F379553

General Info

Members Datasets Scaffolds Average Seq Length
274 207 548 170

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10176369|Ga0070710_101763692
Length 183
Sequence MRVDLYEKIWMWGVAVMLSLFFTSTAIAALRDSRHPPSHVETIDPTRVMADARFRAPGVSVDVTGRVQARIIGMTFAWLPAEITVPAETPVTFRVTSMDVVHGFEIVRTDGQTMVLPGYVSQFTTTFDAGEYLITCNEYCGIGHHTMAAKLHVVPRAQWHGQGATLSPAVPHTAGGGDDHDHI

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
130 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
131 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
132 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.28
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 20.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10176369 3300005437 Bacteria 1335
2 JGI24742J22300_10057313 3300002244 Unclassified 712
3 rootL2_10091005 3300003322 Unclassified 4325
4 rootL2_10195948 3300003322 Bacteria 3291
5 Ga0065707_10279799 3300005295 Unclassified 1050
6 Ga0070658_10532564 3300005327 Bacteria 1016
7 Ga0068869_100001322 3300005334 Bacteria 14684
8 Ga0070666_10034644 3300005335 Bacteria 3346
9 Ga0070680_100175922 3300005336 Archaea 1802
10 Ga0070682_100189958 3300005337 Archaea 1441
11 Ga0070691_10021632 3300005341 Bacteria 2977
12 Ga0070668_100234024 3300005347 Archaea 1520
13 Ga0070669_100011993 3300005353 Bacteria 6151
14 Ga0070675_101117257 3300005354 Unclassified 725
15 Ga0070671_100093402 3300005355 Bacteria 2521
16 Ga0070674_100003340 3300005356 Bacteria 8982
17 Ga0070709_10000009 3300005434 Bacteria 178953
18 Ga0070709_10060902 3300005434 Bacteria 2401
19 Ga0070709_10434005 3300005434 Bacteria 987
20 Ga0070701_10274946 3300005438 Unclassified 1026
21 Ga0070711_100032293 3300005439 Bacteria 3480
22 Ga0070705_100005726 3300005440 Bacteria 6067
23 Ga0070700_100171000 3300005441 Archaea 1505
24 Ga0070694_100018216 3300005444 Bacteria 4456
25 Ga0070708_100773169 3300005445 Unclassified 903
26 Ga0070678_100016975 3300005456 Bacteria 4673
27 Ga0070662_100000372 3300005457 Bacteria 26754
28 Ga0070707_100198375 3300005468 Unclassified 1956
29 Ga0070679_100199200 3300005530 Archaea 1969
30 Ga0070695_100001108 3300005545 Bacteria 14742
31 Ga0070696_100003089 3300005546 Bacteria 11075
32 Ga0068857_100008534 3300005577 Bacteria 8859
33 Ga0068854_100000539 3300005578 Bacteria 22864
34 Ga0068856_100166667 3300005614 Bacteria 2214
35 Ga0068856_100474183 3300005614 Unclassified 1272
36 Ga0068856_100883057 3300005614 Bacteria 913
37 Ga0070702_100206512 3300005615 Unclassified 1304
38 Ga0068859_100136388 3300005617 Bacteria 2527
39 Ga0068864_100002816 3300005618 Bacteria 14352
40 Ga0068866_10001835 3300005718 Bacteria 8932
41 Ga0068863_101062768 3300005841 Bacteria 813
42 Ga0068860_100010411 3300005843 Bacteria 9197
43 Ga0068862_100403275 3300005844 Archaea 1279
44 Ga0070717_10383429 3300006028 Bacteria 1261
45 Ga0070717_10689699 3300006028 Bacteria 928
46 Ga0070717_11272990 3300006028 Unclassified 669
47 Ga0097621_100030250 3300006237 Bacteria 4285
48 Ga0097621_100092571 3300006237 Unclassified 2532
49 Ga0068871_100378953 3300006358 Bacteria 1256
