F379704

General Info

Members Datasets Scaffolds Average Seq Length
274 173 548 301

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10086405|Ga0105249_100864053
Length 321
Sequence VFGRRLSVCRANEEHDVKLGFLTAPFPETPLLRLADWATAAGLEAVEIACWPRSSGSTRRYAGTSHVDVAAISSSEAKEIAAALGERNLAISALGYYPNPLHPDAEHRETVIAHLKQVIEGAALLEVPIVGTFIGKDKNKTVPQNLEDYAQVWPPIVKFAKEHGIKIAIENCPMIFSWDEWPGGNNLAVNPAIWRRMWEIIPDDNFGLNLDPSHLIWQMIDYERVIREFADKLFHVHAKDLHVDHDGLYNNGALSLGMGWQVPRLPGRGDVDWGKFFAALSDVGYDYVVSIEHEDRDYEGDEELVKKGFYLSRDVLKPLMN

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
129 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
168 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
171 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
172 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
173 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 1.09
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.36
Rhizoplane 3.65
Rhizosphere 94.89
Stem 0
Stem Tuber 0
Unclassified 6.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10086405 3300009553 Bacteria 2925
2 JGI24742J22300_10001670 3300002244 Bacteria 3531
3 JGI25407J50210_10033231 3300003373 Bacteria 1332
4 Ga0070690_100023304 3300005330 Bacteria 3796
5 Ga0070680_100021427 3300005336 Bacteria 5138
6 Ga0070682_100011021 3300005337 Bacteria 5155
7 Ga0070682_100040243 3300005337 Bacteria 2876
8 Ga0070660_100146657 3300005339 Bacteria 1896
9 Ga0070689_100146879 3300005340 Bacteria 1900
10 Ga0070691_10014512 3300005341 Bacteria 3616
11 Ga0070671_100026145 3300005355 Bacteria 4795
12 Ga0070674_100004618 3300005356 Bacteria 7871
13 Ga0070673_100121875 3300005364 Bacteria 2177
14 Ga0070659_100033003 3300005366 Bacteria 4020
15 Ga0070667_100115040 3300005367 Bacteria 2336
16 Ga0070703_10079033 3300005406 Bacteria 1116
17 Ga0070714_100284774 3300005435 Bacteria 1536
18 Ga0070710_10001148 3300005437 Bacteria 12560
19 Ga0070701_10002723 3300005438 Bacteria 6853
20 Ga0070711_100001447 3300005439 Bacteria 13055
21 Ga0070705_100030869 3300005440 Bacteria 2962
22 Ga0070700_100008887 3300005441 Bacteria 5494
23 Ga0070694_100052751 3300005444 Bacteria 2750
24 Ga0070678_100004008 3300005456 Bacteria 8285
25 Ga0070662_100039641 3300005457 Bacteria 3350
26 Ga0070662_100456092 3300005457 Bacteria 1062
27 Ga0068867_100011045 3300005459 Bacteria 6369
28 Ga0070706_100000214 3300005467 Bacteria 71440
29 Ga0070706_100477600 3300005467 Bacteria 1160
30 Ga0070707_100017554 3300005468 Bacteria 6730
31 Ga0070698_100065814 3300005471 Bacteria 3649
32 Ga0070699_100006280 3300005518 Bacteria 10369
33 Ga0070699_100258660 3300005518 Unclassified 1556
34 Ga0070679_100026219 3300005530 Bacteria 5721
35 Ga0070684_100216190 3300005535 Unclassified 1748
36 Ga0070684_100298113 3300005535 Bacteria 1479
37 Ga0068853_100179440 3300005539 Bacteria 1920
38 Ga0070672_100301763 3300005543 Bacteria 1358
39 Ga0070686_100001639 3300005544 Bacteria 12515
40 Ga0070695_100050765 3300005545 Bacteria 2659
41 Ga0070695_100137996 3300005545 Unclassified 1687
42 Ga0070696_100003111 3300005546 Bacteria 11040
43 Ga0070693_100096418 3300005547 Bacteria 1793
44 Ga0070704_100118503 3300005549 Unclassified 2028
