Ga0207708_10006381 3300026075 Bacteria 8735
159 Ga0207702_11288154 3300026078 Bacteria 725
160 Ga0207641_11599675 3300026088 Bacteria 653
161 Ga0207676_10015047 3300026095 Bacteria 5577
162 Ga0207676_10251116 3300026095 Bacteria 1592
163 Ga0207674_11203284 3300026116 Bacteria 727
164 Ga0207683_10151071 3300026121 Bacteria 2096
165 Ga0209974_10298145 3300027876 Bacteria 616
166 Ga0268265_10213403 3300028380 Bacteria 1683
167 Ga0268265_11245805 3300028380 Bacteria 743
168 Ga0268264_10022616 3300028381 Bacteria 5131
169 Ga0265330_10045284 3300031235 Bacteria 1940
170 Ga0265316_10010672 3300031344 Bacteria 8350
171 Ga0265316_10340022 3300031344 Unclassified 1088
172 Ga0265314_10108156 3300031711 Bacteria 1772
173 Ga0307413_10004896 3300031824 Bacteria 5895
174 Ga0307413_10119767 3300031824 Bacteria 1780
175 Ga0307413_11246617 3300031824 Bacteria 648
176 Ga0307410_10021271 3300031852 Bacteria 3987
177 Ga0307410_10128540 3300031852 Bacteria 1858
178 Ga0307410_10689694 3300031852 Bacteria 860
179 Ga0307406_10482088 3300031901 Bacteria 1002
180 Ga0307406_10729731 3300031901 Bacteria 830
181 Ga0307406_11337252 3300031901 Bacteria 626
182 Ga0307406_12140392 3300031901 Bacteria 502
183 Ga0307409_100120843 3300031995 Bacteria 2218
184 Ga0307409_100749193 3300031995 Bacteria 980
185 Ga0307416_100225161 3300032002 Bacteria 1803
186 Ga0307416_100712058 3300032002 Bacteria 1094
187 Ga0307416_103593039 3300032002 Bacteria 519
188 Ga0307414_10037213 3300032004 Bacteria 3256
189 Ga0307414_10156368 3300032004 Bacteria 1805
190 Ga0307414_10558446 3300032004 Bacteria 1021
191 Ga0307414_11368995 3300032004 Bacteria 657
192 Ga0307411_10005534 3300032005 Bacteria 6218
193 Ga0307411_10051190 3300032005 Bacteria 2693
194 Ga0307411_10569645 3300032005 Bacteria 969
195 Ga0307411_11154539 3300032005 Bacteria 700
196 Ga0307415_100091498 3300032126 Bacteria 2203
197 Ga0373923_0124469 3300035111 Unclassified 1154
198 Ga0373923_0368197 3300035111 Unclassified 688
199 Ga0373939_0262294 3300035114 Bacteria 676
200 Ga0373953_0089553 3300035117 Bacteria 1286
201 Ga0373953_0201343 3300035117 Unclassified 861
202 Ga0373954_0074344 3300035118 Unclassified 1617
203 Ga0373956_0172164 3300035119 Bacteria 1022
204 Ga0373957_0314141 3300035120 Bacteria 666
205 Ga0373943_0055322 3300035170 Bacteria 1965
206 Ga0373955_0043148 3300035172 Unclassified 2425
207 Ga0373955_0109479 3300035172 Bacteria 1596
208 Ga0373942_0115235 3300035207 Bacteria 835
209 Ga0373931_0559354 3300035691 Bacteria 744
210 Ga0373935_0150509 3300035692 Bacteria 1579
211 Ga0373933_0051688 3300035724 Unclassified 2457
212 Ga0373933_0419564 3300035724 Bacteria 874
213 Ga0373933_0634521 3300035724 Bacteria 702
214 Ga0373937_0041182 3300036401 Unclassified 4214
215 Ga0373937_0247077 3300036401 Unclassified 1682
216 Ga0373925_0596082 3300037068 Bacteria 910
217 Ga0395905_0015507 3300037471 Bacteria 7244
218 Ga0436365_0910811 3300039437 Bacteria 868
219 Ga0439461_0119911 3300041410 Bacteria 657
220 Ga0451795_0184136 3300041456 Bacteria 1230
221 Ga0451795_1530918 3300041456 Bacteria 2215
222 Ga0450921_019363 3300042123 Bacteria 637
223 Ga0450899_021370 3300042135 Bacteria 758
224 Ga0439435_0081339 3300042436 Bacteria 972
225 Ga0450918_099560 3300042531 Bacteria 568
226 Ga0466961_0013727 3300044693 Bacteria 5191