50 Ga0075428_101068235 3300006844 Unclassified 853
51 Ga0075430_100207771 3300006846 Bacteria 1625
52 Ga0075431_100136088 3300006847 Unclassified 2533
53 Ga0075434_100063353 3300006871 Archaea 3680
54 Ga0075434_100278566 3300006871 Bacteria 1692
55 Ga0075429_100815481 3300006880 Archaea 817
56 Ga0068865_100000483 3300006881 Bacteria 22294
57 Ga0068865_100283523 3300006881 Archaea 1320
58 Ga0097620_100136386 3300006931 Bacteria 2527
59 Ga0105240_10064791 3300009093 Bacteria 4539
60 Ga0111539_10055001 3300009094 Bacteria 4732
61 Ga0105245_10021383 3300009098 Bacteria 5674
62 Ga0105247_10294807 3300009101 Unclassified 1123
63 Ga0105243_10002336 3300009148 Bacteria 15874
64 Ga0105243_10054138 3300009148 Bacteria 3184
65 Ga0105241_10004306 3300009174 Bacteria 10527
66 Ga0105242_10005255 3300009176 Bacteria 9994
67 Ga0105248_10007559 3300009177 Bacteria 11936
68 Ga0105248_10165479 3300009177 Bacteria 2493
69 Ga0105249_10016774 3300009553 Bacteria 6499
70 Ga0105249_10052992 3300009553 Unclassified 3707
71 Ga0105239_10003823 3300010375 Bacteria 18287
72 Ga0105246_10005174 3300011119 Bacteria 7927
73 Ga0157371_10104881 3300013102 Unclassified 2006
74 Ga0163162_10019953 3300013306 Bacteria 6583
75 Ga0163162_10225775 3300013306 Bacteria 2002
76 Ga0163162_10356062 3300013306 Archaea 1596
77 Ga0157372_10156418 3300013307 Bacteria 2633
78 Ga0157372_12419357 3300013307 Bacteria 603
79 Ga0157375_10035895 3300013308 Bacteria 4736
80 Ga0157375_10263284 3300013308 Unclassified 1886
81 Ga0157380_10006870 3300014326 Bacteria 8044
82 Ga0157380_10052063 3300014326 Bacteria 3240
83 Ga0157379_10014770 3300014968 Bacteria 6849
84 Ga0157376_10066284 3300014969 Archaea 3052
85 Ga0157376_10654982 3300014969 Unclassified 1051
86 Ga0213872_10127493 3300021361 Archaea 1122
87 Ga0213874_10006758 3300021377 Bacteria 2728
88 Ga0213874_10022040 3300021377 Archaea 1763
89 Ga0213871_10000836 3300021441 Bacteria 4637
90 Ga0213871_10075028 3300021441 Unclassified 961
91 Ga0207710_10284909 3300025900 Unclassified 832
92 Ga0207680_10087488 3300025903 Bacteria 1973
93 Ga0207699_10000020 3300025906 Bacteria 179154
94 Ga0207699_10121052 3300025906 Bacteria 1693
95 Ga0207699_10480485 3300025906 Unclassified 895
96 Ga0207699_10693096 3300025906 Unclassified 745
97 Ga0207645_10003586 3300025907 Bacteria 11742
98 Ga0207643_10014130 3300025908 Bacteria 4335
99 Ga0207654_10014160 3300025911 Bacteria 4116
100 Ga0207695_10214035 3300025913 Unclassified 1837
101 Ga0207671_10468904 3300025914 Unclassified 1003
102 Ga0207663_10160961 3300025916 Bacteria 1584
103 Ga0207663_10324758 3300025916 Bacteria 1157
104 Ga0207663_10361068 3300025916 Bacteria 1102
105 Ga0207652_10218324 3300025921 Archaea 1718
106 Ga0207646_10170112 3300025922 Unclassified 1968
107 Ga0207681_10030328 3300025923 Bacteria 3525
108 Ga0207687_11025960 3300025927 Bacteria 708
109 Ga0207664_10180870 3300025929 Bacteria 1810
110 Ga0207664_11283438 3300025929 Unclassified 651
111 Ga0207644_10093050 3300025931 Bacteria 2250
112 Ga0207706_10000025 3300025933 Bacteria 150958
113 Ga0207686_10000350 3300025934 Bacteria 32839
