F379362

General Info

Members Datasets Scaffolds Average Seq Length
273 156 266 164

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000858|Ga0500616_0000858_24760_25317
Length 185
Sequence MTADEADGGETGRVDGGEPRLDSEGVPESVAVYRRIRSVFGDPGMRSGDARRRKRAARDETSVPYGAGRDPRGVGDVLQNLTSEMGWDSPLAQAEVLAAWADVVGAETAAHALPIGIEEGVLTIRCDSTAWATQLRRMNAAITTKITTRFAAAGIQSVKFLGPDTPSWKRGPRAIPGRGPRDTYG

Samples

Sample ID Description Type Environment
1 2643221616 Leifsonia sp. Root227 Isolate Unclassified
2 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
3 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
4 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
5 2928153084 Leifsonia sp. 563 Isolate Unclassified
6 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
82 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
83 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
143 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
144 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
145 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
146 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
147 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
148 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
149 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
150 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 1.1
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.92
Nodule 0
Rhizoplane 5.13
Rhizosphere 70.33
Stem 0
Stem Tuber 0
Unclassified 10.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007199 3300001979 Bacteria 4536
2 JGI24739J22299_10002217 3300001989 Bacteria 7466
3 JGI24737J22298_10004810 3300001990 Bacteria 4691
4 JGI24735J21928_10000213 3300002067 Bacteria 20363
5 Ga0006562J51391_1007922 3300003578 Bacteria 9000
6 Ga0006562J51391_1007923 3300003578 Bacteria 4170
7 Ga0055539_1000014 3300003752 Bacteria 381086
8 Ga0055533_1000002 3300003756 Bacteria 1196393
9 Ga0055532_1011015 3300003758 Bacteria 1071
10 Ga0055525_1001156 3300003759 Bacteria 6223
11 Ga0055527_1000004 3300003760 Bacteria 570634
12 Ga0055542_1000019 3300003762 Bacteria 341174
13 Ga0055529_1000008 3300003763 Bacteria 394786
14 Ga0055541_1000497 3300003841 Bacteria 11039
15 Ga0065714_10010144 3300005288 Bacteria 4002
16 Ga0070683_100403967 3300005329 Bacteria 1303
17 Ga0068869_100983039 3300005334 Bacteria 734
18 Ga0070682_100248684 3300005337 Bacteria 1281
19 Ga0068868_100036222 3300005338 Bacteria 3818
20 Ga0070675_101027836 3300005354 Bacteria 757
21 Ga0070671_100091858 3300005355 Bacteria 2543
22 Ga0070659_100003355 3300005366 Bacteria 11392
23 Ga0070667_100047298 3300005367 Bacteria 3619
24 Ga0070667_100173368 3300005367 Bacteria 1905
25 Ga0070711_101607712 3300005439 Bacteria 568
26 Ga0070672_100019574 3300005543 Bacteria 4916
27 Ga0068855_100001284 3300005563 Bacteria 31118
28 Ga0068855_100860266 3300005563 Bacteria 960
29 Ga0068856_100154854 3300005614 Bacteria 2302
30 Ga0068852_100274077 3300005616 Bacteria 1624
31 Ga0068864_100024877 3300005618 Bacteria 5037
32 Ga0068858_100000176 3300005842 Bacteria 68056
33 Ga0068858_101254486 3300005842 Bacteria 729
34 Ga0075365_10135986 3300006038 Bacteria 1703
35 Ga0105244_10108179 3300009036 Bacteria 1355
36 Ga0105242_10997429 3300009176 Bacteria 845
37 Ga0105248_10000897 3300009177 Bacteria 33319
38 Ga0105237_10004763 3300009545 Bacteria 15599
39 Ga0105238_10142813 3300009551 Bacteria 2370
40 Ga0105238_10404000 3300009551 Bacteria 1359
41 Ga0157369_10312044 3300013105 Bacteria 1635
42 Ga0157369_10753550 3300013105 Bacteria 1002
43 Ga0157374_10034123 3300013296 Bacteria 4646
44 Ga0163162_10422999 3300013306 Bacteria 1464
45 Ga0157372_10124688 3300013307 Bacteria 2961
46 Ga0157372_10442532 3300013307 Bacteria 1515
47 Ga0163163_10186156 3300014325 Bacteria 2124
48 Ga0157379_10068421 3300014968 Bacteria 3175
49 Ga0206353_10737357 3300020082 Bacteria 2202
50 Ga0209566_100056 3300025225 Bacteria 209595
51 Ga0209674_100001 3300025226 Bacteria 4013750
52 Ga0209672_100011 3300025228 Bacteria 856297
53 Ga0209147_100289 3300025229 Bacteria 42738