227 Ga0451576_0155165 3300045051 Bacteria 2388
228 Ga0451576_0169033 3300045051 Bacteria 2282
229 Ga0495629_0268597 3300046459 Unclassified 1172
230 Ga0495643_0000035 3300046522 Bacteria 238464
231 Ga0495643_0037089 3300046522 Bacteria 2676
232 Ga0495586_0119770 3300046535 Bacteria 1470
233 Ga0495586_0701963 3300046535 Bacteria 584
234 Ga0495622_0308261 3300046557 Bacteria 689
235 Ga0495668_0008694 3300046616 Bacteria 6309
236 Ga0495668_0010383 3300046616 Bacteria 5636
237 Ga0495623_0052231 3300046679 Bacteria 2583
238 Ga0495613_0565950 3300046689 Unclassified 759
239 Ga0495674_0272570 3300047319 Bacteria 1388
240 Ga0495683_0274952 3300047323 Bacteria 731
241 Ga0495602_0076361 3300048088 Bacteria 2839
242 Ga0495602_0104497 3300048088 Unclassified 2317
243 Ga0495614_0327739 3300048089 Bacteria 711
244 Ga0495615_0302745 3300048090 Bacteria 518
245 Ga0496101_0217485 3300048904 Bacteria 1482
246 Ga0496106_1385087 3300048909 Bacteria 544
247 Ga0496107_0190196 3300048910 Bacteria 1525
248 Ga0496108_1228209 3300048911 Bacteria 633
249 Ga0496109_0524681 3300048912 Bacteria 1118
250 Ga0496114_0294145 3300048917 Bacteria 1433
251 Ga0496115_0001150 3300048918 Bacteria 19121
252 Ga0501042_0463062 3300049578 Bacteria 920
253 Ga0501067_0765858 3300049583 Bacteria 543
254 Ga0501069_0136985 3300049585 Bacteria 1403
255 Ga0501076_0297085 3300049592 Bacteria 1324
256 Ga0501249_164692 3300049679 Bacteria 565
257 Ga0501257_282069 3300049686 Bacteria 500
258 Ga0501081_0868297 3300049743 Bacteria 680
259 nmdc:mga05p37_1043571_c1 3300050507 Bacteria 863
260 nmdc:mga09592_9821_c2 3300050508 Bacteria 7443
261 nmdc:mga06r32_795560_c1 3300050510 Bacteria 907
262 nmdc:mga08y16_2177256_c1 3300050511 Bacteria 501
263 nmdc:mga08y16_337689_c1 3300050511 Unclassified 1549
264 nmdc:mga0n895_1095324_c1 3300050512 Bacteria 774
265 nmdc:mga0rr50_144050_c1 3300050513 Bacteria 1919
266 nmdc:mga0rr50_1567242_c1 3300050513 Unclassified 556
267 nmdc:mga0a205_26222_c1 3300050515 Bacteria 5555
268 Ga0500566_0475873 3300053094 Bacteria 542
269 Ga0500592_002381 3300053116 Bacteria 3028
270 Ga0500658_0000149 3300053134 Bacteria 33339
271 Ga0500559_0030875 3300053136 Bacteria 2298
272 Ga0500559_0289307 3300053136 Bacteria 770
273 Ga0590071_007593 3300059421 Bacteria 2566
274 Ga0530510_0371214 3300061734 Bacteria 1076
275 Ga0307409_100802117
276 MBSR1b_contig_10007863
277 JGI24033J26618_1036437
278 rootL2_10123001
279 Ga0065712_10790116
280 Ga0065715_10156422
281 Ga0065715_10486544
282 Ga0070676_10175504
283 Ga0070683_101109378
284 Ga0070690_100022837
285 Ga0070670_100033980
286 Ga0070670_100064549
287 Ga0070670_100573462
288 Ga0070677_10011949
289 Ga0068869_100398434
290 Ga0070666_10000207
291 Ga0068868_100065620
292 Ga0070689_100179011
293 Ga0070687_100223079
294 Ga0070661_100036908
295 Ga0070661_101933552
296 Ga0070668_101697645
297 Ga0070669_100019230
298 Ga0070669_100023723
299 Ga0070675_101096143
300 Ga0070671_100008256
301 Ga0070671_100065997
302 Ga0070671_101880746
303 Ga0070674_100011000
304 Ga0070674_100274704
305 Ga0070673_100005800
306 Ga0070673_101625764
307 Ga0070673_101930648
308 Ga0070659_100141622
309 Ga0070667_100001528
310 Ga0070714_100693738
311 Ga0070694_101334256
312 Ga0070663_100006315
313 Ga0070663_100672063
314 Ga0070662_100000521
315 Ga0070662_100101258
316 Ga0070662_100152470