114 Ga0207709_10005226 3300025935 Bacteria 7387
115 Ga0207669_10048814 3300025937 Archaea 2517
116 Ga0207704_10000422 3300025938 Bacteria 18975
117 Ga0207691_10191860 3300025940 Unclassified 1781
118 Ga0207711_10003179 3300025941 Bacteria 14320
119 Ga0207711_10188494 3300025941 Bacteria 1878
120 Ga0207689_10005165 3300025942 Bacteria 11727
121 Ga0207651_10071236 3300025960 Bacteria 2463
122 Ga0207712_10001427 3300025961 Bacteria 16326
123 Ga0207712_10485015 3300025961 Archaea 1054
124 Ga0207668_10087592 3300025972 Archaea 2278
125 Ga0207640_10005627 3300025981 Bacteria 6831
126 Ga0207703_10032624 3300026035 Bacteria 4122
127 Ga0207708_10054234 3300026075 Archaea 3056
128 Ga0207702_10940248 3300026078 Unclassified 857
129 Ga0207648_10000269 3300026089 Bacteria 56592
130 Ga0207676_10008039 3300026095 Bacteria 7500
131 Ga0207674_10001992 3300026116 Bacteria 25885
132 Ga0207674_11226647 3300026116 Unclassified 719
133 Ga0207675_100076079 3300026118 Bacteria 3143
134 Ga0207683_10028562 3300026121 Bacteria 4824
135 Ga0209969_1021043 3300027360 Bacteria 973
136 Ga0209999_1004313 3300027543 Bacteria 2561
137 Ga0209983_1049937 3300027665 Unclassified 915
138 Ga0209971_1005725 3300027682 Unclassified 2943
139 Ga0209974_10002498 3300027876 Bacteria 6656
140 Ga0207428_10041606 3300027907 Unclassified 3718
141 Ga0268265_10066326 3300028380 Bacteria 2790
142 Ga0268264_10004272 3300028381 Bacteria 12193
143 Ga0268264_10138144 3300028381 Bacteria 2170
144 Ga0373923_0004332 3300035111 Bacteria 4701
145 Ga0373936_0218280 3300035113 Unclassified 845
146 Ga0373953_0053054 3300035117 Bacteria 1642
147 Ga0373956_0000179 3300035119 Bacteria 24049
148 Ga0373955_0000358 3300035172 Bacteria 19171
149 Ga0373924_0008313 3300035410 Bacteria 3767
150 Ga0373931_0057512 3300035691 Bacteria 2086
151 Ga0373935_0418494 3300035692 Unclassified 964
152 Ga0373935_0660284 3300035692 Bacteria 767
153 Ga0373933_0000244 3300035724 Bacteria 35858
154 Ga0373947_0113455 3300035725 Bacteria 1715
155 Ga0373937_0000097 3300036401 Bacteria 81932
156 Ga0373925_0040848 3300037068 Bacteria 3436
157 Ga0373925_0446002 3300037068 Bacteria 1059
158 Ga0373925_0948877 3300037068 Bacteria 709
159 Ga0436360_0189444 3300039438 Unclassified 1033
160 Ga0436360_0684632 3300039438 Bacteria 21056
161 Ga0436361_0162711 3300039447 Bacteria 13504
162 Ga0436361_0521357 3300039447 Bacteria 957
163 Ga0436361_0927549 3300039447 Bacteria 1122
164 Ga0436363_0458564 3300039450 Archaea 699
165 Ga0436363_0614192 3300039450 Bacteria 549
166 Ga0436363_1335143 3300039450 Bacteria 2307
167 Ga0436363_1387035 3300039450 Archaea 2969
168 Ga0436362_0490035 3300039453 Bacteria 1276
169 Ga0436362_1263287 3300039453 Archaea 2155
170 Ga0439453_0008621 3300041408 Bacteria 1641
171 Ga0439443_006833 3300042003 Bacteria 1572
172 Ga0439443_097360 3300042003 Bacteria 561
173 Ga0439451_053057 3300042009 Unclassified 812
174 Ga0439456_145900 3300042013 Unclassified 550
175 Ga0439460_0011564 3300042461 Unclassified 2278
176 Ga0439460_0060301 3300042461 Bacteria 1157
177 Ga0453683_0191966 3300044673 Unclassified 1296
178 Ga0451576_0147415 3300045051 Bacteria 2454