54 Ga0209563_100001 3300025230 Bacteria 4013775
55 Ga0209563_101290 3300025230 Bacteria 6850
56 Ga0209258_102239 3300025242 Bacteria 5239
57 Ga0209677_100001 3300025253 Bacteria 4013787
58 Ga0209677_100271 3300025253 Bacteria 34642
59 Ga0209148_1000023 3300025254 Bacteria 680511
60 Ga0209455_1000023 3300025272 Bacteria 680449
61 Ga0209455_1004265 3300025272 Bacteria 4750
62 Ga0207710_10047942 3300025900 Bacteria 1911
63 Ga0207647_10010284 3300025904 Bacteria 6610
64 Ga0207647_10297582 3300025904 Bacteria 919
65 Ga0207705_10009264 3300025909 Bacteria 7161
66 Ga0207705_10096625 3300025909 Bacteria 2169
67 Ga0207654_10000001 3300025911 Bacteria 1816198
68 Ga0207671_10003504 3300025914 Bacteria 15592
69 Ga0207657_10007809 3300025919 Bacteria 10918
70 Ga0207644_10058975 3300025931 Bacteria 2775
71 Ga0207690_10002616 3300025932 Bacteria 10843
72 Ga0207669_11023984 3300025937 Bacteria 695
73 Ga0207711_10000405 3300025941 Bacteria 45662
74 Ga0207667_10000498 3300025949 Bacteria 51911
75 Ga0207658_10127606 3300025986 Bacteria 2038
76 Ga0207677_10570580 3300026023 Bacteria 989
77 Ga0207677_10931427 3300026023 Bacteria 785
78 Ga0207703_10000121 3300026035 Bacteria 94523
79 Ga0207678_10281394 3300026067 Bacteria 1428
80 Ga0207702_10278122 3300026078 Bacteria 1581
81 Ga0207641_10022978 3300026088 Bacteria 5137
82 Ga0207641_10083852 3300026088 Bacteria 2773
83 Ga0307515_10072678 3300028794 Bacteria 4635
84 Ga0307515_10282638 3300028794 Bacteria 1365
85 Ga0307515_10304762 3300028794 Bacteria 1274
86 Ga0307513_10122214 3300031456 Bacteria 2567
87 Ga0307412_10341503 3300031911 Bacteria 1199
88 Ga0307412_10359550 3300031911 Bacteria 1172
89 Ga0307409_101983211 3300031995 Bacteria 612
90 Ga0395899_0007189 3300037312 Bacteria 8617
91 Ga0395900_0224186 3300037418 Bacteria 1893
92 Ga0395900_1223006 3300037418 Bacteria 666
93 Ga0451797_0600536 3300041453 Bacteria 1044
94 Ga0451806_290068 3300041462 Bacteria 760
95 Ga0451837_1335072 3300041494 Bacteria 935
96 Ga0466972_0113702 3300044658 Bacteria 1278
97 Ga0466972_0179861 3300044658 Bacteria 992
98 Ga0466972_0224377 3300044658 Bacteria 879
99 Ga0466965_0039744 3300044683 Bacteria 2314
100 Ga0466965_0059256 3300044683 Bacteria 1910
101 Ga0466965_0147113 3300044683 Bacteria 1230
102 Ga0466966_0079543 3300044684 Bacteria 2043
103 Ga0466966_0301073 3300044684 Bacteria 964
104 Ga0466961_0075142 3300044693 Bacteria 2142
105 Ga0466961_0146479 3300044693 Bacteria 1476
106 Ga0466971_0140361 3300044719 Bacteria 1125
107 Ga0466968_0090842 3300044735 Bacteria 1353
108 Ga0466968_0227578 3300044735 Bacteria 880
109 Ga0466970_0030333 3300044765 Bacteria 2851
110 Ga0466970_0117568 3300044765 Bacteria 1454
111 Ga0466970_0193542 3300044765 Bacteria 1130
112 Ga0466957_0114482 3300044842 Bacteria 1713
113 Ga0466957_0229561 3300044842 Bacteria 1228
114 Ga0466960_0114241 3300044901 Bacteria 1407
115 Ga0466959_0024100 3300045049 Bacteria 4505
116 Ga0466959_0042693 3300045049 Bacteria 3344
117 Ga0495650_0000211 3300046471 Bacteria 125248
118 Ga0495650_0096219 3300046471 Bacteria 1118
119 Ga0495645_0013214 3300046543 Bacteria 5837
120 Ga0495656_0187234 3300046615 Bacteria 1020
121 Ga0495672_0041315 3300047320 Bacteria 2790
122 Ga0495686_0180099 3300047472 Bacteria 1225
123 Ga0496101_0091378 3300048904 Bacteria 2265
124 Ga0496102_0014042 3300048905 Bacteria 6955
125 Ga0496102_0168107 3300048905 Bacteria 2064
126 Ga0496103_0200186 3300048906 Bacteria 1284
127 Ga0496104_0223044 3300048907 Bacteria 1797
128 Ga0496105_0182710 3300048908 Bacteria 1717
129 Ga0496105_0414995 3300048908 Bacteria 1066
130 Ga0496106_0984459 3300048909 Bacteria 664
131 Ga0496113_0455491 3300048916 Bacteria 1028
132 Ga0496114_0117897 3300048917 Bacteria 2280
133 Ga0496114_0200217 3300048917 Bacteria 1749
134 Ga0496114_0388069 3300048917 Bacteria 1236
135 Ga0496117_0020855 3300048920 Bacteria 5330
136 Ga0496117_0027272 3300048920 Bacteria 4453
137 Ga0496117_0086469 3300048920 Bacteria 2037
138 Ga0496117_0090413 3300048920 Bacteria 1972
139 Ga0496118_0003621 3300048921 Bacteria 19177
