F379793

General Info

Members Datasets Scaffolds Average Seq Length
274 163 548 105

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10048021|Ga0207665_100480215
Length 113
Sequence MINDDLKRRIEETLHKDRVMLFMKGSPSMPQCGFSATVVGVLKEVGVPFGSFNILADGEMREGLKEYASWPTFPQLYVDGKLVGGCDIVRAMHARGELQPLLTGKAATKSTGE

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
84 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
85 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
114 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
115 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
119 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 4.01
Rhizosphere 89.42
Stem 0
Stem Tuber 0
Unclassified 10.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10048021 3300025939 Bacteria 2864
2 Ga0006759J45824_1039533 3300003163 Bacteria 889
3 rootH1_10096514 3300003323 Bacteria 1719
4 rootH1_10107329 3300003323 Unclassified 1007
5 rootH1_10217363 3300003323 Bacteria 2530
6 rootH1_10223873 3300003323 Bacteria 2392
7 rootH1_10259764 3300003323 Bacteria 2403
8 Ga0032354_1089281 3300003693 Bacteria 556
9 Ga0058862_11767233 3300004803 Bacteria 609
10 Ga0070658_10018521 3300005327 Bacteria 5574
11 Ga0070683_100293614 3300005329 Unclassified 1546
12 Ga0070683_101077977 3300005329 Bacteria 772
13 Ga0070670_100176341 3300005331 Bacteria 1855
14 Ga0068869_102040898 3300005334 Bacteria 515
15 Ga0070680_100039933 3300005336 Bacteria 3797
16 Ga0070682_100020044 3300005337 Bacteria 3930
17 Ga0070682_100131080 3300005337 Bacteria 1697
18 Ga0070682_101013648 3300005337 Bacteria 690
19 Ga0070660_100290419 3300005339 Bacteria 1339
20 Ga0070689_100000006 3300005340 Bacteria 332562
21 Ga0070687_100020691 3300005343 Bacteria 3081
22 Ga0070688_100230377 3300005365 Bacteria 1310
23 Ga0070688_100386485 3300005365 Bacteria 1033
24 Ga0070659_100405885 3300005366 Bacteria 1151
25 Ga0070709_11052562 3300005434 Bacteria 649
26 Ga0070709_11208173 3300005434 Unclassified 608
27 Ga0070713_100426629 3300005436 Bacteria 1242
28 Ga0070713_100737501 3300005436 Bacteria 942
29 Ga0070710_10275446 3300005437 Bacteria 1090
30 Ga0070710_11048863 3300005437 Bacteria 596
31 Ga0070701_10554793 3300005438 Bacteria 754
32 Ga0070708_101133257 3300005445 Bacteria 732
33 Ga0070685_11023099 3300005466 Bacteria 621
34 Ga0070698_101138266 3300005471 Bacteria 729
35 Ga0070679_100064767 3300005530 Bacteria 3643
36 Ga0070684_100271616 3300005535 Bacteria 1552
37 Ga0070684_100412400 3300005535 Bacteria 1246
38 Ga0068853_100008068 3300005539 Bacteria 8445
39 Ga0070686_100664480 3300005544 Bacteria 828
40 Ga0070693_100498752 3300005547 Bacteria 863
41 Ga0070693_100775401 3300005547 Bacteria 709
42 Ga0070665_102037992 3300005548 Bacteria 579
43 Ga0068855_100009766 3300005563 Bacteria 11576
44 Ga0068855_100573438 3300005563 Unclassified 1219
45 Ga0068857_101283482 3300005577 Bacteria 710
46 Ga0068856_100053263 3300005614 Bacteria 3989
47 Ga0068856_100061818 3300005614 Bacteria 3700
48 Ga0068856_100249857 3300005614 Bacteria 1789
49 Ga0068856_100448551 3300005614 Unclassified 1311
50 Ga0070702_100722087 3300005615 Bacteria 762