45 Ga0070704_100190188 3300005549 Bacteria 1649
46 Ga0068855_100543176 3300005563 Bacteria 1259
47 Ga0068856_100088245 3300005614 Bacteria 3084
48 Ga0068852_100431491 3300005616 Bacteria 1301
49 Ga0068859_100034272 3300005617 Bacteria 5096
50 Ga0068859_100102681 3300005617 Bacteria 2917
51 Ga0068859_100466632 3300005617 Unclassified 1358
52 Ga0068866_10001168 3300005718 Bacteria 11510
53 Ga0068858_100229984 3300005842 Unclassified 1758
54 Ga0068860_100139880 3300005843 Bacteria 2326
55 Ga0068862_100068086 3300005844 Bacteria 3070
56 Ga0081455_10100338 3300005937 Bacteria 2326
57 Ga0081538_10003624 3300005981 Bacteria 14514
58 Ga0081538_10045360 3300005981 Bacteria 2726
59 Ga0081538_10048090 3300005981 Bacteria 2607
60 Ga0081538_10117742 3300005981 Bacteria 1285
61 Ga0081539_10002686 3300005985 Bacteria 24187
62 Ga0070716_100064368 3300006173 Bacteria 2132
63 Ga0070712_100095603 3300006175 Bacteria 2186
64 Ga0068871_100074899 3300006358 Bacteria 2794
65 Ga0075430_100046698 3300006846 Bacteria 3658
66 Ga0075430_100182930 3300006846 Bacteria 1743
67 Ga0075430_100186241 3300006846 Bacteria 1726
68 Ga0075431_100058016 3300006847 Unclassified 3993
69 Ga0075433_10417491 3300006852 Unclassified 1183
70 Ga0075434_100049564 3300006871 Bacteria 4170
71 Ga0075429_100059147 3300006880 Bacteria 3338
72 Ga0075429_100120356 3300006880 Bacteria 2294
73 Ga0068865_100002147 3300006881 Bacteria 11641
74 Ga0075436_100031137 3300006914 Bacteria 3672
75 Ga0097620_100034272 3300006931 Bacteria 5096
76 Ga0097620_100102685 3300006931 Bacteria 2917
77 Ga0097620_100466688 3300006931 Unclassified 1358
78 Ga0111539_10038845 3300009094 Bacteria 5742
79 Ga0105245_10006585 3300009098 Bacteria 10199
80 Ga0114129_10024016 3300009147 Bacteria 8640
81 Ga0114129_10029950 3300009147 Bacteria 7707
82 Ga0114129_10070072 3300009147 Bacteria 4888
83 Ga0114129_10942149 3300009147 Bacteria 1091
84 Ga0105243_10016924 3300009148 Bacteria 5513
85 Ga0105242_10003997 3300009176 Bacteria 11461
86 Ga0105242_10429950 3300009176 Bacteria 1239
87 Ga0105238_10177290 3300009551 Bacteria 2108
88 Ga0105249_10003093 3300009553 Bacteria 14364
89 Ga0105249_10034559 3300009553 Bacteria 4582
90 Ga0105249_10243833 3300009553 Bacteria 1778
91 Ga0105239_10007055 3300010375 Bacteria 12931
92 Ga0105246_10304907 3300011119 Bacteria 1287
93 Ga0157371_10087222 3300013102 Bacteria 2210
94 Ga0157374_10210310 3300013296 Bacteria 1907
95 Ga0157378_10003888 3300013297 Bacteria 13228
96 Ga0163162_10005631 3300013306 Bacteria 12104
97 Ga0157380_10160458 3300014326 Bacteria 1954
98 Ga0157380_10215555 3300014326 Bacteria 1714
99 Ga0157380_10559778 3300014326 Bacteria 1123
100 Ga0157377_10001204 3300014745 Bacteria 11015
101 Ga0157376_10132412 3300014969 Bacteria 2227
102 Ga0206353_11155122 3300020082 Bacteria 1387
103 Ga0207653_10006901 3300025885 Bacteria 3541
104 Ga0207692_10001561 3300025898 Bacteria 8618
105 Ga0207684_10000074 3300025910 Bacteria 183469
106 Ga0207693_10150989 3300025915 Bacteria 1827
107 Ga0207663_10093382 3300025916 Bacteria 2002
108 Ga0207660_10050849 3300025917 Bacteria 2944
109 Ga0207657_10163323 3300025919 Bacteria 1808
