F379348

General Info

Members Datasets Scaffolds Average Seq Length
273 141 546 244

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_411136_c1|nmdc:mga0rr50_411136_c1_30_851
Length 273
Sequence MSIAMSVMYLRCWKSGAGKQNIRSKEMPVSETLIIAALFFVGAALYASVGHGGASSYLAVMGLFSFGPDVMKPTALALNILVAAIATVKFYRAGLFKWDLFWPFAIASIPAAFVGGATALPARQYKILVGVVLLYAAVWMFRSSLRPVTREPHAPPLWAAILCGVAIGFLSGLTGVGGGIFLSPLLLYMGWSETRETSAIAAPFILVNSVSGLLGHLSSVALLPPNIPLWGAAAVIGGWIGASYGSKRAPTPVLRQLLSLVLIVAGAKLIFGS

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
122 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
123 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.37
Isolates 0.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.37
Rhizoplane 0.73
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_411136_c1 3300050513 Bacteria 1144
2 JGI24751J29686_10042579 3300002459 Unclassified 938
3 Ga0070658_10700447 3300005327 Bacteria 879
4 Ga0070676_10089750 3300005328 Bacteria 1880
5 Ga0070676_10375318 3300005328 Bacteria 983
6 Ga0070683_100001401 3300005329 Bacteria 18510
7 Ga0070683_100226926 3300005329 Bacteria 1775
8 Ga0070670_100014128 3300005331 Bacteria 6849
9 Ga0070680_100006191 3300005336 Bacteria 9076
10 Ga0070680_100012133 3300005336 Bacteria 6691
11 Ga0070680_100025937 3300005336 Bacteria 4687
12 Ga0070680_100038401 3300005336 Bacteria 3873
13 Ga0070680_100045071 3300005336 Bacteria 3584
14 Ga0070682_100001054 3300005337 Bacteria 15907
15 Ga0070682_100001401 3300005337 Bacteria 13577
16 Ga0070682_100001952 3300005337 Bacteria 11496
17 Ga0070682_100082938 3300005337 Bacteria 2079
18 Ga0070682_100148663 3300005337 Bacteria 1605
19 Ga0068868_100008045 3300005338 Bacteria 7540
20 Ga0070660_100010429 3300005339 Bacteria 6564
21 Ga0070661_100100746 3300005344 Bacteria 2148
22 Ga0070661_100191256 3300005344 Bacteria 1561
23 Ga0070692_10005802 3300005345 Bacteria 5309
24 Ga0070692_10125118 3300005345 Bacteria 1439
25 Ga0070669_100185938 3300005353 Bacteria 1628
26 Ga0070671_100000133 3300005355 Bacteria 47555
27 Ga0070674_100121589 3300005356 Bacteria 1934
28 Ga0070659_100064792 3300005366 Bacteria 2893
29 Ga0070659_100607990 3300005366 Unclassified 940
30 Ga0070701_10146946 3300005438 Bacteria 1354
31 Ga0070705_100005767 3300005440 Bacteria 6052
32 Ga0070705_100133086 3300005440 Bacteria 1625
33 Ga0070700_100133911 3300005441 Bacteria 1676
34 Ga0070694_100084094 3300005444 Bacteria 2219
35 Ga0070694_100610412 3300005444 Unclassified 879
36 Ga0070708_100001264 3300005445 Bacteria 19448
37 Ga0070708_100256341 3300005445 Unclassified 1644
38 Ga0070663_100003630 3300005455 Bacteria 8928
39 Ga0070663_100606522 3300005455 Unclassified 921
40 Ga0070678_100006084 3300005456 Bacteria 7043
41 Ga0070678_100189471 3300005456 Bacteria 1690
42 Ga0070662_100171383 3300005457 Bacteria 1704
43 Ga0070681_10015205 3300005458 Bacteria 7655
44 Ga0070681_10016476 3300005458 Bacteria 7379
45 Ga0070681_10023605 3300005458 Bacteria 6186
46 Ga0070681_10036852 3300005458 Bacteria 4910
47 Ga0070681_10082986 3300005458 Bacteria 3159
48 Ga0070681_10574947 3300005458 Unclassified 1040