51 Ga0068864_100613275 3300005618 Unclassified 1057
52 Ga0068861_100100204 3300005719 Bacteria 2302
53 Ga0068861_100584088 3300005719 Bacteria 1023
54 Ga0068860_100208357 3300005843 Bacteria 1896
55 Ga0075366_10109424 3300006195 Bacteria 1662
56 Ga0097621_101634211 3300006237 Bacteria 613
57 Ga0105240_10000967 3300009093 Bacteria 51131
58 Ga0111539_10537426 3300009094 Bacteria 1362
59 Ga0111539_12528388 3300009094 Bacteria 595
60 Ga0105245_10876022 3300009098 Unclassified 939
61 Ga0105241_10296908 3300009174 Bacteria 1385
62 Ga0105237_10000259 3300009545 Bacteria 74958
63 Ga0105237_10159841 3300009545 Bacteria 2251
64 Ga0105237_11963921 3300009545 Bacteria 593
65 Ga0105238_10003593 3300009551 Bacteria 15458
66 Ga0105238_10087801 3300009551 Bacteria 3096
67 Ga0105238_11734574 3300009551 Bacteria 656
68 Ga0105239_10034152 3300010375 Bacteria 5584
69 Ga0105239_10535779 3300010375 Bacteria 1333
70 Ga0105239_12682506 3300010375 Bacteria 581
71 Ga0157374_12083190 3300013296 Bacteria 594
72 Ga0157374_12538857 3300013296 Bacteria 540
73 Ga0157374_12986103 3300013296 Unclassified 500
74 Ga0163163_12228524 3300014325 Bacteria 607
75 Ga0157379_11719512 3300014968 Bacteria 615
76 Ga0157376_11113306 3300014969 Bacteria 816
77 Ga0213876_10513546 3300021384 Bacteria 638
78 Ga0207697_10181696 3300025315 Bacteria 922
79 Ga0207699_10761277 3300025906 Bacteria 711
80 Ga0207699_10981107 3300025906 Unclassified 624
81 Ga0207705_10010212 3300025909 Bacteria 6830
82 Ga0207654_10297124 3300025911 Bacteria 1097
83 Ga0207695_10002338 3300025913 Bacteria 28197
84 Ga0207695_11247912 3300025913 Bacteria 623
85 Ga0207671_10001870 3300025914 Bacteria 23421
86 Ga0207671_10137842 3300025914 Bacteria 1877
87 Ga0207660_10054600 3300025917 Bacteria 2852
88 Ga0207662_10038377 3300025918 Bacteria 2806
89 Ga0207657_10246457 3300025919 Bacteria 1425
90 Ga0207652_10005551 3300025921 Bacteria 10225
91 Ga0207652_10007417 3300025921 Bacteria 8842
92 Ga0207694_10008061 3300025924 Bacteria 7967
93 Ga0207694_10923224 3300025924 Bacteria 738
94 Ga0207694_11317332 3300025924 Unclassified 611
95 Ga0207650_10160704 3300025925 Bacteria 1780
96 Ga0207687_11243524 3300025927 Unclassified 640
97 Ga0207700_10267557 3300025928 Bacteria 1466
98 Ga0207700_11732064 3300025928 Unclassified 551
99 Ga0207690_10266990 3300025932 Bacteria 1328
100 Ga0207670_10000003 3300025936 Bacteria 760449
101 Ga0207689_11329495 3300025942 Bacteria 603
102 Ga0207661_10073333 3300025944 Bacteria 2803
103 Ga0207661_10248284 3300025944 Bacteria 1581
104 Ga0207661_10610837 3300025944 Bacteria 1001
105 Ga0207667_10138672 3300025949 Bacteria 2504
106 Ga0207667_10470160 3300025949 Bacteria 1277
107 Ga0207667_10644688 3300025949 Bacteria 1065
108 Ga0207677_11517290 3300026023 Bacteria 619
109 Ga0207639_10084749 3300026041 Bacteria 2518
110 Ga0207702_10042221 3300026078 Bacteria 3826
111 Ga0207702_10316610 3300026078 Bacteria 1485
112 Ga0207702_10478152 3300026078 Unclassified 1212
113 Ga0207641_12332735 3300026088 Bacteria 534
114 Ga0207676_10721242 3300026095 Bacteria 968
115 Ga0207676_12034023 3300026095 Bacteria 573