110 Ga0207646_10000153 3300025922 Bacteria 94476
111 Ga0207646_10211352 3300025922 Bacteria 1752
112 Ga0207687_10021119 3300025927 Bacteria 4322
113 Ga0207706_10021077 3300025933 Bacteria 5854
114 Ga0207686_10001590 3300025934 Bacteria 12741
115 Ga0207709_10001700 3300025935 Bacteria 14819
116 Ga0207670_10022447 3300025936 Bacteria 3912
117 Ga0207670_10120574 3300025936 Bacteria 1906
118 Ga0207670_10150864 3300025936 Bacteria 1724
119 Ga0207704_10001464 3300025938 Bacteria 10555
120 Ga0207691_10019009 3300025940 Bacteria 6507
121 Ga0207651_10158764 3300025960 Bacteria 1770
122 Ga0207712_10016997 3300025961 Bacteria 4719
123 Ga0207677_10034577 3300026023 Bacteria 3274
124 Ga0207703_10164986 3300026035 Unclassified 1943
125 Ga0207703_10315053 3300026035 Bacteria 1431
126 Ga0207708_10002337 3300026075 Bacteria 13923
127 Ga0207702_10046545 3300026078 Bacteria 3652
128 Ga0207648_10005972 3300026089 Bacteria 12172
129 Ga0207674_10089572 3300026116 Unclassified 3069
130 Ga0207675_100105084 3300026118 Bacteria 2661
131 Ga0207683_10004666 3300026121 Bacteria 11816
132 Ga0209588_1000137 3300027671 Bacteria 21215
133 Ga0207428_10144788 3300027907 Bacteria 1812
134 Ga0268265_10038819 3300028380 Bacteria 3505
135 Ga0268265_10120454 3300028380 Bacteria 2161
136 Ga0268265_10142745 3300028380 Unclassified 2007
137 Ga0307408_100120225 3300031548 Bacteria 2034
138 Ga0307408_100234520 3300031548 Bacteria 1505
139 Ga0316579_10008767 3300031691 Bacteria 4229
140 Ga0307410_10054744 3300031852 Unclassified 2706
141 Ga0307406_10028510 3300031901 Bacteria 3374
142 Ga0307416_100293250 3300032002 Bacteria 1612
143 Ga0307416_100475099 3300032002 Bacteria 1309
144 Ga0307415_100051399 3300032126 Bacteria 2797
145 Ga0395898_0271844 3300037466 Bacteria 1616
146 Ga0395901_0579007 3300038443 Unclassified 1134
147 Ga0450918_013253 3300042531 Bacteria 1435
148 Ga0451577_0002166 3300042876 Bacteria 24011
149 Ga0453684_0001420 3300044712 Bacteria 68969
150 Ga0453684_0002604 3300044712 Bacteria 43124
151 Ga0453684_0003486 3300044712 Bacteria 35332
152 Ga0453684_0025592 3300044712 Bacteria 8563
153 Ga0453684_0103205 3300044712 Bacteria 3485
154 Ga0453684_0405466 3300044712 Bacteria 1526
155 Ga0451576_0018435 3300045051 Bacteria 7651
156 Ga0451576_0024189 3300045051 Bacteria 6563
157 Ga0451576_0470885 3300045051 Bacteria 1319
158 Ga0495634_0202907 3300046642 Bacteria 1231
159 Ga0496100_0034632 3300048903 Bacteria 3170
160 Ga0496101_0001216 3300048904 Bacteria 15405
161 Ga0496103_0001835 3300048906 Bacteria 13808
162 Ga0496106_0079822 3300048909 Bacteria 2512
163 Ga0496107_0026705 3300048910 Bacteria 4095
164 Ga0496108_0018281 3300048911 Bacteria 5739
165 Ga0496112_0026400 3300048915 Bacteria 5587
166 Ga0496113_0014420 3300048916 Bacteria 5391
167 Ga0496114_0005529 3300048917 Bacteria 9899
168 Ga0496115_0003300 3300048918 Bacteria 11587
169 Ga0496123_0008991 3300048926 Bacteria 9067
170 Ga0501305_005170 3300049161 Bacteria 1569
171 Ga0501312_005173 3300049528 Bacteria 1574
172 Ga0501031_0009658 3300049568 Bacteria 6281
173 Ga0501031_0033236 3300049568 Bacteria 3363
174 Ga0501033_0016177 3300049570 Bacteria 5649
175 Ga0501034_0347622 3300049571 Bacteria 1412