179 Ga0451576_0250887 3300045051 Unclassified 1849
180 Ga0451576_1248854 3300045051 Unclassified 775
181 Ga0495592_0005389 3300046454 Bacteria 9441
182 Ga0495603_0198250 3300046455 Unclassified 1160
183 Ga0495629_0079368 3300046459 Bacteria 2292
184 Ga0495651_0004560 3300046462 Bacteria 10590
185 Ga0495653_0000026 3300046463 Bacteria 154862
186 Ga0495664_0132129 3300046477 Archaea 1512
187 Ga0495664_0426423 3300046477 Bacteria 795
188 Ga0495594_0012595 3300046499 Bacteria 4409
189 Ga0495608_0000117 3300046511 Bacteria 56601
190 Ga0495618_0092251 3300046514 Bacteria 1936
191 Ga0495628_0004521 3300046516 Bacteria 12324
192 Ga0495630_0021833 3300046517 Bacteria 4726
193 Ga0495652_0022038 3300046529 Bacteria 5658
194 Ga0495665_0218258 3300046531 Bacteria 986
195 Ga0495586_0031238 3300046535 Bacteria 2851
196 Ga0495587_0000554 3300046536 Bacteria 25771
197 Ga0495645_0000083 3300046543 Bacteria 64874
198 Ga0495645_0060346 3300046543 Bacteria 2749
199 Ga0495645_0204022 3300046543 Bacteria 1339
200 Ga0495634_0131524 3300046642 Bacteria 1595
201 Ga0495635_0002273 3300046663 Bacteria 13065
202 Ga0495659_0108239 3300046664 Bacteria 1083
203 Ga0495657_0000100 3300046675 Bacteria 76416
204 Ga0495599_0000191 3300046678 Bacteria 40630
205 Ga0495623_0000088 3300046679 Bacteria 54273
206 Ga0495646_0000382 3300046680 Bacteria 23147
207 Ga0495658_0068879 3300046683 Bacteria 2050
208 Ga0495613_0072060 3300046689 Bacteria 2518
209 Ga0495600_0000761 3300046809 Bacteria 16965
210 Ga0495581_0177187 3300047315 Bacteria 1246
211 Ga0495604_0000088 3300047317 Bacteria 78169
212 Ga0495674_0429905 3300047319 Bacteria 1063
213 Ga0495680_0007524 3300047322 Bacteria 9970
214 Ga0495675_0003561 3300047444 Bacteria 9391
215 Ga0495684_0000038 3300047471 Bacteria 104215
216 Ga0495593_0062941 3300047673 Bacteria 1938
217 Ga0495602_0000087 3300048088 Bacteria 89869
218 Ga0496101_0363886 3300048904 Archaea 1137
219 Ga0496102_0140286 3300048905 Bacteria 2266
220 Ga0496104_0361687 3300048907 Bacteria 1364
221 Ga0496109_0415775 3300048912 Unclassified 1270
222 Ga0496110_0629067 3300048913 Unclassified 972
223 Ga0496111_0328296 3300048914 Unclassified 1133
224 Ga0496113_0040097 3300048916 Bacteria 3450
225 Ga0496114_0042694 3300048917 Bacteria 3759
226 Ga0496114_1117972 3300048917 Unclassified 673
227 Ga0501031_0281601 3300049568 Unclassified 1078
228 Ga0501036_0321702 3300049572 Archaea 1292
229 Ga0501036_1277609 3300049572 Unclassified 597
230 Ga0501037_0402774 3300049573 Archaea 938
231 Ga0501038_0034383 3300049574 Bacteria 4457
232 Ga0501039_0114198 3300049575 Bacteria 2113
233 Ga0501039_0171414 3300049575 Bacteria 1706
234 Ga0501041_0049719 3300049577 Bacteria 2554
235 Ga0501042_0033834 3300049578 Bacteria 3624
236 Ga0501046_0087967 3300049580 Archaea 2393
237 Ga0501048_0161363 3300049582 Archaea 1586
238 Ga0501070_0453471 3300049586 Unclassified 1034
239 Ga0501071_0081568 3300049587 Bacteria 2367
240 Ga0501072_0166422 3300049588 Unclassified 1759
241 Ga0501072_0232770 3300049588 Archaea 1468
242 Ga0501072_0612356 3300049588 Archaea 858