116 Ga0207674_10637969 3300026116 Unclassified 1029
117 Ga0207674_10762266 3300026116 Bacteria 934
118 Ga0207674_11255906 3300026116 Bacteria 710
119 Ga0207675_100185621 3300026118 Bacteria 1993
120 Ga0268264_10865725 3300028381 Bacteria 905
121 Ga0265319_1012072 3300028563 Bacteria 3507
122 Ga0265319_1084853 3300028563 Bacteria 1003
123 Ga0265334_10047515 3300028573 Bacteria 1656
124 Ga0265334_10057792 3300028573 Bacteria 1469
125 Ga0265334_10082789 3300028573 Bacteria 1180
126 Ga0265318_10000030 3300028577 Bacteria 146681
127 Ga0265318_10000130 3300028577 Bacteria 69319
128 Ga0265318_10096330 3300028577 Bacteria 1089
129 Ga0265318_10295548 3300028577 Bacteria 591
130 Ga0265336_10016860 3300028666 Bacteria 2384
131 Ga0265336_10045711 3300028666 Bacteria 1331
132 Ga0265338_10010471 3300028800 Bacteria 10861
133 Ga0265338_10880999 3300028800 Bacteria 610
134 Ga0265330_10000105 3300031235 Bacteria 69914
135 Ga0265330_10000906 3300031235 Bacteria 18293
136 Ga0265332_10001456 3300031238 Bacteria 13266
137 Ga0265332_10003316 3300031238 Bacteria 7813
138 Ga0265332_10021318 3300031238 Bacteria 2863
139 Ga0265328_10001404 3300031239 Bacteria 11081
140 Ga0265328_10010727 3300031239 Bacteria 3680
141 Ga0265328_10014156 3300031239 Bacteria 3145
142 Ga0265320_10000017 3300031240 Bacteria 196688
143 Ga0265320_10001759 3300031240 Bacteria 15351
144 Ga0265320_10019621 3300031240 Bacteria 3691
145 Ga0265320_10355275 3300031240 Bacteria 647
146 Ga0265325_10028028 3300031241 Bacteria 3040
147 Ga0265329_10001047 3300031242 Bacteria 13713
148 Ga0265329_10004533 3300031242 Bacteria 5761
149 Ga0265329_10018157 3300031242 Bacteria 2409
150 Ga0265340_10070340 3300031247 Bacteria 1660
151 Ga0265340_10203455 3300031247 Bacteria 890
152 Ga0265339_10001341 3300031249 Bacteria 18413
153 Ga0265339_10003593 3300031249 Bacteria 10828
154 Ga0265339_10006882 3300031249 Bacteria 7408
155 Ga0265339_10008705 3300031249 Bacteria 6437
156 Ga0265339_10144344 3300031249 Bacteria 1208
157 Ga0265331_10000027 3300031250 Bacteria 220058
158 Ga0265331_10002108 3300031250 Bacteria 13711
159 Ga0265331_10567727 3300031250 Bacteria 512
160 Ga0265316_10002612 3300031344 Bacteria 18574
161 Ga0265316_10021122 3300031344 Bacteria 5524
162 Ga0307513_11108559 3300031456 Unclassified 504
163 Ga0307408_102495646 3300031548 Bacteria 503
164 Ga0265313_10000236 3300031595 Bacteria 59962
165 Ga0265313_10015617 3300031595 Bacteria 4408
166 Ga0265313_10016378 3300031595 Bacteria 4263
167 Ga0265313_10072819 3300031595 Bacteria 1578
168 Ga0265313_10080300 3300031595 Bacteria 1482
169 Ga0265314_10000069 3300031711 Bacteria 153728
170 Ga0265314_10019004 3300031711 Bacteria 5332
171 Ga0265314_10034212 3300031711 Bacteria 3717
172 Ga0265314_10084057 3300031711 Bacteria 2090
173 Ga0265342_10000119 3300031712 Bacteria 87664
174 Ga0265342_10000731 3300031712 Bacteria 33812
175 Ga0265342_10012374 3300031712 Bacteria 5783
176 Ga0265342_10145453 3300031712 Bacteria 1320
177 Ga0265342_10173340 3300031712 Bacteria 1185
178 Ga0316576_10949208 3300031727 Bacteria 614
179 Ga0373950_0000001 3300034818 Bacteria 1001987