140 Ga0496118_0132347 3300048921 Bacteria 1599
141 Ga0496118_0238234 3300048921 Bacteria 1044
142 Ga0496119_0000553 3300048922 Bacteria 50775
143 Ga0496119_0007823 3300048922 Bacteria 9529
144 Ga0496119_0034191 3300048922 Bacteria 3354
145 Ga0496120_0004926 3300048923 Bacteria 10863
146 Ga0496121_0000046 3300048924 Bacteria 335942
147 Ga0496121_0168740 3300048924 Bacteria 1592
148 Ga0496122_0283526 3300048925 Bacteria 904
149 Ga0496125_0097542 3300048928 Bacteria 2178
150 Ga0496126_0014498 3300048929 Bacteria 7966
151 Ga0496126_0033914 3300048929 Bacteria 4801
152 Ga0496126_0098505 3300048929 Bacteria 2561
153 Ga0496126_0146769 3300048929 Bacteria 2025
154 Ga0501031_0008686 3300049568 Bacteria 6605
155 Ga0501031_0014535 3300049568 Bacteria 5119
156 Ga0501031_0440897 3300049568 Bacteria 841
157 Ga0501031_0662686 3300049568 Bacteria 670
158 Ga0501032_0004227 3300049569 Bacteria 10857
159 Ga0501032_0030435 3300049569 Bacteria 3704
160 Ga0501032_0042504 3300049569 Bacteria 3082
161 Ga0501032_0046636 3300049569 Bacteria 2928
162 Ga0501032_0525555 3300049569 Bacteria 755
163 Ga0501033_0008284 3300049570 Bacteria 8051
164 Ga0501033_0009083 3300049570 Bacteria 7669
165 Ga0501033_0021907 3300049570 Bacteria 4822
166 Ga0501033_0096971 3300049570 Bacteria 2154
167 Ga0501034_0002069 3300049571 Bacteria 25050
168 Ga0501034_0005919 3300049571 Bacteria 13268
169 Ga0501034_0015232 3300049571 Bacteria 7902
170 Ga0501034_0046985 3300049571 Bacteria 4360
171 Ga0501034_0051405 3300049571 Bacteria 4155
172 Ga0501034_0154956 3300049571 Bacteria 2266
173 Ga0501034_0182639 3300049571 Bacteria 2062
174 Ga0501034_0203666 3300049571 Bacteria 1936
175 Ga0501034_0261424 3300049571 Bacteria 1673
176 Ga0501034_0280518 3300049571 Bacteria 1605
177 Ga0501036_0013296 3300049572 Bacteria 6834
178 Ga0501036_0023300 3300049572 Bacteria 5214
179 Ga0501037_0003406 3300049573 Bacteria 11561
180 Ga0501037_0020980 3300049573 Bacteria 4827
181 Ga0501037_0067046 3300049573 Bacteria 2613
182 Ga0501037_0114281 3300049573 Bacteria 1943
183 Ga0501037_0159842 3300049573 Bacteria 1606
184 Ga0501038_0001027 3300049574 Bacteria 25180
185 Ga0501038_0045759 3300049574 Bacteria 3797
186 Ga0501038_0061007 3300049574 Bacteria 3226
187 Ga0501038_0069665 3300049574 Bacteria 2987
188 Ga0501038_0207053 3300049574 Bacteria 1571
189 Ga0501039_0004737 3300049575 Bacteria 10303
190 Ga0501039_0073973 3300049575 Bacteria 2647
191 Ga0501039_0135045 3300049575 Bacteria 1937
192 Ga0501042_0049308 3300049578 Bacteria 3003
193 Ga0501042_0525938 3300049578 Bacteria 859
194 Ga0501042_0860710 3300049578 Bacteria 660
195 Ga0501043_0003549 3300049579 Bacteria 12809
196 Ga0501043_0030636 3300049579 Bacteria 4229
197 Ga0501043_0035713 3300049579 Bacteria 3910
198 Ga0501043_0057591 3300049579 Bacteria 3051
199 Ga0501043_0082718 3300049579 Bacteria 2523
200 Ga0501046_0001009 3300049580 Bacteria 27472
201 Ga0501046_0059111 3300049580 Bacteria 3004
202 Ga0501046_0082748 3300049580 Bacteria 2478
203 Ga0501047_0013642 3300049581 Bacteria 7711
204 Ga0501047_0018363 3300049581 Bacteria 6704
205 Ga0501047_0027122 3300049581 Bacteria 5517
206 Ga0501047_0049259 3300049581 Bacteria 4068
207 Ga0501047_0062307 3300049581 Bacteria 3597
208 Ga0501048_0003662 3300049582 Bacteria 11709
209 Ga0501048_0374204 3300049582 Bacteria 1017
210 Ga0501067_0093908 3300049583 Bacteria 1665
211 Ga0501067_0108118 3300049583 Bacteria 1546
212 Ga0501067_0207539 3300049583 Bacteria 1091
213 Ga0501068_0189035 3300049584 Bacteria 1304
214 Ga0501069_0020706 3300049585 Bacteria 3566
215 Ga0501069_0134624 3300049585 Bacteria 1416
216 Ga0501070_0018645 3300049586 Bacteria 5822
217 Ga0501070_0152079 3300049586 Bacteria 1909
218 Ga0501070_0174538 3300049586 Bacteria 1770
219 Ga0501070_0259246 3300049586 Bacteria 1421
220 Ga0501070_0881290 3300049586 Bacteria 699
221 Ga0501071_0264153 3300049587 Bacteria 1300
222 Ga0501072_0631639 3300049588 Bacteria 844
223 Ga0501073_0045048 3300049589 Bacteria 3108
224 Ga0501073_0063693 3300049589 Bacteria 2571
225 Ga0501073_0083240 3300049589 Bacteria 2226