243 Ga0501073_0051775 3300049589 Bacteria 2876
244 Ga0501074_0106195 3300049590 Bacteria 2010
245 Ga0501075_0109209 3300049591 Archaea 2103
246 Ga0501075_0305828 3300049591 Archaea 1211
247 Ga0501075_1284165 3300049591 Bacteria 555
248 Ga0501076_0273074 3300049592 Archaea 1384
249 Ga0501076_0782410 3300049592 Unclassified 787
250 Ga0501076_0802285 3300049592 Bacteria 777
251 Ga0501077_0010009 3300049593 Bacteria 5900
252 Ga0501077_0010038 3300049593 Bacteria 5894
253 Ga0501079_0032027 3300049741 Bacteria 4041
254 Ga0501079_0220763 3300049741 Archaea 1481
255 Ga0501080_0096610 3300049742 Archaea 2743
256 Ga0501080_0296280 3300049742 Archaea 1468
257 Ga0501081_0004203 3300049743 Bacteria 9230
258 Ga0501081_0762242 3300049743 Unclassified 727
259 Ga0501045_0011402 3300049824 Bacteria 6243
260 Ga0501045_0040691 3300049824 Bacteria 3380
261 nmdc:mga09592_542377_c1 3300050508 Archaea 999
262 nmdc:mga08y16_182599_c1 3300050511 Unclassified 2178
263 nmdc:mga0n895_147500_c1 3300050512 Unclassified 2382
264 nmdc:mga0n895_2199778_c1 3300050512 Unclassified 507
265 nmdc:mga0n895_59240_c1 3300050512 Archaea 3778
266 Ga0495601_0017098 3300053077 Bacteria 4401
267 Ga0495612_0000823 3300053078 Bacteria 12622
268 Ga0495619_0001475 3300053085 Bacteria 15515
269 Ga0501084_0008923 3300054114 Bacteria 8295
270 Ga0501084_0283244 3300054114 Bacteria 1400
271 Ga0501084_0490993 3300054114 Bacteria 1038
272 Ga0501082_0054210 3300060353 Bacteria 3456
273 Ga0501082_0228254 3300060353 Unclassified 1620
274 Ga0530510_0225654 3300061734 Unclassified 1393
275 Ga0070710_10176369
276 JGI24742J22300_10057313
277 rootL2_10091005
278 rootL2_10195948
279 Ga0065707_10279799
280 Ga0070658_10532564
281 Ga0068869_100001322
282 Ga0070666_10034644
283 Ga0070680_100175922
284 Ga0070682_100189958
285 Ga0070691_10021632
286 Ga0070668_100234024
287 Ga0070669_100011993
288 Ga0070675_101117257
289 Ga0070671_100093402
290 Ga0070674_100003340
291 Ga0070709_10000009
292 Ga0070709_10060902
293 Ga0070709_10434005
294 Ga0070701_10274946
295 Ga0070711_100032293
296 Ga0070705_100005726
297 Ga0070700_100171000
298 Ga0070694_100018216
299 Ga0070708_100773169
300 Ga0070678_100016975
301 Ga0070662_100000372
302 Ga0070707_100198375
303 Ga0070679_100199200
304 Ga0070695_100001108
305 Ga0070696_100003089
306 Ga0068857_100008534
307 Ga0068854_100000539
308 Ga0068856_100166667
309 Ga0068856_100474183
310 Ga0068856_100883057
311 Ga0070702_100206512
312 Ga0068859_100136388
313 Ga0068864_100002816
314 Ga0068866_10001835
315 Ga0068863_101062768
316 Ga0068860_100010411
317 Ga0068862_100403275
318 Ga0070717_10383429
319 Ga0070717_10689699
320 Ga0070717_11272990
321 Ga0097621_100030250
322 Ga0097621_100092571
323 Ga0068871_100378953
324 Ga0075428_101068235
325 Ga0075430_100207771
326 Ga0075431_100136088
327 Ga0075434_100063353
328 Ga0075434_100278566
329 Ga0075429_100815481
330 Ga0068865_100000483
331 Ga0068865_100283523
332 Ga0097620_100136386
333 Ga0105240_10064791
334 Ga0111539_10055001
335 Ga0105245_10021383
336 Ga0105247_10294807
337 Ga0105243_10002336
338 Ga0105243_10054138
339 Ga0105241_10004306