180 Ga0373950_0000049 3300034818 Bacteria 87604
181 Ga0373950_0078494 3300034818 Unclassified 686
182 Ga0373934_0028918 3300035086 Bacteria 2162
183 Ga0373923_0112776 3300035111 Bacteria 1209
184 Ga0373954_0017720 3300035118 Bacteria 3201
185 Ga0373954_0228957 3300035118 Bacteria 915
186 Ga0373956_0006492 3300035119 Bacteria 4687
187 Ga0373956_0022351 3300035119 Bacteria 2706
188 Ga0373957_0111652 3300035120 Unclassified 1101
189 Ga0373957_0228012 3300035120 Bacteria 781
190 Ga0373955_0088848 3300035172 Bacteria 1758
191 Ga0373955_0400149 3300035172 Bacteria 834
192 Ga0373924_0278845 3300035410 Bacteria 741
193 Ga0373935_1237432 3300035692 Bacteria 557
194 Ga0373927_0241247 3300035695 Unclassified 1188
195 Ga0373933_0000220 3300035724 Bacteria 37921
196 Ga0373933_0009962 3300035724 Bacteria 5202
197 Ga0373933_0240551 3300035724 Bacteria 1164
198 Ga0373947_0606128 3300035725 Bacteria 746
199 Ga0373937_0014858 3300036401 Bacteria 6876
200 Ga0373937_0061734 3300036401 Bacteria 3445
201 Ga0373937_0068283 3300036401 Bacteria 3277
202 Ga0373937_0613785 3300036401 Bacteria 1032
203 Ga0373937_0995440 3300036401 Bacteria 787
204 Ga0436365_0688872 3300039437 Unclassified 735
205 Ga0439461_0123764 3300041410 Bacteria 649
206 Ga0451797_1594317 3300041453 Unclassified 566
207 Ga0451802_1064219 3300041460 Bacteria 582
208 Ga0451802_1212469 3300041460 Unclassified 846
209 Ga0451807_0221164 3300041486 Bacteria 3643
210 Ga0451807_1225546 3300041486 Unclassified 587
211 Ga0451837_0448329 3300041494 Unclassified 850
212 Ga0451849_0661997 3300041505 Eukaryota 529
213 Ga0451851_0346919 3300041507 Bacteria 3977
214 Ga0451853_0882243 3300041512 Bacteria 8739
215 Ga0451853_3154175 3300041512 Bacteria 940
216 Ga0451853_3838823 3300041512 Bacteria 648
217 Ga0439445_0208782 3300042004 Bacteria 578
218 Ga0451577_1258270 3300042876 Bacteria 659
219 Ga0466971_0030836 3300044719 Bacteria 2400
220 Ga0451576_0466280 3300045051 Bacteria 1326
221 Ga0495641_0586595 3300046461 Bacteria 509
222 Ga0495630_1232970 3300046517 Bacteria 565
223 Ga0495632_0506975 3300046519 Bacteria 520
224 Ga0495668_0591839 3300046616 Bacteria 613
225 Ga0495680_0080131 3300047322 Bacteria 2468
226 Ga0496104_1732991 3300048907 Bacteria 527
227 Ga0496105_0180678 3300048908 Unclassified 1728
228 Ga0496110_0719132 3300048913 Bacteria 901
229 Ga0496111_0175758 3300048914 Bacteria 1592
230 Ga0496114_0048458 3300048917 Bacteria 3534
231 Ga0496115_0632146 3300048918 Bacteria 848
232 Ga0501032_0082557 3300049569 Bacteria 2138
233 Ga0501034_0000354 3300049571 Bacteria 78713
234 Ga0501036_0070799 3300049572 Bacteria 2949
235 Ga0501036_0185233 3300049572 Bacteria 1752
236 Ga0501038_0380032 3300049574 Bacteria 1096
237 Ga0501042_0465754 3300049578 Bacteria 917
238 Ga0501043_0002103 3300049579 Bacteria 17005
239 Ga0501046_0000960 3300049580 Bacteria 28234
240 Ga0501047_0000001 3300049581 Bacteria 658799
241 Ga0501048_0001331 3300049582 Bacteria 18722
242 Ga0501067_0000077 3300049583 Bacteria 56354
243 Ga0501067_0040841 3300049583 Unclassified 2576
244 Ga0501067_0058553 3300049583 Bacteria 2133
245 Ga0501067_0666167 3300049583 Bacteria 584