226 Ga0501073_0203267 3300049589 Bacteria 1370
227 Ga0501073_0472012 3300049589 Bacteria 867
228 Ga0501073_0984756 3300049589 Bacteria 580
229 Ga0501074_0053480 3300049590 Bacteria 2912
230 Ga0501074_0558116 3300049590 Bacteria 811
231 Ga0501079_0614601 3300049741 Bacteria 855
232 Ga0501080_0000331 3300049742 Bacteria 36170
233 Ga0501080_0061193 3300049742 Bacteria 3506
234 Ga0501083_0257445 3300049744 Bacteria 1136
235 Ga0501035_0010169 3300049822 Bacteria 8732
236 Ga0501035_0042304 3300049822 Bacteria 4109
237 Ga0501035_0054195 3300049822 Bacteria 3584
238 Ga0501035_0228208 3300049822 Bacteria 1587
239 Ga0501035_0579122 3300049822 Bacteria 917
240 Ga0501044_0045410 3300049823 Bacteria 4551
241 Ga0501044_0049292 3300049823 Bacteria 4347
242 Ga0501044_0062244 3300049823 Bacteria 3814
243 Ga0501044_0142915 3300049823 Bacteria 2380
244 Ga0501044_0166241 3300049823 Bacteria 2180
245 Ga0501044_0244173 3300049823 Bacteria 1738
246 Ga0501045_0005650 3300049824 Bacteria 8653
247 Ga0500635_0000066 3300053080 Bacteria 69274
248 Ga0500651_0000041 3300053093 Bacteria 88035
249 Ga0500650_0426628 3300053098 Bacteria 571
250 Ga0500554_086483 3300053102 Bacteria 1038
251 Ga0500628_051144 3300053129 Bacteria 981
252 Ga0500628_052920 3300053129 Bacteria 969
253 Ga0500559_0339223 3300053136 Bacteria 704
254 Ga0500559_0428287 3300053136 Bacteria 613
255 Ga0500568_0000007 3300053139 Bacteria 292579
256 Ga0500568_0004874 3300053139 Bacteria 7077
257 Ga0500573_0016530 3300053140 Bacteria 4187
258 Ga0500573_0053904 3300053140 Bacteria 2310
259 Ga0500573_0091570 3300053140 Bacteria 1717
260 Ga0500590_039436 3300053148 Bacteria 2435
261 Ga0500616_0000858 3300053153 Bacteria 33743
262 Ga0500616_0001108 3300053153 Bacteria 27854
263 Ga0500620_008514 3300053155 Bacteria 2594
264 Ga0501084_0424817 3300054114 Bacteria 1123
265 Ga0501082_1281585 3300060353 Bacteria 640
266 Ga0466962_0236903 3300061719 Bacteria 895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0374204 Ga0501048_0374204_14_430 136
2 3300049578 Ga0501042_0860710 Ga0501042_0860710_204_650 144
3 3300048921 Ga0496118_0238234 Ga0496118_0238234_146_634 145
4 3300005354 Ga0070675_101027836 Ga0070675_1010278362 147
5 3300044658 Ga0466972_0179861 Ga0466972_0179861_23_469 148
6 3300048908 Ga0496105_0182710 Ga0496105_0182710_191_637 148
7 3300048917 Ga0496114_0200217 Ga0496114_0200217_1150_1635 149
8 3300049590 Ga0501074_0558116 Ga0501074_0558116_288_752 151
9 3300048917 Ga0496114_0117897 Ga0496114_0117897_202_687 152
10 3300053098 Ga0500650_0426628 Ga0500650_0426628_11_475 153
11 3300048929 Ga0496126_0033914 Ga0496126_0033914_690_1190 154
12 3300053153 Ga0500616_0001108 Ga0500616_0001108_17446_17925 155
13 3300005355 Ga0070671_100091858 Ga0070671_1000918582 156
14 3300005543 Ga0070672_100019574 Ga0070672_1000195741 156
15 3300005563 Ga0068855_100001284 Ga0068855_10000128411 156
16 3300005618 Ga0068864_100024877 Ga0068864_1000248775 156
17 3300014325 Ga0163163_10186156 Ga0163163_101861562 156
18 3300025931 Ga0207644_10058975 Ga0207644_100589752 156
19 3300025949 Ga0207667_10000498 Ga0207667_1000049816 156
20 3300026088 Ga0207641_10083852 Ga0207641_100838522 156
21 3300048922 Ga0496119_0007823 Ga0496119_0007823_5097_5597 156
22 3300048923 Ga0496120_0004926 Ga0496120_0004926_5473_5973 156
23 3300048929 Ga0496126_0014498 Ga0496126_0014498_4985_5464 156
24 3300005563 Ga0068855_100860266 Ga0068855_1008602662 157
25 3300046471 Ga0495650_0000211 Ga0495650_0000211_87608_88090 157
26 iso_pu_bacteria 2939660829 2939661985 157
27 3300003758 Ga0055532_1011015 Ga0055532_10110152 158
28 3300003760 Ga0055527_1000004 Ga0055527_1000004313 158
29 3300003762 Ga0055542_1000019 Ga0055542_1000019101 158
30 3300003763 Ga0055529_1000008 Ga0055529_1000008264 158
31 3300005337 Ga0070682_100248684 Ga0070682_1002486842 158
32 3300009551 Ga0105238_10404000 Ga0105238_104040002 158
33 3300013105 Ga0157369_10312044 Ga0157369_103120442 158
34 3300013306 Ga0163162_10422999 Ga0163162_104229992 158
35 3300013307 Ga0157372_10442532 Ga0157372_104425322 158