49 Ga0068867_100022142 3300005459 Bacteria 4540
50 Ga0068867_100087196 3300005459 Bacteria 2363
51 Ga0068867_100185658 3300005459 Bacteria 1656
52 Ga0070707_100000485 3300005468 Bacteria 39356
53 Ga0070698_100021579 3300005471 Bacteria 6744
54 Ga0070699_100012217 3300005518 Bacteria 7410
55 Ga0070679_100000608 3300005530 Bacteria 30458
56 Ga0070679_100006010 3300005530 Bacteria 11296
57 Ga0070679_100006290 3300005530 Bacteria 11054
58 Ga0070679_100073448 3300005530 Bacteria 3412
59 Ga0070684_100000212 3300005535 Bacteria 40868
60 Ga0070684_100020331 3300005535 Bacteria 5508
61 Ga0070684_100155693 3300005535 Bacteria 2072
62 Ga0070697_100050983 3300005536 Bacteria 3362
63 Ga0070697_100207443 3300005536 Bacteria 1667
64 Ga0068853_100096212 3300005539 Bacteria 2612
65 Ga0068853_100169249 3300005539 Bacteria 1976
66 Ga0068853_100212621 3300005539 Bacteria 1763
67 Ga0070672_100010294 3300005543 Bacteria 6480
68 Ga0070686_100012939 3300005544 Bacteria 4764
69 Ga0070695_100000684 3300005545 Bacteria 18106
70 Ga0070695_100080521 3300005545 Bacteria 2153
71 Ga0070695_100137499 3300005545 Bacteria 1690
72 Ga0070695_100157241 3300005545 Bacteria 1592
73 Ga0070696_100191855 3300005546 Bacteria 1521
74 Ga0070696_100262199 3300005546 Bacteria 1311
75 Ga0070693_100006508 3300005547 Bacteria 5664
76 Ga0070693_100249243 3300005547 Bacteria 1176
77 Ga0070704_100043906 3300005549 Bacteria 3102
78 Ga0070704_100230703 3300005549 Bacteria 1510
79 Ga0068855_100003490 3300005563 Bacteria 19254
80 Ga0070664_100000279 3300005564 Bacteria 36812
81 Ga0070664_100390965 3300005564 Unclassified 1271
82 Ga0068857_100056331 3300005577 Bacteria 3488
83 Ga0070702_100018930 3300005615 Bacteria 3580
84 Ga0068866_10123453 3300005718 Bacteria 1462
85 Ga0068866_10130936 3300005718 Bacteria 1427
86 Ga0068866_10314294 3300005718 Bacteria 983
87 Ga0068860_100055478 3300005843 Plasmid 3767
88 Ga0068862_100210654 3300005844 Bacteria 1756
89 Ga0068862_100795915 3300005844 Bacteria 923
90 Ga0070712_100375859 3300006175 Bacteria 1169
91 Ga0097621_100598574 3300006237 Bacteria 1007
92 Ga0075428_100012213 3300006844 Bacteria 9550
93 Ga0075428_100090552 3300006844 Bacteria 3337
94 Ga0075428_100116036 3300006844 Bacteria 2917
95 Ga0075428_100128987 3300006844 Bacteria 2751
96 Ga0075430_100120524 3300006846 Bacteria 2187
97 Ga0075431_100000059 3300006847 Bacteria 61740
98 Ga0075431_100157067 3300006847 Bacteria 2340
99 Ga0075431_100287612 3300006847 Bacteria 1663
100 Ga0075431_100654045 3300006847 Bacteria 1031
101 Ga0075433_10102598 3300006852 Bacteria 2534
102 Ga0075434_100063853 3300006871 Bacteria 3665
103 Ga0075429_100070436 3300006880 Bacteria 3045
104 Ga0075429_100721856 3300006880 Unclassified 873
105 Ga0075436_100006862 3300006914 Bacteria 7787
106 Ga0111539_10002614 3300009094 Bacteria 23869
107 Ga0105245_10115087 3300009098 Bacteria 2506
108 Ga0105245_10621196 3300009098 Bacteria 1109
109 Ga0114129_10000323 3300009147 Bacteria 56097
110 Ga0114129_10001483 3300009147 Bacteria 31789
111 Ga0114129_10181870 3300009147 Bacteria 2860
112 Ga0114129_10222884 3300009147 Bacteria 2543
113 Ga0105243_10556429 3300009148 Bacteria 1097