246 Ga0501068_0005036 3300049584 Bacteria 7196
247 Ga0501068_0220299 3300049584 Bacteria 1206
248 Ga0501068_0617355 3300049584 Unclassified 707
249 Ga0501069_0021928 3300049585 Bacteria 3470
250 Ga0501070_0001313 3300049586 Bacteria 22270
251 Ga0501070_0729166 3300049586 Bacteria 782
252 Ga0501071_0090542 3300049587 Bacteria 2246
253 Ga0501072_0000019 3300049588 Bacteria 158156
254 Ga0501073_0015469 3300049589 Bacteria 5535
255 Ga0501073_0021840 3300049589 Bacteria 4611
256 Ga0501074_0000342 3300049590 Bacteria 27192
257 Ga0501074_0396834 3300049590 Bacteria 978
258 Ga0501075_0129438 3300049591 Unclassified 1923
259 Ga0501077_0495966 3300049593 Unclassified 783
260 Ga0501079_0004809 3300049741 Bacteria 10005
261 Ga0501080_0015048 3300049742 Bacteria 7128
262 Ga0501080_0257756 3300049742 Bacteria 1589
263 Ga0501080_0553507 3300049742 Bacteria 1024
264 Ga0501083_0005049 3300049744 Bacteria 9348
265 Ga0501045_0767690 3300049824 Bacteria 710
266 nmdc:mga0k408_255108_c1 3300050493 Bacteria 1047
267 nmdc:mga0k408_262220_c1 3300050493 Bacteria 1032
268 nmdc:mga0k408_75535_c1 3300050493 Bacteria 1969
269 Ga0501084_0000509 3300054114 Bacteria 29788
270 Ga0590071_131148 3300059421 Bacteria 644
271 Ga0590077_005705 3300059426 Bacteria 2546
272 Ga0590077_035239 3300059426 Bacteria 1102
273 Ga0501082_0068568 3300060353 Bacteria 3053
274 Ga0501082_0231381 3300060353 Bacteria 1608
275 Ga0207665_10048021
276 Ga0006759J45824_1039533
277 rootH1_10096514
278 rootH1_10107329
279 rootH1_10217363
280 rootH1_10223873
281 rootH1_10259764
282 Ga0032354_1089281
283 Ga0058862_11767233
284 Ga0070658_10018521
285 Ga0070683_100293614
286 Ga0070683_101077977
287 Ga0070670_100176341
288 Ga0068869_102040898
289 Ga0070680_100039933
290 Ga0070682_100020044
291 Ga0070682_100131080
292 Ga0070682_101013648
293 Ga0070660_100290419
294 Ga0070689_100000006
295 Ga0070687_100020691
296 Ga0070688_100230377
297 Ga0070688_100386485
298 Ga0070659_100405885
299 Ga0070709_11052562
300 Ga0070709_11208173
301 Ga0070713_100426629
302 Ga0070713_100737501
303 Ga0070710_10275446
304 Ga0070710_11048863
305 Ga0070701_10554793
306 Ga0070708_101133257
307 Ga0070685_11023099
308 Ga0070698_101138266
309 Ga0070679_100064767
310 Ga0070684_100271616
311 Ga0070684_100412400
312 Ga0068853_100008068
313 Ga0070686_100664480
314 Ga0070693_100498752
315 Ga0070693_100775401
316 Ga0070665_102037992
317 Ga0068855_100009766
318 Ga0068855_100573438
319 Ga0068857_101283482
320 Ga0068856_100053263
321 Ga0068856_100061818
322 Ga0068856_100249857
323 Ga0068856_100448551
324 Ga0070702_100722087
325 Ga0068864_100613275
326 Ga0068861_100100204
327 Ga0068861_100584088
328 Ga0068860_100208357
329 Ga0075366_10109424
330 Ga0097621_101634211
331 Ga0105240_10000967
332 Ga0111539_10537426
333 Ga0111539_12528388
334 Ga0105245_10876022
335 Ga0105241_10296908
336 Ga0105237_10000259
337 Ga0105237_10159841
338 Ga0105237_11963921
339 Ga0105238_10003593
340 Ga0105238_10087801
341 Ga0105238_11734574
342 Ga0105239_10034152
343 Ga0105239_10535779
344 Ga0105239_12682506
345 Ga0157374_12083190
346 Ga0157374_12538857
347 Ga0157374_12986103