176 Ga0501036_0003011 3300049572 Bacteria 13412
177 Ga0501036_0111479 3300049572 Bacteria 2312
178 Ga0501036_0203214 3300049572 Bacteria 1666
179 Ga0501038_0037286 3300049574 Bacteria 4263
180 Ga0501039_0005945 3300049575 Bacteria 9246
181 Ga0501039_0028849 3300049575 Bacteria 4274
182 Ga0501039_0058649 3300049575 Bacteria 2982
183 Ga0501040_0005696 3300049576 Bacteria 8055
184 Ga0501040_0070520 3300049576 Bacteria 2412
185 Ga0501041_0002787 3300049577 Bacteria 9975
186 Ga0501041_0048144 3300049577 Bacteria 2596
187 Ga0501041_0060012 3300049577 Bacteria 2328
188 Ga0501041_0072783 3300049577 Bacteria 2112
189 Ga0501041_0090069 3300049577 Bacteria 1894
190 Ga0501042_0003411 3300049578 Bacteria 9977
191 Ga0501042_0054488 3300049578 Bacteria 2853
192 Ga0501043_0100461 3300049579 Bacteria 2274
193 Ga0501048_0086883 3300049582 Bacteria 2206
194 Ga0501048_0115425 3300049582 Bacteria 1897
195 Ga0501048_0141040 3300049582 Bacteria 1704
196 Ga0501068_0004672 3300049584 Bacteria 7457
197 Ga0501068_0213490 3300049584 Unclassified 1226
198 Ga0501069_0148714 3300049585 Bacteria 1345
199 Ga0501070_0133359 3300049586 Bacteria 2051
200 Ga0501071_0002309 3300049587 Bacteria 11510
201 Ga0501071_0005056 3300049587 Bacteria 8438
202 Ga0501071_0008748 3300049587 Bacteria 6702
203 Ga0501071_0012224 3300049587 Bacteria 5814
204 Ga0501071_0101489 3300049587 Bacteria 2121
205 Ga0501071_0115455 3300049587 Bacteria 1987
206 Ga0501071_0154943 3300049587 Bacteria 1710
207 Ga0501072_0025424 3300049588 Bacteria 4612
208 Ga0501072_0030787 3300049588 Bacteria 4198
209 Ga0501072_0040360 3300049588 Bacteria 3665
210 Ga0501072_0056779 3300049588 Bacteria 3084
211 Ga0501072_0062575 3300049588 Bacteria 2935
212 Ga0501072_0086803 3300049588 Bacteria 2482
213 Ga0501072_0121235 3300049588 Bacteria 2083
214 Ga0501073_0081318 3300049589 Bacteria 2254
215 Ga0501074_0023569 3300049590 Bacteria 4474
216 Ga0501074_0028514 3300049590 Bacteria 4047
217 Ga0501075_0009477 3300049591 Bacteria 6814
218 Ga0501075_0010704 3300049591 Bacteria 6455
219 Ga0501075_0084065 3300049591 Bacteria 2410
220 Ga0501075_0091314 3300049591 Bacteria 2311
221 Ga0501075_0107900 3300049591 Bacteria 2116
222 Ga0501075_0230117 3300049591 Bacteria 1414
223 Ga0501076_0001193 3300049592 Bacteria 17238
224 Ga0501076_0025067 3300049592 Bacteria 4613
225 Ga0501076_0087697 3300049592 Bacteria 2501
226 Ga0501076_0137906 3300049592 Bacteria 1981
227 Ga0501077_0147955 3300049593 Bacteria 1490
228 Ga0501079_0004111 3300049741 Bacteria 10766
229 Ga0501079_0105900 3300049741 Bacteria 2182
230 Ga0501080_0018795 3300049742 Bacteria 6398
231 Ga0501080_0040521 3300049742 Bacteria 4344
232 Ga0501080_0087372 3300049742 Bacteria 2897
233 Ga0501080_0380057 3300049742 Bacteria 1273
234 Ga0501081_0004047 3300049743 Bacteria 9395
235 Ga0501081_0024713 3300049743 Bacteria 4036
236 Ga0501081_0057477 3300049743 Bacteria 2690
237 Ga0501081_0125711 3300049743 Bacteria 1829
238 Ga0501083_0028900 3300049744 Bacteria 3819
239 Ga0501083_0054942 3300049744 Bacteria 2671
240 Ga0501035_0076019 3300049822 Bacteria 2970
241 Ga0501044_0064482 3300049823 Bacteria 3740