114 Ga0105248_10385358 3300009177 Unclassified 1578
115 Ga0105249_10308347 3300009553 Bacteria 1590
116 Ga0157373_10023771 3300013100 Bacteria 4440
117 Ga0157373_10028689 3300013100 Bacteria 4014
118 Ga0157373_10151810 3300013100 Bacteria 1629
119 Ga0157371_10097385 3300013102 Bacteria 2085
120 Ga0157371_10117972 3300013102 Bacteria 1886
121 Ga0157374_10036285 3300013296 Bacteria 4514
122 Ga0157374_10058378 3300013296 Bacteria 3605
123 Ga0157378_10030551 3300013297 Bacteria 4761
124 Ga0157378_10042033 3300013297 Bacteria 4055
125 Ga0157378_10237759 3300013297 Bacteria 1739
126 Ga0157378_10523734 3300013297 Bacteria 1187
127 Ga0157372_10005697 3300013307 Bacteria 13258
128 Ga0163161_10338023 3300017792 Bacteria 1194
129 Ga0206353_11542035 3300020082 Bacteria 3988
130 Ga0207699_10003154 3300025906 Bacteria 7843
131 Ga0207645_10036265 3300025907 Bacteria 3166
132 Ga0207645_10058473 3300025907 Bacteria 2461
133 Ga0207705_10000320 3300025909 Bacteria 43763
134 Ga0207707_10001574 3300025912 Bacteria 21013
135 Ga0207707_10002159 3300025912 Bacteria 17785
136 Ga0207707_10003549 3300025912 Bacteria 13811
137 Ga0207707_10011982 3300025912 Bacteria 7539
138 Ga0207707_10116897 3300025912 Bacteria 2331
139 Ga0207660_10006377 3300025917 Bacteria 7645
140 Ga0207660_10030835 3300025917 Bacteria 3687
141 Ga0207660_10033867 3300025917 Bacteria 3537
142 Ga0207662_10008134 3300025918 Bacteria 5733
143 Ga0207657_10001906 3300025919 Bacteria 22540
144 Ga0207657_10034532 3300025919 Bacteria 4546
145 Ga0207652_10005220 3300025921 Bacteria 10552
146 Ga0207652_10017207 3300025921 Bacteria 5914
147 Ga0207652_10021748 3300025921 Bacteria 5297
148 Ga0207652_10080745 3300025921 Bacteria 2844
149 Ga0207652_10113554 3300025921 Bacteria 2405
150 Ga0207646_10039943 3300025922 Bacteria 4223
151 Ga0207681_10166635 3300025923 Unclassified 1666
152 Ga0207650_10224415 3300025925 Bacteria 1513
153 Ga0207644_10000256 3300025931 Bacteria 35858
154 Ga0207690_10032876 3300025932 Bacteria 3331
155 Ga0207706_10004023 3300025933 Bacteria 13910
156 Ga0207706_10333434 3300025933 Bacteria 1320
157 Ga0207704_10005985 3300025938 Bacteria 5641
158 Ga0207691_10306861 3300025940 Bacteria 1362
159 Ga0207661_10000487 3300025944 Bacteria 25531
160 Ga0207661_10710871 3300025944 Bacteria 924
161 Ga0207679_10008293 3300025945 Bacteria 6618
162 Ga0207679_10091699 3300025945 Bacteria 2352
163 Ga0207679_10138130 3300025945 Bacteria 1966
164 Ga0207667_10041488 3300025949 Bacteria 4894
165 Ga0207677_10040087 3300026023 Bacteria 3085
166 Ga0207639_10065025 3300026041 Bacteria 2830
167 Ga0207639_10269205 3300026041 Bacteria 1493
168 Ga0207639_10345684 3300026041 Bacteria 1327
169 Ga0207678_10012033 3300026067 Bacteria 7599
170 Ga0207702_10427476 3300026078 Bacteria 1282
171 Ga0207648_10007489 3300026089 Bacteria 10724
172 Ga0207648_10074122 3300026089 Bacteria 2966
173 Ga0207674_10003933 3300026116 Bacteria 18083
174 Ga0207674_10019322 3300026116 Bacteria 7382
175 Ga0207683_10001875 3300026121 Bacteria 18598
176 Ga0207683_10010952 3300026121 Bacteria 7734
177 Ga0207698_10142893 3300026142 Bacteria 2065