340 Ga0105242_10005255
341 Ga0105248_10007559
342 Ga0105248_10165479
343 Ga0105249_10016774
344 Ga0105249_10052992
345 Ga0105239_10003823
346 Ga0105246_10005174
347 Ga0157371_10104881
348 Ga0163162_10019953
349 Ga0163162_10225775
350 Ga0163162_10356062
351 Ga0157372_10156418
352 Ga0157372_12419357
353 Ga0157375_10035895
354 Ga0157375_10263284
355 Ga0157380_10006870
356 Ga0157380_10052063
357 Ga0157379_10014770
358 Ga0157376_10066284
359 Ga0157376_10654982
360 Ga0213872_10127493
361 Ga0213874_10006758
362 Ga0213874_10022040
363 Ga0213871_10000836
364 Ga0213871_10075028
365 Ga0207710_10284909
366 Ga0207680_10087488
367 Ga0207699_10000020
368 Ga0207699_10121052
369 Ga0207699_10480485
370 Ga0207699_10693096
371 Ga0207645_10003586
372 Ga0207643_10014130
373 Ga0207654_10014160
374 Ga0207695_10214035
375 Ga0207671_10468904
376 Ga0207663_10160961
377 Ga0207663_10324758
378 Ga0207663_10361068
379 Ga0207652_10218324
380 Ga0207646_10170112
381 Ga0207681_10030328
382 Ga0207687_11025960
383 Ga0207664_10180870
384 Ga0207664_11283438
385 Ga0207644_10093050
386 Ga0207706_10000025
387 Ga0207686_10000350
388 Ga0207709_10005226
389 Ga0207669_10048814
390 Ga0207704_10000422
391 Ga0207691_10191860
392 Ga0207711_10003179
393 Ga0207711_10188494
394 Ga0207689_10005165
395 Ga0207651_10071236
396 Ga0207712_10001427
397 Ga0207712_10485015
398 Ga0207668_10087592
399 Ga0207640_10005627
400 Ga0207703_10032624
401 Ga0207708_10054234
402 Ga0207702_10940248
403 Ga0207648_10000269
404 Ga0207676_10008039
405 Ga0207674_10001992
406 Ga0207674_11226647
407 Ga0207675_100076079
408 Ga0207683_10028562
409 Ga0209969_1021043
410 Ga0209999_1004313
411 Ga0209983_1049937
412 Ga0209971_1005725
413 Ga0209974_10002498
414 Ga0207428_10041606
415 Ga0268265_10066326
416 Ga0268264_10004272
417 Ga0268264_10138144
418 Ga0373923_0004332
419 Ga0373936_0218280
420 Ga0373953_0053054
421 Ga0373956_0000179
422 Ga0373955_0000358
423 Ga0373924_0008313
424 Ga0373931_0057512
425 Ga0373935_0418494
426 Ga0373935_0660284
427 Ga0373933_0000244
428 Ga0373947_0113455
429 Ga0373937_0000097
430 Ga0373925_0040848
431 Ga0373925_0446002
432 Ga0373925_0948877
433 Ga0436360_0189444
434 Ga0436360_0684632
435 Ga0436361_0162711
436 Ga0436361_0521357
437 Ga0436361_0927549
438 Ga0436363_0458564
439 Ga0436363_0614192
440 Ga0436363_1335143
441 Ga0436363_1387035
442 Ga0436362_0490035
443 Ga0436362_1263287
444 Ga0439453_0008621
445 Ga0439443_006833
446 Ga0439443_097360
447 Ga0439451_053057
448 Ga0439456_145900
449 Ga0439460_0011564
450 Ga0439460_0060301
451 Ga0453683_0191966
452 Ga0451576_0147415
453 Ga0451576_0250887
454 Ga0451576_1248854
455 Ga0495592_0005389
456 Ga0495603_0198250
457 Ga0495629_0079368
458 Ga0495651_0004560
459 Ga0495653_0000026
460 Ga0495664_0132129
461 Ga0495664_0426423
462 Ga0495594_0012595
463 Ga0495608_0000117
464 Ga0495618_0092251
465 Ga0495628_0004521
466 Ga0495630_0021833
467 Ga0495652_0022038
468 Ga0495665_0218258
469 Ga0495586_0031238
470 Ga0495587_0000554
471 Ga0495645_0000083
472 Ga0495645_0060346
473 Ga0495645_0204022
474 Ga0495634_0131524
475 Ga0495635_0002273
476 Ga0495659_0108239