36 3300025228 Ga0209672_100011 Ga0209672_100011313 158
37 3300025229 Ga0209147_100289 Ga0209147_10028935 158
38 3300025242 Ga0209258_102239 Ga0209258_1022392 158
39 3300025254 Ga0209148_1000023 Ga0209148_1000023151 158
40 3300025272 Ga0209455_1000023 Ga0209455_1000023151 158
41 3300025904 Ga0207647_10010284 Ga0207647_100102843 158
42 3300025904 Ga0207647_10297582 Ga0207647_102975821 158
43 3300046543 Ga0495645_0013214 Ga0495645_0013214_44_526 158
44 3300048904 Ga0496101_0091378 Ga0496101_0091378_1585_2061 158
45 3300048905 Ga0496102_0168107 Ga0496102_0168107_243_719 158
46 3300048906 Ga0496103_0200186 Ga0496103_0200186_628_1104 158
47 3300048907 Ga0496104_0223044 Ga0496104_0223044_910_1386 158
48 3300048908 Ga0496105_0414995 Ga0496105_0414995_79_555 158
49 3300048917 Ga0496114_0388069 Ga0496114_0388069_273_749 158
50 3300048920 Ga0496117_0086469 Ga0496117_0086469_1049_1525 158
51 3300048922 Ga0496119_0034191 Ga0496119_0034191_43_519 158
52 3300048929 Ga0496126_0098505 Ga0496126_0098505_1010_1486 158
53 3300048929 Ga0496126_0146769 Ga0496126_0146769_300_782 158
54 3300049568 Ga0501031_0014535 Ga0501031_0014535_3665_4150 158
55 3300049568 Ga0501031_0440897 Ga0501031_0440897_38_520 158
56 3300049568 Ga0501031_0662686 Ga0501031_0662686_126_611 158
57 3300049569 Ga0501032_0030435 Ga0501032_0030435_897_1382 158
58 3300049569 Ga0501032_0042504 Ga0501032_0042504_98_583 158
59 3300049570 Ga0501033_0009083 Ga0501033_0009083_2415_2897 158
60 3300049570 Ga0501033_0096971 Ga0501033_0096971_947_1432 158
61 3300049571 Ga0501034_0015232 Ga0501034_0015232_6103_6585 158
62 3300049571 Ga0501034_0261424 Ga0501034_0261424_1079_1564 158
63 3300049571 Ga0501034_0280518 Ga0501034_0280518_1011_1496 158
64 3300049572 Ga0501036_0023300 Ga0501036_0023300_197_682 158
65 3300049573 Ga0501037_0067046 Ga0501037_0067046_1932_2417 158
66 3300049573 Ga0501037_0159842 Ga0501037_0159842_100_585 158
67 3300049574 Ga0501038_0061007 Ga0501038_0061007_1129_1614 158
68 3300049574 Ga0501038_0207053 Ga0501038_0207053_82_567 158
69 3300049575 Ga0501039_0073973 Ga0501039_0073973_1473_1958 158
70 3300049578 Ga0501042_0049308 Ga0501042_0049308_989_1474 158
71 3300049578 Ga0501042_0525938 Ga0501042_0525938_361_846 158
72 3300049579 Ga0501043_0030636 Ga0501043_0030636_980_1465 158
73 3300049579 Ga0501043_0035713 Ga0501043_0035713_98_580 158
74 3300049579 Ga0501043_0082718 Ga0501043_0082718_107_592 158
75 3300049580 Ga0501046_0059111 Ga0501046_0059111_961_1446 158
76 3300049580 Ga0501046_0082748 Ga0501046_0082748_371_856 158
77 3300049581 Ga0501047_0027122 Ga0501047_0027122_4748_5233 158
78 3300049581 Ga0501047_0049259 Ga0501047_0049259_186_668 158
79 3300049581 Ga0501047_0062307 Ga0501047_0062307_1987_2472 158
80 3300049583 Ga0501067_0207539 Ga0501067_0207539_18_503 158
81 3300049584 Ga0501068_0189035 Ga0501068_0189035_142_627 158
82 3300049585 Ga0501069_0134624 Ga0501069_0134624_705_1190 158
83 3300049586 Ga0501070_0152079 Ga0501070_0152079_311_796 158
84 3300049587 Ga0501071_0264153 Ga0501071_0264153_207_692 158
85 3300049589 Ga0501073_0063693 Ga0501073_0063693_1721_2206 158
86 3300049590 Ga0501074_0053480 Ga0501074_0053480_1588_2073 158
87 3300049741 Ga0501079_0614601 Ga0501079_0614601_152_637 158
88 3300049742 Ga0501080_0061193 Ga0501080_0061193_869_1354 158
89 3300049822 Ga0501035_0010169 Ga0501035_0010169_1623_2108 158
90 3300049822 Ga0501035_0054195 Ga0501035_0054195_1389_1865 158
91 3300049822 Ga0501035_0228208 Ga0501035_0228208_109_594 158
92 3300049823 Ga0501044_0045410 Ga0501044_0045410_3637_4119 158
93 3300049823 Ga0501044_0062244 Ga0501044_0062244_1022_1507 158
94 3300049823 Ga0501044_0142915 Ga0501044_0142915_874_1359 158
95 3300049823 Ga0501044_0244173 Ga0501044_0244173_212_697 158
96 iso_pu_bacteria 2919523602 2919526289 158
97 iso_pu_bacteria 8046352972 8046354592 159
98 3300005288 Ga0065714_10010144 Ga0065714_100101444 160
99 3300005334 Ga0068869_100983039 Ga0068869_1009830392 160
100 3300006038 Ga0075365_10135986 Ga0075365_101359862 160
101 3300028794 Ga0307515_10282638 Ga0307515_102826382 160