178 Ga0210000_1001914 3300027462 Bacteria 2944
179 Ga0209968_1003615 3300027526 Bacteria 2319
180 Ga0209974_10054774 3300027876 Bacteria 1345
181 Ga0207428_10004947 3300027907 Bacteria 12546
182 Ga0268265_10087871 3300028380 Bacteria 2475
183 Ga0268265_10510156 3300028380 Bacteria 1135
184 Ga0268264_10039956 3300028381 Plasmid 3876
185 Ga0307408_100009294 3300031548 Bacteria 6481
186 Ga0307408_100082962 3300031548 Bacteria 2400
187 Ga0307408_100132819 3300031548 Bacteria 1944
188 Ga0307408_100174431 3300031548 Bacteria 1719
189 Ga0307413_10000431 3300031824 Bacteria 13601
190 Ga0307413_10067736 3300031824 Bacteria 2233
191 Ga0307413_10078467 3300031824 Bacteria 2107
192 Ga0307413_10185223 3300031824 Bacteria 1489
193 Ga0307413_10316853 3300031824 Bacteria 1190
194 Ga0307410_10000444 3300031852 Bacteria 16606
195 Ga0307410_10000821 3300031852 Bacteria 13174
196 Ga0307410_10042516 3300031852 Bacteria 3005
197 Ga0307410_10093182 3300031852 Bacteria 2143
198 Ga0307410_10173604 3300031852 Bacteria 1626
199 Ga0307410_10297518 3300031852 Bacteria 1272
200 Ga0307406_10001129 3300031901 Bacteria 14919
201 Ga0307407_10000292 3300031903 Bacteria 14791
202 Ga0307407_10057767 3300031903 Bacteria 2252
203 Ga0307407_10155983 3300031903 Bacteria 1489
204 Ga0307407_10199421 3300031903 Bacteria 1340
205 Ga0307407_10548747 3300031903 Bacteria 854
206 Ga0307412_10038009 3300031911 Bacteria 3096
207 Ga0307412_10039638 3300031911 Bacteria 3043
208 Ga0307412_10422046 3300031911 Unclassified 1091
209 Ga0307409_100044578 3300031995 Bacteria 3342
210 Ga0307409_100108060 3300031995 Bacteria 2326
211 Ga0307409_100417587 3300031995 Bacteria 1286
212 Ga0307416_100000907 3300032002 Bacteria 15650
213 Ga0307416_100001316 3300032002 Bacteria 13373
214 Ga0307416_100026824 3300032002 Bacteria 4253
215 Ga0307416_100060894 3300032002 Bacteria 3077
216 Ga0307416_100114312 3300032002 Bacteria 2388
217 Ga0307416_100150587 3300032002 Bacteria 2133
218 Ga0307416_100347794 3300032002 Bacteria 1499
219 Ga0307416_100435969 3300032002 Bacteria 1359
220 Ga0307416_101081804 3300032002 Bacteria 906
221 Ga0307414_10000594 3300032004 Bacteria 18638
222 Ga0307414_10025555 3300032004 Bacteria 3785
223 Ga0307414_10072054 3300032004 Bacteria 2495
224 Ga0307414_10078395 3300032004 Bacteria 2408
225 Ga0307414_10084371 3300032004 Bacteria 2336
226 Ga0307414_10476861 3300032004 Unclassified 1099
227 Ga0307411_10001883 3300032005 Bacteria 8938
228 Ga0307411_10015831 3300032005 Bacteria 4249
229 Ga0307411_10272373 3300032005 Bacteria 1343
230 Ga0307415_100000233 3300032126 Bacteria 24396
231 Ga0307415_100117316 3300032126 Bacteria 1988
232 Ga0307415_100120357 3300032126 Bacteria 1967
233 Ga0307415_100168342 3300032126 Bacteria 1706
234 Ga0307415_100249435 3300032126 Bacteria 1441
235 Ga0373939_0061068 3300035114 Bacteria 1200
236 Ga0373941_0003349 3300035115 Bacteria 3622
237 Ga0373942_0106426 3300035207 Unclassified 863
238 Ga0373931_0137569 3300035691 Bacteria 1411
239 Ga0373947_0104312 3300035725 Bacteria 1785
240 Ga0373947_0472103 3300035725 Unclassified 851
241 Ga0395905_0619675 3300037471 Unclassified 984