317 Ga0070662_100612153
318 Ga0070681_10434570
319 Ga0070681_11208473
320 Ga0070679_100246578
321 Ga0068853_102079102
322 Ga0070672_100163032
323 Ga0070672_100176439
324 Ga0070693_100517325
325 Ga0070665_101173385
326 Ga0070664_100018874
327 Ga0070664_100919099
328 Ga0068859_100126650
329 Ga0068859_100590917
330 Ga0068864_100177624
331 Ga0068864_100181915
332 Ga0068866_10133739
333 Ga0068851_10546414
334 Ga0068863_100061720
335 Ga0068863_100877891
336 Ga0068858_100001012
337 Ga0068858_100011033
338 Ga0068858_100053190
339 Ga0068858_101527243
340 Ga0068860_100079491
341 Ga0068860_100585211
342 Ga0068862_100318714
343 Ga0070716_101808625
344 Ga0068871_100129177
345 Ga0075428_100273065
346 Ga0075431_100028287
347 Ga0075433_10034113
348 Ga0075433_10453960
349 Ga0075434_101166634
350 Ga0075429_100012150
351 Ga0068865_100196625
352 Ga0097620_100126649
353 Ga0097620_100590913
354 Ga0075435_100110597
355 Ga0075435_101008910
356 Ga0105240_10151155
357 Ga0111539_11893602
358 Ga0105245_10226307
359 Ga0114129_11227125
360 Ga0114129_13297741
361 Ga0105243_11737593
362 Ga0105241_10316128
363 Ga0105242_10571707
364 Ga0105248_10008508
365 Ga0105248_10352785
366 Ga0105248_10406429
367 Ga0105248_10422957
368 Ga0105237_10929660
369 Ga0105238_10000545
370 Ga0105249_10148031
371 Ga0105246_10124766
372 Ga0157371_10619682
373 Ga0157371_10658736
374 Ga0157369_10296013
375 Ga0157374_10026954
376 Ga0157374_10038488
377 Ga0157374_10795109
378 Ga0157378_10029429
379 Ga0157378_12459336
380 Ga0163162_13473948
381 Ga0157375_10209900
382 Ga0157377_10054439
383 Ga0157377_10874372
384 Ga0157379_11568405
385 Ga0207656_10367306
386 Ga0207682_10001093
387 Ga0207642_10129439
388 Ga0207688_10991952
389 Ga0207643_10509242
390 Ga0207654_10621449
391 Ga0207662_10204366
392 Ga0207657_10138565
393 Ga0207649_11634694
394 Ga0207652_10242754
395 Ga0207681_10064026
396 Ga0207681_10072099
397 Ga0207694_10000424
398 Ga0207650_10233537
399 Ga0207650_10363509
400 Ga0207650_11575568
401 Ga0207659_10965632
402 Ga0207687_10418699
403 Ga0207644_10002917
404 Ga0207644_10018462
405 Ga0207706_10000106
406 Ga0207706_10036311
407 Ga0207706_10039615
408 Ga0207706_10089450
409 Ga0207706_10390924
410 Ga0207706_10669602
411 Ga0207670_10145726
412 Ga0207669_10016762
413 Ga0207704_10648944
414 Ga0207691_10178355
415 Ga0207711_10000639
416 Ga0207689_10419768
417 Ga0207689_10561159
418 Ga0207651_10003199
419 Ga0207651_10257096
420 Ga0207651_11723954
421 Ga0207712_10047846
422 Ga0207712_10365265
423 Ga0207668_10232484
424 Ga0207658_10001050
425 Ga0207677_10022980
426 Ga0207677_10024103
427 Ga0207703_10014570
428 Ga0207703_10073682
429 Ga0207703_10514258
430 Ga0207703_11615811
431 Ga0207678_10005815
432 Ga0207708_10006381
433 Ga0207702_11288154
434 Ga0207641_11599675
435 Ga0207676_10015047
436 Ga0207676_10251116
437 Ga0207674_11203284
438 Ga0207683_10151071
439 Ga0209974_10298145
440 Ga0268265_10213403
441 Ga0268265_11245805
442 Ga0268264_10022616
443 Ga0265330_10045284
444 Ga0265316_10010672
445 Ga0265316_10340022
446 Ga0265314_10108156
447 Ga0307413_10004896
448 Ga0307413_10119767
449 Ga0307413_11246617
450 Ga0307410_10021271
451 Ga0307410_10128540
452 Ga0307410_10689694
453 Ga0307406_10482088
454 Ga0307406_10729731
455 Ga0307406_11337252
456 Ga0307406_12140392
457 Ga0307409_100120843
458 Ga0307409_100749193