477 Ga0495657_0000100
478 Ga0495599_0000191
479 Ga0495623_0000088
480 Ga0495646_0000382
481 Ga0495658_0068879
482 Ga0495613_0072060
483 Ga0495600_0000761
484 Ga0495581_0177187
485 Ga0495604_0000088
486 Ga0495674_0429905
487 Ga0495680_0007524
488 Ga0495675_0003561
489 Ga0495684_0000038
490 Ga0495593_0062941
491 Ga0495602_0000087
492 Ga0496101_0363886
493 Ga0496102_0140286
494 Ga0496104_0361687
495 Ga0496109_0415775
496 Ga0496110_0629067
497 Ga0496111_0328296
498 Ga0496113_0040097
499 Ga0496114_0042694
500 Ga0496114_1117972
501 Ga0501031_0281601
502 Ga0501036_0321702
503 Ga0501036_1277609
504 Ga0501037_0402774
505 Ga0501038_0034383
506 Ga0501039_0114198
507 Ga0501039_0171414
508 Ga0501041_0049719
509 Ga0501042_0033834
510 Ga0501046_0087967
511 Ga0501048_0161363
512 Ga0501070_0453471
513 Ga0501071_0081568
514 Ga0501072_0166422
515 Ga0501072_0232770
516 Ga0501072_0612356
517 Ga0501073_0051775
518 Ga0501074_0106195
519 Ga0501075_0109209
520 Ga0501075_0305828
521 Ga0501075_1284165
522 Ga0501076_0273074
523 Ga0501076_0782410
524 Ga0501076_0802285
525 Ga0501077_0010009
526 Ga0501077_0010038
527 Ga0501079_0032027
528 Ga0501079_0220763
529 Ga0501080_0096610
530 Ga0501080_0296280
531 Ga0501081_0004203
532 Ga0501081_0762242
533 Ga0501045_0011402
534 Ga0501045_0040691
535 nmdc:mga09592_542377_c1
536 nmdc:mga08y16_182599_c1
537 nmdc:mga0n895_147500_c1
538 nmdc:mga0n895_2199778_c1
539 nmdc:mga0n895_59240_c1
540 Ga0495601_0017098
541 Ga0495612_0000823
542 Ga0495619_0001475
543 Ga0501084_0008923
544 Ga0501084_0283244
545 Ga0501084_0490993
546 Ga0501082_0054210
547 Ga0501082_0228254
548 Ga0530510_0225654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

69

154

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pty-assembly2.cif.gz_B soluble model of human cua (tt3lh) 0.9327 41 154
1cyx-assembly1.cif.gz_A quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa) 0.9272 68 156
6ptt-assembly2.cif.gz_B soluble model of arabidopsis thaliana cua (tt3lat) 0.9264 41 154
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.9192 38 154
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.9112 43 155
ID Description Score Start End Superfamily
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9069 46 155 2.60.40.420
af_P9WP69_149_325_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8963 82 158 2.60.40.420
3hb3B01 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8946 70 158 2.60.40.420
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8912 80 158 2.60.40.420
af_A0A2P2CLF0_113_253_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.891 80 158 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A6I7WQ91-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9665 70 160 GO:0004129
GO:0005507
GO:0016020
GO:0030313
AF-A0A658J8J6-F1-model_v4 deleted 0.9644 71 156
AF-A0A2S5QVA3-F1-model_v4 deleted 0.9577 68 156
AF-A0A523YV02-F1-model_v4 Rhodanese domain-containing protein 0.9561 68 156 GO:0004129
GO:0005507
GO:0016020
GO:0030313
AF-A0A536YA34-F1-model_v4 Cytochrome c oxidase subunit II 0.9518 68 155 GO:0004129
GO:0005507
GO:0016020
GO:0030313

Map