242 Ga0451807_0231273 3300041486 Bacteria 1633
243 Ga0451839_1324587 3300041496 Bacteria 2441
244 Ga0439441_000556 3300042001 Bacteria 4136
245 Ga0439443_010530 3300042003 Bacteria 1341
246 Ga0450898_014892 3300042134 Bacteria 1312
247 Ga0439435_0050676 3300042436 Bacteria 1187
248 Ga0495588_0024111 3300046674 Unclassified 3020
249 Ga0496112_0010719 3300048915 Bacteria 8333
250 Ga0501037_0166351 3300049573 Bacteria 1570
251 Ga0501039_0053679 3300049575 Bacteria 3119
252 Ga0501040_0324515 3300049576 Bacteria 1101
253 Ga0501073_0055706 3300049589 Bacteria 2766
254 Ga0501081_0107173 3300049743 Bacteria 1981
255 nmdc:mga05p37_191310_c1 3300050507 Bacteria 2484
256 nmdc:mga05p37_1_c1 3300050507 Bacteria 177088
257 nmdc:mga05p37_285_c1 3300050507 Bacteria 52916
258 nmdc:mga05p37_403604_c1 3300050507 Bacteria 1595
259 nmdc:mga09592_263361_c1 3300050508 Bacteria 1495
260 nmdc:mga09592_727398_c1 3300050508 Bacteria 843
261 nmdc:mga0qj67_79466_c2 3300050509 Bacteria 2310
262 nmdc:mga06r32_118_c1 3300050510 Bacteria 56778
263 nmdc:mga06r32_157406_c1 3300050510 Bacteria 2253
264 nmdc:mga06r32_56901_c1 3300050510 Bacteria 3755
265 nmdc:mga06r32_749526_c1 3300050510 Bacteria 940
266 nmdc:mga08y16_26138_c1 3300050511 Bacteria 6157
267 nmdc:mga08y16_303_c1 3300050511 Bacteria 44322
268 nmdc:mga0n895_3867_c1 3300050512 Bacteria 12157
269 nmdc:mga08x19_27345_c1 3300050514 Bacteria 3567
270 nmdc:mga08x19_4952_c1 3300050514 Bacteria 7865
271 nmdc:mga0a205_6045_c1 3300050515 Bacteria 10919
272 Ga0501082_0299290 3300060353 Bacteria 1401
273 2841970740 2841966195 Bacteria 8673214
274 nmdc:mga0rr50_411136_c1
275 JGI24751J29686_10042579
276 Ga0070658_10700447
277 Ga0070676_10089750
278 Ga0070676_10375318
279 Ga0070683_100001401
280 Ga0070683_100226926
281 Ga0070670_100014128
282 Ga0070680_100006191
283 Ga0070680_100012133
284 Ga0070680_100025937
285 Ga0070680_100038401
286 Ga0070680_100045071
287 Ga0070682_100001054
288 Ga0070682_100001401
289 Ga0070682_100001952
290 Ga0070682_100082938
291 Ga0070682_100148663
292 Ga0068868_100008045
293 Ga0070660_100010429
294 Ga0070661_100100746
295 Ga0070661_100191256
296 Ga0070692_10005802
297 Ga0070692_10125118
298 Ga0070669_100185938
299 Ga0070671_100000133
300 Ga0070674_100121589
301 Ga0070659_100064792
302 Ga0070659_100607990
303 Ga0070701_10146946
304 Ga0070705_100005767
305 Ga0070705_100133086
306 Ga0070700_100133911
307 Ga0070694_100084094
308 Ga0070694_100610412
309 Ga0070708_100001264
310 Ga0070708_100256341
311 Ga0070663_100003630
312 Ga0070663_100606522
313 Ga0070678_100006084
314 Ga0070678_100189471
315 Ga0070662_100171383
316 Ga0070681_10015205
317 Ga0070681_10016476
318 Ga0070681_10023605
319 Ga0070681_10036852
320 Ga0070681_10082986
321 Ga0070681_10574947
322 Ga0068867_100022142
323 Ga0068867_100087196
324 Ga0068867_100185658
325 Ga0070707_100000485
326 Ga0070698_100021579
327 Ga0070699_100012217
328 Ga0070679_100000608
329 Ga0070679_100006010
330 Ga0070679_100006290
331 Ga0070679_100073448
332 Ga0070684_100000212
333 Ga0070684_100020331
334 Ga0070684_100155693
335 Ga0070697_100050983
336 Ga0070697_100207443
337 Ga0068853_100096212