242 Ga0501044_0329977 3300049823 Unclassified 1449
243 Ga0501045_0004588 3300049824 Bacteria 9538
244 Ga0501045_0007422 3300049824 Bacteria 7622
245 Ga0501045_0038413 3300049824 Bacteria 3482
246 Ga0501045_0046873 3300049824 Bacteria 3147
247 Ga0501045_0110721 3300049824 Bacteria 2036
248 Ga0501045_0169229 3300049824 Bacteria 1628
249 nmdc:mga05p37_26895_c1 3300050507 Bacteria 7000
250 nmdc:mga05p37_59148_c1 3300050507 Bacteria 4720
251 nmdc:mga09592_467933_c1 3300050508 Unclassified 1087
252 nmdc:mga0qj67_122846_c1 3300050509 Bacteria 2100
253 nmdc:mga0qj67_124928_c1 3300050509 Bacteria 2082
254 nmdc:mga0qj67_159683_c1 3300050509 Bacteria 1830
255 nmdc:mga06r32_95321_c1 3300050510 Bacteria 2912
256 nmdc:mga08y16_137549_c1 3300050511 Bacteria 2539
257 nmdc:mga08y16_43702_c1 3300050511 Bacteria 4696
258 nmdc:mga0rr50_86743_c1 3300050513 Bacteria 2429
259 nmdc:mga08x19_42201_c1 3300050514 Bacteria 2907
260 nmdc:mga0a205_403823_c1 3300050515 Unclassified 1230
261 Ga0501084_0009698 3300054114 Bacteria 7963
262 Ga0501084_0415365 3300054114 Unclassified 1137
263 Ga0590071_011110 3300059421 Bacteria 2106
264 Ga0501082_0016401 3300060353 Bacteria 6377
265 Ga0501082_0027030 3300060353 Bacteria 4944
266 Ga0501082_0206928 3300060353 Bacteria 1707
267 Ga0530510_0000831 3300061734 Bacteria 20295
268 Ga0530510_0024672 3300061734 Bacteria 4294
269 Ga0530510_0047098 3300061734 Bacteria 3115
270 Ga0530510_0157877 3300061734 Bacteria 1677
271 Ga0530510_0281774 3300061734 Bacteria 1242
272 2643985100 2643221595 Bacteria 6565519
273 2644198137 2643221635 Bacteria 2632343
274 2802724150 2802428859 Bacteria 6667919
275 Ga0105249_10086405
276 JGI24742J22300_10001670
277 JGI25407J50210_10033231
278 Ga0070690_100023304
279 Ga0070680_100021427
280 Ga0070682_100011021
281 Ga0070682_100040243
282 Ga0070660_100146657
283 Ga0070689_100146879
284 Ga0070691_10014512
285 Ga0070671_100026145
286 Ga0070674_100004618
287 Ga0070673_100121875
288 Ga0070659_100033003
289 Ga0070667_100115040
290 Ga0070703_10079033
291 Ga0070714_100284774
292 Ga0070710_10001148
293 Ga0070701_10002723
294 Ga0070711_100001447
295 Ga0070705_100030869
296 Ga0070700_100008887
297 Ga0070694_100052751
298 Ga0070678_100004008
299 Ga0070662_100039641
300 Ga0070662_100456092
301 Ga0068867_100011045
302 Ga0070706_100000214
303 Ga0070706_100477600
304 Ga0070707_100017554
305 Ga0070698_100065814
306 Ga0070699_100006280
307 Ga0070699_100258660
308 Ga0070679_100026219
309 Ga0070684_100216190
310 Ga0070684_100298113
311 Ga0068853_100179440
312 Ga0070672_100301763
313 Ga0070686_100001639
314 Ga0070695_100050765
315 Ga0070695_100137996
316 Ga0070696_100003111
317 Ga0070693_100096418
318 Ga0070704_100118503
319 Ga0070704_100190188
320 Ga0068855_100543176
321 Ga0068856_100088245
322 Ga0068852_100431491
323 Ga0068859_100034272
324 Ga0068859_100102681
325 Ga0068859_100466632
326 Ga0068866_10001168
327 Ga0068858_100229984
328 Ga0068860_100139880
329 Ga0068862_100068086
330 Ga0081455_10100338
331 Ga0081538_10003624
332 Ga0081538_10045360
333 Ga0081538_10048090
334 Ga0081538_10117742
335 Ga0081539_10002686
336 Ga0070716_100064368
337 Ga0070712_100095603
338 Ga0068871_100074899
339 Ga0075430_100046698