102 3300031456 Ga0307513_10122214 Ga0307513_101222142 160
103 3300041462 Ga0451806_290068 Ga0451806_290068_181_696 160
104 3300041494 Ga0451837_1335072 Ga0451837_1335072_86_577 160
105 3300044683 Ga0466965_0059256 Ga0466965_0059256_717_1202 160
106 3300044684 Ga0466966_0301073 Ga0466966_0301073_76_561 160
107 3300044735 Ga0466968_0227578 Ga0466968_0227578_195_680 160
108 3300044765 Ga0466970_0117568 Ga0466970_0117568_220_705 160
109 3300044901 Ga0466960_0114241 Ga0466960_0114241_624_1109 160
110 3300046471 Ga0495650_0096219 Ga0495650_0096219_598_1086 160
111 3300046615 Ga0495656_0187234 Ga0495656_0187234_499_999 160
112 3300047320 Ga0495672_0041315 Ga0495672_0041315_1887_2375 160
113 3300048920 Ga0496117_0020855 Ga0496117_0020855_4434_4949 160
114 3300048921 Ga0496118_0132347 Ga0496118_0132347_747_1262 160
115 3300049568 Ga0501031_0008686 Ga0501031_0008686_153_647 160
116 3300049569 Ga0501032_0004227 Ga0501032_0004227_4705_5199 160
117 3300049569 Ga0501032_0046636 Ga0501032_0046636_891_1385 160
118 3300049570 Ga0501033_0008284 Ga0501033_0008284_985_1479 160
119 3300049570 Ga0501033_0021907 Ga0501033_0021907_2554_3048 160
120 3300049571 Ga0501034_0005919 Ga0501034_0005919_7116_7610 160
121 3300049571 Ga0501034_0051405 Ga0501034_0051405_2159_2653 160
122 3300049571 Ga0501034_0154956 Ga0501034_0154956_213_707 160
123 3300049571 Ga0501034_0182639 Ga0501034_0182639_782_1276 160
124 3300049571 Ga0501034_0203666 Ga0501034_0203666_1319_1813 160
125 3300049572 Ga0501036_0013296 Ga0501036_0013296_2886_3380 160
126 3300049573 Ga0501037_0003406 Ga0501037_0003406_3412_3906 160
127 3300049573 Ga0501037_0020980 Ga0501037_0020980_2489_2983 160
128 3300049574 Ga0501038_0001027 Ga0501038_0001027_21865_22359 160
129 3300049574 Ga0501038_0045759 Ga0501038_0045759_38_532 160
130 3300049574 Ga0501038_0069665 Ga0501038_0069665_977_1471 160
131 3300049575 Ga0501039_0004737 Ga0501039_0004737_681_1175 160
132 3300049575 Ga0501039_0135045 Ga0501039_0135045_1213_1707 160
133 3300049579 Ga0501043_0057591 Ga0501043_0057591_2128_2622 160
134 3300049580 Ga0501046_0001009 Ga0501046_0001009_20204_20698 160
135 3300049581 Ga0501047_0013642 Ga0501047_0013642_3609_4103 160
136 3300049582 Ga0501048_0003662 Ga0501048_0003662_9463_9957 160
137 3300049583 Ga0501067_0108118 Ga0501067_0108118_196_690 160
138 3300049586 Ga0501070_0174538 Ga0501070_0174538_999_1493 160
139 3300049586 Ga0501070_0259246 Ga0501070_0259246_698_1192 160
140 3300049586 Ga0501070_0881290 Ga0501070_0881290_52_546 160
141 3300049588 Ga0501072_0631639 Ga0501072_0631639_336_830 160
142 3300049589 Ga0501073_0203267 Ga0501073_0203267_797_1291 160
143 3300049589 Ga0501073_0472012 Ga0501073_0472012_145_639 160
144 3300049822 Ga0501035_0042304 Ga0501035_0042304_2328_2822 160
145 3300049822 Ga0501035_0579122 Ga0501035_0579122_251_745 160
146 3300049823 Ga0501044_0049292 Ga0501044_0049292_1160_1654 160
147 3300049823 Ga0501044_0166241 Ga0501044_0166241_1567_2061 160
148 3300049824 Ga0501045_0005650 Ga0501045_0005650_4286_4780 160
149 3300053129 Ga0500628_051144 Ga0500628_051144_378_878 160
150 3300053129 Ga0500628_052920 Ga0500628_052920_426_926 160
151 3300031911 Ga0307412_10341503 Ga0307412_103415032 161
152 3300031911 Ga0307412_10359550 Ga0307412_103595502 161
153 3300031995 Ga0307409_101983211 Ga0307409_1019832112 161
154 3300048909 Ga0496106_0984459 Ga0496106_0984459_94_588 161
155 3300048924 Ga0496121_0000046 Ga0496121_0000046_185549_186043 161
156 3300048924 Ga0496121_0168740 Ga0496121_0168740_156_671 161
157 iso_pu_bacteria 2643221616 2644097394 161
158 3300025272 Ga0209455_1004265 Ga0209455_10042652 162
159 3300044693 Ga0466961_0075142 Ga0466961_0075142_1146_1634 162
160 3300049571 Ga0501034_0046985 Ga0501034_0046985_2720_3217 162
161 3300049583 Ga0501067_0093908 Ga0501067_0093908_754_1251 162
162 3300049589 Ga0501073_0045048 Ga0501073_0045048_484_981 162
163 3300049589 Ga0501073_0984756 Ga0501073_0984756_38_535 162
164 3300053139 Ga0500568_0000007 Ga0500568_0000007_249647_250147 162
165 3300005338 Ga0068868_100036222 Ga0068868_1000362222 163