338 Ga0068853_100169249
339 Ga0068853_100212621
340 Ga0070672_100010294
341 Ga0070686_100012939
342 Ga0070695_100000684
343 Ga0070695_100080521
344 Ga0070695_100137499
345 Ga0070695_100157241
346 Ga0070696_100191855
347 Ga0070696_100262199
348 Ga0070693_100006508
349 Ga0070693_100249243
350 Ga0070704_100043906
351 Ga0070704_100230703
352 Ga0068855_100003490
353 Ga0070664_100000279
354 Ga0070664_100390965
355 Ga0068857_100056331
356 Ga0070702_100018930
357 Ga0068866_10123453
358 Ga0068866_10130936
359 Ga0068866_10314294
360 Ga0068860_100055478
361 Ga0068862_100210654
362 Ga0068862_100795915
363 Ga0070712_100375859
364 Ga0097621_100598574
365 Ga0075428_100012213
366 Ga0075428_100090552
367 Ga0075428_100116036
368 Ga0075428_100128987
369 Ga0075430_100120524
370 Ga0075431_100000059
371 Ga0075431_100157067
372 Ga0075431_100287612
373 Ga0075431_100654045
374 Ga0075433_10102598
375 Ga0075434_100063853
376 Ga0075429_100070436
377 Ga0075429_100721856
378 Ga0075436_100006862
379 Ga0111539_10002614
380 Ga0105245_10115087
381 Ga0105245_10621196
382 Ga0114129_10000323
383 Ga0114129_10001483
384 Ga0114129_10181870
385 Ga0114129_10222884
386 Ga0105243_10556429
387 Ga0105248_10385358
388 Ga0105249_10308347
389 Ga0157373_10023771
390 Ga0157373_10028689
391 Ga0157373_10151810
392 Ga0157371_10097385
393 Ga0157371_10117972
394 Ga0157374_10036285
395 Ga0157374_10058378
396 Ga0157378_10030551
397 Ga0157378_10042033
398 Ga0157378_10237759
399 Ga0157378_10523734
400 Ga0157372_10005697
401 Ga0163161_10338023
402 Ga0206353_11542035
403 Ga0207699_10003154
404 Ga0207645_10036265
405 Ga0207645_10058473
406 Ga0207705_10000320
407 Ga0207707_10001574
408 Ga0207707_10002159
409 Ga0207707_10003549
410 Ga0207707_10011982
411 Ga0207707_10116897
412 Ga0207660_10006377
413 Ga0207660_10030835
414 Ga0207660_10033867
415 Ga0207662_10008134
416 Ga0207657_10001906
417 Ga0207657_10034532
418 Ga0207652_10005220
419 Ga0207652_10017207
420 Ga0207652_10021748
421 Ga0207652_10080745
422 Ga0207652_10113554
423 Ga0207646_10039943
424 Ga0207681_10166635
425 Ga0207650_10224415
426 Ga0207644_10000256
427 Ga0207690_10032876
428 Ga0207706_10004023
429 Ga0207706_10333434
430 Ga0207704_10005985
431 Ga0207691_10306861
432 Ga0207661_10000487
433 Ga0207661_10710871
434 Ga0207679_10008293
435 Ga0207679_10091699
436 Ga0207679_10138130
437 Ga0207667_10041488
438 Ga0207677_10040087
439 Ga0207639_10065025
440 Ga0207639_10269205
441 Ga0207639_10345684
442 Ga0207678_10012033
443 Ga0207702_10427476
444 Ga0207648_10007489
445 Ga0207648_10074122
446 Ga0207674_10003933
447 Ga0207674_10019322
448 Ga0207683_10001875
449 Ga0207683_10010952
450 Ga0207698_10142893
451 Ga0210000_1001914
452 Ga0209968_1003615
453 Ga0209974_10054774
454 Ga0207428_10004947
455 Ga0268265_10087871
456 Ga0268265_10510156
457 Ga0268264_10039956
458 Ga0307408_100009294
459 Ga0307408_100082962
460 Ga0307408_100132819
461 Ga0307408_100174431
462 Ga0307413_10000431
463 Ga0307413_10067736
464 Ga0307413_10078467
465 Ga0307413_10185223
466 Ga0307413_10316853
467 Ga0307410_10000444
468 Ga0307410_10000821
469 Ga0307410_10042516
470 Ga0307410_10093182