340 Ga0075430_100182930
341 Ga0075430_100186241
342 Ga0075431_100058016
343 Ga0075433_10417491
344 Ga0075434_100049564
345 Ga0075429_100059147
346 Ga0075429_100120356
347 Ga0068865_100002147
348 Ga0075436_100031137
349 Ga0097620_100034272
350 Ga0097620_100102685
351 Ga0097620_100466688
352 Ga0111539_10038845
353 Ga0105245_10006585
354 Ga0114129_10024016
355 Ga0114129_10029950
356 Ga0114129_10070072
357 Ga0114129_10942149
358 Ga0105243_10016924
359 Ga0105242_10003997
360 Ga0105242_10429950
361 Ga0105238_10177290
362 Ga0105249_10003093
363 Ga0105249_10034559
364 Ga0105249_10243833
365 Ga0105239_10007055
366 Ga0105246_10304907
367 Ga0157371_10087222
368 Ga0157374_10210310
369 Ga0157378_10003888
370 Ga0163162_10005631
371 Ga0157380_10160458
372 Ga0157380_10215555
373 Ga0157380_10559778
374 Ga0157377_10001204
375 Ga0157376_10132412
376 Ga0206353_11155122
377 Ga0207653_10006901
378 Ga0207692_10001561
379 Ga0207684_10000074
380 Ga0207693_10150989
381 Ga0207663_10093382
382 Ga0207660_10050849
383 Ga0207657_10163323
384 Ga0207646_10000153
385 Ga0207646_10211352
386 Ga0207687_10021119
387 Ga0207706_10021077
388 Ga0207686_10001590
389 Ga0207709_10001700
390 Ga0207670_10022447
391 Ga0207670_10120574
392 Ga0207670_10150864
393 Ga0207704_10001464
394 Ga0207691_10019009
395 Ga0207651_10158764
396 Ga0207712_10016997
397 Ga0207677_10034577
398 Ga0207703_10164986
399 Ga0207703_10315053
400 Ga0207708_10002337
401 Ga0207702_10046545
402 Ga0207648_10005972
403 Ga0207674_10089572
404 Ga0207675_100105084
405 Ga0207683_10004666
406 Ga0209588_1000137
407 Ga0207428_10144788
408 Ga0268265_10038819
409 Ga0268265_10120454
410 Ga0268265_10142745
411 Ga0307408_100120225
412 Ga0307408_100234520
413 Ga0316579_10008767
414 Ga0307410_10054744
415 Ga0307406_10028510
416 Ga0307416_100293250
417 Ga0307416_100475099
418 Ga0307415_100051399
419 Ga0395898_0271844
420 Ga0395901_0579007
421 Ga0450918_013253
422 Ga0451577_0002166
423 Ga0453684_0001420
424 Ga0453684_0002604
425 Ga0453684_0003486
426 Ga0453684_0025592
427 Ga0453684_0103205
428 Ga0453684_0405466
429 Ga0451576_0018435
430 Ga0451576_0024189
431 Ga0451576_0470885
432 Ga0495634_0202907
433 Ga0496100_0034632
434 Ga0496101_0001216
435 Ga0496103_0001835
436 Ga0496106_0079822
437 Ga0496107_0026705
438 Ga0496108_0018281
439 Ga0496112_0026400
440 Ga0496113_0014420
441 Ga0496114_0005529
442 Ga0496115_0003300
443 Ga0496123_0008991
444 Ga0501305_005170
445 Ga0501312_005173
446 Ga0501031_0009658
447 Ga0501031_0033236
448 Ga0501033_0016177
449 Ga0501034_0347622
450 Ga0501036_0003011
451 Ga0501036_0111479
452 Ga0501036_0203214
453 Ga0501038_0037286
454 Ga0501039_0005945
455 Ga0501039_0028849
456 Ga0501039_0058649
457 Ga0501040_0005696
458 Ga0501040_0070520
459 Ga0501041_0002787
460 Ga0501041_0048144
461 Ga0501041_0060012
462 Ga0501041_0072783
463 Ga0501041_0090069
464 Ga0501042_0003411
465 Ga0501042_0054488
466 Ga0501043_0100461
467 Ga0501048_0086883
468 Ga0501048_0115425
469 Ga0501048_0141040
470 Ga0501068_0004672
471 Ga0501068_0213490
472 Ga0501069_0148714
473 Ga0501070_0133359
474 Ga0501071_0002309
475 Ga0501071_0005056
476 Ga0501071_0008748
477 Ga0501071_0012224