166 3300005366 Ga0070659_100003355 Ga0070659_10000335513 163
167 3300005367 Ga0070667_100047298 Ga0070667_1000472982 163
168 3300005439 Ga0070711_101607712 Ga0070711_1016077121 163
169 3300005616 Ga0068852_100274077 Ga0068852_1002740772 163
170 3300005842 Ga0068858_100000176 Ga0068858_10000017628 163
171 3300005842 Ga0068858_101254486 Ga0068858_1012544862 163
172 3300009177 Ga0105248_10000897 Ga0105248_1000089710 163
173 3300009545 Ga0105237_10004763 Ga0105237_100047632 163
174 3300009551 Ga0105238_10142813 Ga0105238_101428132 163
175 3300013105 Ga0157369_10753550 Ga0157369_107535502 163
176 3300013296 Ga0157374_10034123 Ga0157374_100341232 163
177 3300014968 Ga0157379_10068421 Ga0157379_100684213 163
178 3300025900 Ga0207710_10047942 Ga0207710_100479422 163
179 3300025909 Ga0207705_10009264 Ga0207705_100092645 163
180 3300025911 Ga0207654_10000001 Ga0207654_10000001475 163
181 3300025914 Ga0207671_10003504 Ga0207671_100035042 163
182 3300025919 Ga0207657_10007809 Ga0207657_100078093 163
183 3300025932 Ga0207690_10002616 Ga0207690_100026162 163
184 3300025941 Ga0207711_10000405 Ga0207711_1000040538 163
185 3300026023 Ga0207677_10570580 Ga0207677_105705801 163
186 3300026023 Ga0207677_10931427 Ga0207677_109314272 163
187 3300026035 Ga0207703_10000121 Ga0207703_1000012132 163
188 3300026088 Ga0207641_10022978 Ga0207641_100229782 163
189 3300028794 Ga0307515_10304762 Ga0307515_103047622 163
190 3300048905 Ga0496102_0014042 Ga0496102_0014042_2327_2818 163
191 3300048920 Ga0496117_0090413 Ga0496117_0090413_1285_1776 163
192 3300048921 Ga0496118_0003621 Ga0496118_0003621_7958_8449 163
193 3300048922 Ga0496119_0000553 Ga0496119_0000553_32677_33177 163
194 3300049569 Ga0501032_0525555 Ga0501032_0525555_89_589 163
195 3300049571 Ga0501034_0002069 Ga0501034_0002069_24129_24629 163
196 3300049573 Ga0501037_0114281 Ga0501037_0114281_469_969 163
197 3300049579 Ga0501043_0003549 Ga0501043_0003549_6429_6929 163
198 3300049581 Ga0501047_0018363 Ga0501047_0018363_5855_6355 163
199 3300049585 Ga0501069_0020706 Ga0501069_0020706_2613_3113 163
200 3300049586 Ga0501070_0018645 Ga0501070_0018645_2193_2693 163
201 3300049589 Ga0501073_0083240 Ga0501073_0083240_1644_2144 163
202 3300049742 Ga0501080_0000331 Ga0501080_0000331_7611_8111 163
203 3300049744 Ga0501083_0257445 Ga0501083_0257445_420_920 163
204 3300053093 Ga0500651_0000041 Ga0500651_0000041_76073_76573 163
205 3300053102 Ga0500554_086483 Ga0500554_086483_323_823 163
206 3300053136 Ga0500559_0428287 Ga0500559_0428287_39_539 163
207 3300053140 Ga0500573_0053904 Ga0500573_0053904_34_531 163
208 3300053148 Ga0500590_039436 Ga0500590_039436_826_1326 163
209 3300053155 Ga0500620_008514 Ga0500620_008514_240_740 163
210 3300054114 Ga0501084_0424817 Ga0501084_0424817_415_915 163
211 3300060353 Ga0501082_1281585 Ga0501082_1281585_84_584 163
212 3300009036 Ga0105244_10108179 Ga0105244_101081792 164
213 3300025937 Ga0207669_11023984 Ga0207669_110239841 164
214 3300044683 Ga0466965_0039744 Ga0466965_0039744_1798_2304 164
215 3300044683 Ga0466965_0147113 Ga0466965_0147113_325_822 164
216 3300044765 Ga0466970_0030333 Ga0466970_0030333_2040_2534 164
217 3300047472 Ga0495686_0180099 Ga0495686_0180099_195_689 164
218 3300048928 Ga0496125_0097542 Ga0496125_0097542_1228_1755 164
219 3300053080 Ga0500635_0000066 Ga0500635_0000066_35522_36022 164
220 3300003752 Ga0055539_1000014 Ga0055539_10000143 165
221 3300003756 Ga0055533_1000002 Ga0055533_1000002790 165
222 3300003759 Ga0055525_1001156 Ga0055525_10011562 165
223 3300003841 Ga0055541_1000497 Ga0055541_100049711 165
224 3300025225 Ga0209566_100056 Ga0209566_100056220 165
225 3300025226 Ga0209674_100001 Ga0209674_1000012774 165
226 3300025230 Ga0209563_100001 Ga0209563_1000012774 165
227 3300025253 Ga0209677_100001 Ga0209677_1000012774 165
228 3300044658 Ga0466972_0224377 Ga0466972_0224377_31_528 165
229 3300044684 Ga0466966_0079543 Ga0466966_0079543_1089_1586 165
230 3300044693 Ga0466961_0146479 Ga0466961_0146479_962_1459 165
231 3300044765 Ga0466970_0193542 Ga0466970_0193542_377_874 165