459 Ga0307416_100225161
460 Ga0307416_100712058
461 Ga0307416_103593039
462 Ga0307414_10037213
463 Ga0307414_10156368
464 Ga0307414_10558446
465 Ga0307414_11368995
466 Ga0307411_10005534
467 Ga0307411_10051190
468 Ga0307411_10569645
469 Ga0307411_11154539
470 Ga0307415_100091498
471 Ga0373923_0124469
472 Ga0373923_0368197
473 Ga0373939_0262294
474 Ga0373953_0089553
475 Ga0373953_0201343
476 Ga0373954_0074344
477 Ga0373956_0172164
478 Ga0373957_0314141
479 Ga0373943_0055322
480 Ga0373955_0043148
481 Ga0373955_0109479
482 Ga0373942_0115235
483 Ga0373931_0559354
484 Ga0373935_0150509
485 Ga0373933_0051688
486 Ga0373933_0419564
487 Ga0373933_0634521
488 Ga0373937_0041182
489 Ga0373937_0247077
490 Ga0373925_0596082
491 Ga0395905_0015507
492 Ga0436365_0910811
493 Ga0439461_0119911
494 Ga0451795_0184136
495 Ga0451795_1530918
496 Ga0450921_019363
497 Ga0450899_021370
498 Ga0439435_0081339
499 Ga0450918_099560
500 Ga0466961_0013727
501 Ga0451576_0155165
502 Ga0451576_0169033
503 Ga0495629_0268597
504 Ga0495643_0000035
505 Ga0495643_0037089
506 Ga0495586_0119770
507 Ga0495586_0701963
508 Ga0495622_0308261
509 Ga0495668_0008694
510 Ga0495668_0010383
511 Ga0495623_0052231
512 Ga0495613_0565950
513 Ga0495674_0272570
514 Ga0495683_0274952
515 Ga0495602_0076361
516 Ga0495602_0104497
517 Ga0495614_0327739
518 Ga0495615_0302745
519 Ga0496101_0217485
520 Ga0496106_1385087
521 Ga0496107_0190196
522 Ga0496108_1228209
523 Ga0496109_0524681
524 Ga0496114_0294145
525 Ga0496115_0001150
526 Ga0501042_0463062
527 Ga0501067_0765858
528 Ga0501069_0136985
529 Ga0501076_0297085
530 Ga0501249_164692
531 Ga0501257_282069
532 Ga0501081_0868297
533 nmdc:mga05p37_1043571_c1
534 nmdc:mga09592_9821_c2
535 nmdc:mga06r32_795560_c1
536 nmdc:mga08y16_2177256_c1
537 nmdc:mga08y16_337689_c1
538 nmdc:mga0n895_1095324_c1
539 nmdc:mga0rr50_144050_c1
540 nmdc:mga0rr50_1567242_c1
541 nmdc:mga0a205_26222_c1
542 Ga0500566_0475873
543 Ga0500592_002381
544 Ga0500658_0000149
545 Ga0500559_0030875
546 Ga0500559_0289307
547 Ga0590071_007593
548 Ga0530510_0371214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9242 6 62
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.9213 6 62
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9111 4 67
3zkc-assembly1.cif.gz_A crystal structure of the master regulator for biofilm formation sinr in complex with dna. 0.9101 6 60
2cro-assembly1.cif.gz_A structure of phage 434 cro protein at 2.35 angstroms resolution 0.9077 6 59
ID Description Score Start End Superfamily
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9242 6 62 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9213 6 62 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9153 6 62 1.10.260.40
3zkcA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9101 6 60 1.10.260.40
3zkcB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8975 8 62 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A7Z0BWH4-F1-model_v4 Putative transcriptional regulator 0.9923 2 66 GO:0003677
AF-A0A3A0DGK6-F1-model_v4 Transcriptional regulator 0.9907 1 66 GO:0003677
AF-A0A7K2FC68-F1-model_v4 Helix-turn-helix domain-containing protein 0.9907 2 67 GO:0003677
AF-A0A143XVW6-F1-model_v4 Helix-turn-helix protein 0.9887 2 68 GO:0003677
AF-A0A4Q5A9M0-F1-model_v4 Cro/Cl family transcriptional regulator 0.9886 3 67 GO:0003677

Map