348 Ga0163163_12228524
349 Ga0157379_11719512
350 Ga0157376_11113306
351 Ga0213876_10513546
352 Ga0207697_10181696
353 Ga0207699_10761277
354 Ga0207699_10981107
355 Ga0207705_10010212
356 Ga0207654_10297124
357 Ga0207695_10002338
358 Ga0207695_11247912
359 Ga0207671_10001870
360 Ga0207671_10137842
361 Ga0207660_10054600
362 Ga0207662_10038377
363 Ga0207657_10246457
364 Ga0207652_10005551
365 Ga0207652_10007417
366 Ga0207694_10008061
367 Ga0207694_10923224
368 Ga0207694_11317332
369 Ga0207650_10160704
370 Ga0207687_11243524
371 Ga0207700_10267557
372 Ga0207700_11732064
373 Ga0207690_10266990
374 Ga0207670_10000003
375 Ga0207689_11329495
376 Ga0207661_10073333
377 Ga0207661_10248284
378 Ga0207661_10610837
379 Ga0207667_10138672
380 Ga0207667_10470160
381 Ga0207667_10644688
382 Ga0207677_11517290
383 Ga0207639_10084749
384 Ga0207702_10042221
385 Ga0207702_10316610
386 Ga0207702_10478152
387 Ga0207641_12332735
388 Ga0207676_10721242
389 Ga0207676_12034023
390 Ga0207674_10637969
391 Ga0207674_10762266
392 Ga0207674_11255906
393 Ga0207675_100185621
394 Ga0268264_10865725
395 Ga0265319_1012072
396 Ga0265319_1084853
397 Ga0265334_10047515
398 Ga0265334_10057792
399 Ga0265334_10082789
400 Ga0265318_10000030
401 Ga0265318_10000130
402 Ga0265318_10096330
403 Ga0265318_10295548
404 Ga0265336_10016860
405 Ga0265336_10045711
406 Ga0265338_10010471
407 Ga0265338_10880999
408 Ga0265330_10000105
409 Ga0265330_10000906
410 Ga0265332_10001456
411 Ga0265332_10003316
412 Ga0265332_10021318
413 Ga0265328_10001404
414 Ga0265328_10010727
415 Ga0265328_10014156
416 Ga0265320_10000017
417 Ga0265320_10001759
418 Ga0265320_10019621
419 Ga0265320_10355275
420 Ga0265325_10028028
421 Ga0265329_10001047
422 Ga0265329_10004533
423 Ga0265329_10018157
424 Ga0265340_10070340
425 Ga0265340_10203455
426 Ga0265339_10001341
427 Ga0265339_10003593
428 Ga0265339_10006882
429 Ga0265339_10008705
430 Ga0265339_10144344
431 Ga0265331_10000027
432 Ga0265331_10002108
433 Ga0265331_10567727
434 Ga0265316_10002612
435 Ga0265316_10021122
436 Ga0307513_11108559
437 Ga0307408_102495646
438 Ga0265313_10000236
439 Ga0265313_10015617
440 Ga0265313_10016378
441 Ga0265313_10072819
442 Ga0265313_10080300
443 Ga0265314_10000069
444 Ga0265314_10019004
445 Ga0265314_10034212
446 Ga0265314_10084057
447 Ga0265342_10000119
448 Ga0265342_10000731
449 Ga0265342_10012374
450 Ga0265342_10145453
451 Ga0265342_10173340
452 Ga0316576_10949208
453 Ga0373950_0000001
454 Ga0373950_0000049
455 Ga0373950_0078494
456 Ga0373934_0028918
457 Ga0373923_0112776
458 Ga0373954_0017720
459 Ga0373954_0228957
460 Ga0373956_0006492
461 Ga0373956_0022351
462 Ga0373957_0111652
463 Ga0373957_0228012
464 Ga0373955_0088848
465 Ga0373955_0400149
466 Ga0373924_0278845
467 Ga0373935_1237432
468 Ga0373927_0241247
469 Ga0373933_0000220
470 Ga0373933_0009962
471 Ga0373933_0240551
472 Ga0373947_0606128
473 Ga0373937_0014858
474 Ga0373937_0061734
475 Ga0373937_0068283
476 Ga0373937_0613785
477 Ga0373937_0995440
478 Ga0436365_0688872
479 Ga0439461_0123764
480 Ga0451797_1594317
481 Ga0451802_1064219
482 Ga0451802_1212469
483 Ga0451807_0221164
484 Ga0451807_1225546