478 Ga0501071_0101489
479 Ga0501071_0115455
480 Ga0501071_0154943
481 Ga0501072_0025424
482 Ga0501072_0030787
483 Ga0501072_0040360
484 Ga0501072_0056779
485 Ga0501072_0062575
486 Ga0501072_0086803
487 Ga0501072_0121235
488 Ga0501073_0081318
489 Ga0501074_0023569
490 Ga0501074_0028514
491 Ga0501075_0009477
492 Ga0501075_0010704
493 Ga0501075_0084065
494 Ga0501075_0091314
495 Ga0501075_0107900
496 Ga0501075_0230117
497 Ga0501076_0001193
498 Ga0501076_0025067
499 Ga0501076_0087697
500 Ga0501076_0137906
501 Ga0501077_0147955
502 Ga0501079_0004111
503 Ga0501079_0105900
504 Ga0501080_0018795
505 Ga0501080_0040521
506 Ga0501080_0087372
507 Ga0501080_0380057
508 Ga0501081_0004047
509 Ga0501081_0024713
510 Ga0501081_0057477
511 Ga0501081_0125711
512 Ga0501083_0028900
513 Ga0501083_0054942
514 Ga0501035_0076019
515 Ga0501044_0064482
516 Ga0501044_0329977
517 Ga0501045_0004588
518 Ga0501045_0007422
519 Ga0501045_0038413
520 Ga0501045_0046873
521 Ga0501045_0110721
522 Ga0501045_0169229
523 nmdc:mga05p37_26895_c1
524 nmdc:mga05p37_59148_c1
525 nmdc:mga09592_467933_c1
526 nmdc:mga0qj67_122846_c1
527 nmdc:mga0qj67_124928_c1
528 nmdc:mga0qj67_159683_c1
529 nmdc:mga06r32_95321_c1
530 nmdc:mga08y16_137549_c1
531 nmdc:mga08y16_43702_c1
532 nmdc:mga0rr50_86743_c1
533 nmdc:mga08x19_42201_c1
534 nmdc:mga0a205_403823_c1
535 Ga0501084_0009698
536 Ga0501084_0415365
537 Ga0590071_011110
538 Ga0501082_0016401
539 Ga0501082_0027030
540 Ga0501082_0206928
541 Ga0530510_0000831
542 Ga0530510_0024672
543 Ga0530510_0047098
544 Ga0530510_0157877
545 Ga0530510_0281774
546 2643985100
547 2644198137
548 2802724150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

35

315

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lmz-assembly1.cif.gz_A-2 crystal structure of putative sugar isomerase. (yp_001305105.1) from parabacteroides distasonis atcc 8503 at 1.44 a resolution 0.8417 2 294
7vpf-assembly1.cif.gz_B crystal structure of a novel putative sugar isomerase from the psychrophilic bacterium paenibacillus sp. r4 0.8265 2 291
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.8202 2 293
2zds-assembly1.cif.gz_F crystal structure of sco6571 from streptomyces coelicolor a3(2) 0.8096 2 293
2zvr-assembly1.cif.gz_B crystal structure of a d-tagatose 3-epimerase-related protein from thermotoga maritima 0.8087 2 294
ID Description Score Start End Superfamily
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8723 1 295 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8695 1 295 3.20.20.150
3wqoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8515 1 294 3.20.20.150
af_P76044_1_262_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8258 1 292 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8231 1 292 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A535C9Y4-F1-model_v4 Sugar phosphate isomerase/epimerase 0.9787 201 295 GO:0016853
AF-X1FGI6-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9731 82 295
AF-A0A1Q7CKD3-F1-model_v4 AP endonuclease 0.9678 1 295 GO:0004519
AF-A0A354M7F1-F1-model_v4 AP endonuclease 0.9657 51 295 GO:0004519
GO:0016829
AF-A0A1Q7CKD3-F1-model_v4 AP endonuclease 0.9645 1 295 GO:0004519

Map