471 Ga0307410_10173604
472 Ga0307410_10297518
473 Ga0307406_10001129
474 Ga0307407_10000292
475 Ga0307407_10057767
476 Ga0307407_10155983
477 Ga0307407_10199421
478 Ga0307407_10548747
479 Ga0307412_10038009
480 Ga0307412_10039638
481 Ga0307412_10422046
482 Ga0307409_100044578
483 Ga0307409_100108060
484 Ga0307409_100417587
485 Ga0307416_100000907
486 Ga0307416_100001316
487 Ga0307416_100026824
488 Ga0307416_100060894
489 Ga0307416_100114312
490 Ga0307416_100150587
491 Ga0307416_100347794
492 Ga0307416_100435969
493 Ga0307416_101081804
494 Ga0307414_10000594
495 Ga0307414_10025555
496 Ga0307414_10072054
497 Ga0307414_10078395
498 Ga0307414_10084371
499 Ga0307414_10476861
500 Ga0307411_10001883
501 Ga0307411_10015831
502 Ga0307411_10272373
503 Ga0307415_100000233
504 Ga0307415_100117316
505 Ga0307415_100120357
506 Ga0307415_100168342
507 Ga0307415_100249435
508 Ga0373939_0061068
509 Ga0373941_0003349
510 Ga0373942_0106426
511 Ga0373931_0137569
512 Ga0373947_0104312
513 Ga0373947_0472103
514 Ga0395905_0619675
515 Ga0451807_0231273
516 Ga0451839_1324587
517 Ga0439441_000556
518 Ga0439443_010530
519 Ga0450898_014892
520 Ga0439435_0050676
521 Ga0495588_0024111
522 Ga0496112_0010719
523 Ga0501037_0166351
524 Ga0501039_0053679
525 Ga0501040_0324515
526 Ga0501073_0055706
527 Ga0501081_0107173
528 nmdc:mga05p37_191310_c1
529 nmdc:mga05p37_1_c1
530 nmdc:mga05p37_285_c1
531 nmdc:mga05p37_403604_c1
532 nmdc:mga09592_263361_c1
533 nmdc:mga09592_727398_c1
534 nmdc:mga0qj67_79466_c2
535 nmdc:mga06r32_118_c1
536 nmdc:mga06r32_157406_c1
537 nmdc:mga06r32_56901_c1
538 nmdc:mga06r32_749526_c1
539 nmdc:mga08y16_26138_c1
540 nmdc:mga08y16_303_c1
541 nmdc:mga0n895_3867_c1
542 nmdc:mga08x19_27345_c1
543 nmdc:mga08x19_4952_c1
544 nmdc:mga0a205_6045_c1
545 Ga0501082_0299290
546 2841970740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

34

269

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5519 31 270
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5459 28 267
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5271 31 270
6qsk-assembly2.cif.gz_G-2 crystal structure of a nucleotide sugar transporter with bound nucleotide monophosphate. 0.3457 45 267
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.3396 99 269
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4839 97 267 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4583 97 267 1.20.1250.20
af_Q55EC8_162_384_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.431 57 269 1.20.1250.20
af_Q9LEV7_56_469_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4175 37 270 1.20.1250.20
af_Q4D8Q4_1_375_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.417 34 267 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A537MI29-F1-model_v4 Probable membrane transporter protein 0.9735 25 270 GO:0005886
AF-A0A537MI29-F1-model_v4 Probable membrane transporter protein 0.9696 25 270 GO:0005886
AF-A0A517TX77-F1-model_v4 Probable membrane transporter protein 0.9674 25 268 GO:0005886
AF-A0A1W9IN95-F1-model_v4 deleted 0.9658 25 267
AF-A0A2E1LAT4-F1-model_v4 Probable membrane transporter protein 0.9607 29 269 GO:0005886

Map