485 Ga0451837_0448329
486 Ga0451849_0661997
487 Ga0451851_0346919
488 Ga0451853_0882243
489 Ga0451853_3154175
490 Ga0451853_3838823
491 Ga0439445_0208782
492 Ga0451577_1258270
493 Ga0466971_0030836
494 Ga0451576_0466280
495 Ga0495641_0586595
496 Ga0495630_1232970
497 Ga0495632_0506975
498 Ga0495668_0591839
499 Ga0495680_0080131
500 Ga0496104_1732991
501 Ga0496105_0180678
502 Ga0496110_0719132
503 Ga0496111_0175758
504 Ga0496114_0048458
505 Ga0496115_0632146
506 Ga0501032_0082557
507 Ga0501034_0000354
508 Ga0501036_0070799
509 Ga0501036_0185233
510 Ga0501038_0380032
511 Ga0501042_0465754
512 Ga0501043_0002103
513 Ga0501046_0000960
514 Ga0501047_0000001
515 Ga0501048_0001331
516 Ga0501067_0000077
517 Ga0501067_0040841
518 Ga0501067_0058553
519 Ga0501067_0666167
520 Ga0501068_0005036
521 Ga0501068_0220299
522 Ga0501068_0617355
523 Ga0501069_0021928
524 Ga0501070_0001313
525 Ga0501070_0729166
526 Ga0501071_0090542
527 Ga0501072_0000019
528 Ga0501073_0015469
529 Ga0501073_0021840
530 Ga0501074_0000342
531 Ga0501074_0396834
532 Ga0501075_0129438
533 Ga0501077_0495966
534 Ga0501079_0004809
535 Ga0501080_0015048
536 Ga0501080_0257756
537 Ga0501080_0553507
538 Ga0501083_0005049
539 Ga0501045_0767690
540 nmdc:mga0k408_255108_c1
541 nmdc:mga0k408_262220_c1
542 nmdc:mga0k408_75535_c1
543 Ga0501084_0000509
544 Ga0590071_131148
545 Ga0590077_005705
546 Ga0590077_035239
547 Ga0501082_0068568
548 Ga0501082_0231381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

19

83

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zyw-assembly1.cif.gz_A crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) 0.9803 6 101
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9765 2 103
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9632 8 103
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.9624 3 103
2wci-assembly1.cif.gz_A structure of e. coli monothiol glutaredoxin grx4 homodimer 0.9571 3 103
ID Description Score Start End Superfamily
af_C6KSR7_119_214_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9978 10 101 3.40.30.10
af_A0A1D6ETY4_422_499_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9945 10 85 3.40.30.10
af_Q8IBZ7_179_272_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9868 11 101 3.40.30.10
af_B6TEC7_84_191_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9812 10 103 3.40.30.10
af_Q4CNA8_28_125_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.981 10 103 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A067G8M8-F1-model_v4 Glutaredoxin domain-containing protein 1.001 5 100 GO:0005634
GO:0005829
GO:0006879
GO:0046872
GO:0051536
AF-A0A2S5R981-F1-model_v4 Glutaredoxin-4 1.001 5 102 GO:0005829
GO:0006879
GO:0046872
GO:0051536
AF-A0A388LK74-F1-model_v4 Thioredoxin domain-containing protein 0.9998 6 102 GO:0005634
GO:0005829
GO:0006879
GO:0046872
GO:0051536
AF-A0A5B7B1T2-F1-model_v4 Glutaredoxin domain-containing protein 0.9988 4 100 GO:0005634
GO:0005829
GO:0006879
GO:0046872
GO:0051536
AF-A0A540KA72-F1-model_v4 Thioredoxin domain-containing protein 0.9987 4 100 GO:0005634
GO:0005829
GO:0006879
GO:0046872
GO:0051536

Map