232 3300044842 Ga0466957_0229561 Ga0466957_0229561_674_1171 165
233 3300045049 Ga0466959_0042693 Ga0466959_0042693_1791_2288 165
234 iso_pu_bacteria 2844841374 2844844337 165
235 iso_pu_bacteria 2919055335 2919056287 165
236 iso_pu_bacteria 2928153084 2928154420 165
237 3300005329 Ga0070683_100403967 Ga0070683_1004039672 166
238 3300028794 Ga0307515_10072678 Ga0307515_100726782 166
239 3300041453 Ga0451797_0600536 Ga0451797_0600536_412_924 166
240 3300048925 Ga0496122_0283526 Ga0496122_0283526_98_622 167
241 3300005367 Ga0070667_100173368 Ga0070667_1001733681 168
242 3300009176 Ga0105242_10997429 Ga0105242_109974291 168
243 3300025230 Ga0209563_101290 Ga0209563_1012905 168
244 3300025986 Ga0207658_10127606 Ga0207658_101276061 168
245 3300053136 Ga0500559_0339223 Ga0500559_0339223_58_579 168
246 3300053139 Ga0500568_0004874 Ga0500568_0004874_278_808 168
247 3300053140 Ga0500573_0016530 Ga0500573_0016530_1153_1674 168
248 3300053140 Ga0500573_0091570 Ga0500573_0091570_262_795 168
249 3300053153 Ga0500616_0000858 Ga0500616_0000858_24760_25317 168
250 3300001979 JGI24740J21852_10007199 JGI24740J21852_100071992 169
251 3300001989 JGI24739J22299_10002217 JGI24739J22299_100022172 169
252 3300001990 JGI24737J22298_10004810 JGI24737J22298_100048102 169
253 3300002067 JGI24735J21928_10000213 JGI24735J21928_1000021315 169
254 3300003578 Ga0006562J51391_1007922 Ga0006562J51391_10079224 169
255 3300003578 Ga0006562J51391_1007923 Ga0006562J51391_10079232 169
256 3300005614 Ga0068856_100154854 Ga0068856_1001548542 169
257 3300013307 Ga0157372_10124688 Ga0157372_101246882 169
258 3300020082 Ga0206353_10737357 Ga0206353_107373572 169
259 3300025253 Ga0209677_100271 Ga0209677_10027134 169
260 3300025909 Ga0207705_10096625 Ga0207705_100966252 169
261 3300026067 Ga0207678_10281394 Ga0207678_102813942 169
262 3300026078 Ga0207702_10278122 Ga0207702_102781221 169
263 3300037312 Ga0395899_0007189 Ga0395899_0007189_2549_3064 169
264 3300037418 Ga0395900_0224186 Ga0395900_0224186_1354_1869 169
265 3300037418 Ga0395900_1223006 Ga0395900_1223006_33_548 169
266 3300044658 Ga0466972_0113702 Ga0466972_0113702_222_743 169
267 3300044719 Ga0466971_0140361 Ga0466971_0140361_319_840 169
268 3300044735 Ga0466968_0090842 Ga0466968_0090842_664_1185 169
269 3300044842 Ga0466957_0114482 Ga0466957_0114482_637_1158 169
270 3300045049 Ga0466959_0024100 Ga0466959_0024100_327_848 169
271 3300048916 Ga0496113_0455491 Ga0496113_0455491_442_951 169
272 3300048920 Ga0496117_0027272 Ga0496117_0027272_2120_2629 169
273 3300061719 Ga0466962_0236903 Ga0466962_0236903_351_872 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05258

DciA

Dna[CI] antecedent, DciA

73

160

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.883 73 149
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.8343 73 149
2wp0-assembly1.cif.gz_C-2 crystal structure of a hoba-dnaa (domain i-ii) complex from helicobacter pylori. 0.7646 90 147
2wp0-assembly1.cif.gz_D-2 crystal structure of a hoba-dnaa (domain i-ii) complex from helicobacter pylori. 0.7568 90 147
4tps-assembly1.cif.gz_B sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa 0.739 77 147
ID Description Score Start End Superfamily
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.922 58 143 3.30.300.180
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8927 58 143 3.30.300.180
2wp0C00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7646 90 147 3.30.300.180
4tpsB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.739 77 147 3.30.300.180
2y4oB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.6616 105 146 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A1W9RR97-F1-model_v4 RNA-binding protein 0.9464 58 145
AF-A0A1H8XKI3-F1-model_v4 DUF721 domain-containing protein 0.9369 57 147
AF-A0A7V5U2C0-F1-model_v4 DUF721 domain-containing protein 0.9328 75 148
AF-A0A7C0UD78-F1-model_v4 DUF721 domain-containing protein 0.9293 75 147
AF-A0A0U9HDG2-F1-model_v4 DUF721 domain-containing protein 0.9247 58 148

Feature Viewer

pLDDT pTM Quality
72.93 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map