F379249

General Info

Members Datasets Scaffolds Average Seq Length
273 194 243 129

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0013953|Ga0495668_0013953_2650_3117
Length 155
Sequence MGIKLTAMVSPRTGHRSYFSSLNLNSMTPKRIWANLAVSNLERTTKFYTALGFKANGTPNKELTSFLFGEGKFIIHFFLKDVLKAFLKSEISDSQQANEIIFTLSAETKDQVDSWAKEVEEAGGIIVSRPEAFGEGYYGFVFADPDGHKFNVFYM

Samples

Sample ID Description Type Environment
1 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
2 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
3 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
4 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
5 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
6 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
7 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
8 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
9 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
10 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
11 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
12 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
13 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
14 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
15 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
16 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
17 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
18 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
19 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
20 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
21 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
22 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
23 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
24 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
25 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
26 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
27 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
28 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
29 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
38 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
50 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
115 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
116 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
117 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
118 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
158 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
159 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
162 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
163 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
164 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
165 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
166 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
169 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
170 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
176 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
179 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
180 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
189 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
190 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
191 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
192 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
193 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
194 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.64
Metatranscriptomes 0.37
Isolates 10.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.15
Nodule 0.37
Rhizoplane 2.2
Rhizosphere 60.07
Stem 0
Stem Tuber 0
Unclassified 17.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002426 3300001989 Bacteria 7194
2 JGI24739J22299_10056179 3300001989 Unclassified 1256
3 JGI25154J39366_1000025 3300002738 Bacteria 211189
4 JGI25157J39369_1004218 3300002741 Bacteria 2671
5 JGI25153J46596_10013969 3300003215 Unclassified 3367
6 JGI25153J46596_10017948 3300003215 Unclassified 2767
7 JGI25153J46596_10032332 3300003215 Bacteria 1746
8 JGI25153J46596_10057212 3300003215 Unclassified 1080
9 rootH2_10016090 3300003320 Bacteria 3238
10 rootL2_10055485 3300003322 Bacteria 17147
11 rootL2_10155383 3300003322 Unclassified 1304
12 rootH1_10047570 3300003323 Bacteria 3590
13 rootH1_10136306 3300003323 Bacteria 3682
14 rootH1_10220112 3300003323 Bacteria 3385
15 rootH1_10370527 3300003323 Unclassified 1112
16 JGI25160J50197_1004070 3300003354 Bacteria 6363
17 JGI25160J50197_1007037 3300003354 Bacteria 4455
18 Ga0006562J51391_1050289 3300003578 Bacteria 795
19 Ga0055526_1011279 3300003771 Unclassified 4049
20 Ga0055526_1029048 3300003771 Bacteria 1654
21 Ga0055534_1004472 3300003784 Bacteria 4040
22 Ga0055528_1002094 3300003790 Bacteria 11066
23 Ga0055531_10000139 3300003794 Bacteria 82993
24 Ga0055543_1013035 3300004625 Bacteria 1653
25 Ga0065165_1000038 3300005262 Bacteria 211664
26 Ga0065704_10001223 3300005289 Bacteria 8835
27 Ga0070658_10031923 3300005327 Bacteria 4232
28 Ga0070658_11058183 3300005327 Unclassified 706
29 Ga0070682_100000705 3300005337 Bacteria 20112
30 Ga0070660_100478722 3300005339 Bacteria 1034
31 Ga0070668_100246962 3300005347 Bacteria 1480
32 Ga0070669_101395427 3300005353 Bacteria 608
33 Ga0070659_100177847 3300005366 Bacteria 1745
34 Ga0070681_10123773 3300005458 Bacteria 2518
35 Ga0070679_100790385 3300005530 Bacteria 892
36 Ga0070679_101172668 3300005530 Bacteria 713
37 Ga0068853_100889175 3300005539 Bacteria 855
38 Ga0070665_100003215 3300005548 Bacteria 17572
39 Ga0068855_100033157 3300005563 Bacteria 6165
40 Ga0068855_100822956 3300005563 Bacteria 986
41 Ga0070664_101692631 3300005564 Bacteria 599
42 Ga0068857_100134262 3300005577 Bacteria 2234
43 Ga0075366_10080199 3300006195 Bacteria 1949
44 Ga0075428_100795518 3300006844 Bacteria 1005
45 Ga0105244_10000164 3300009036 Bacteria 68570
46 Ga0105243_10000004 3300009148 Bacteria 601266
47 Ga0105243_10001078 3300009148 Bacteria 24973
48 Ga0105241_12609080 3300009174 Bacteria 508
49 Ga0105239_10157270 3300010375 Bacteria 2539
50 Ga0105239_11376742 3300010375 Bacteria 814
51 Ga0157323_1002096 3300012495 Unclassified 1078
52 Ga0157373_10175866 3300013100 Bacteria 1507
53 Ga0157373_10222910 3300013100 Bacteria 1330
54 Ga0157373_10363991 3300013100 Bacteria 1033
55 Ga0157371_10030074 3300013102 Bacteria 3920
56 Ga0157371_10542952 3300013102 Bacteria 861
57 Ga0157370_10007144 3300013104 Bacteria 12182
58 Ga0157370_10164386 3300013104 Bacteria 2064
59 Ga0157370_10395826 3300013104 Bacteria 1272
60 Ga0157369_10353316 3300013105 Bacteria 1526
61 Ga0157372_10035741 3300013307 Bacteria 5471
62 Ga0157372_10588431 3300013307 Bacteria 1297
63 Ga0157372_10781521 3300013307 Bacteria 1110
64 Ga0157372_10958970 3300013307 Unclassified 991
65 Ga0157372_12462723 3300013307 Bacteria 597
66 Ga0163163_10091785 3300014325 Bacteria 3052
67 Ga0182006_1000011 3300015261 Bacteria 408647
68 Ga0209646_1000037 3300025246 Bacteria 355116
69 Ga0209026_1000256 3300025250 Bacteria 66551
70 Ga0209673_1000123 3300025273 Bacteria 169208
71 Ga0209673_1018188 3300025273 Unclassified 2566
72 Ga0209675_1000033 3300025291 Bacteria 271576
73 Ga0209564_1001874 3300025295 Bacteria 18963
74 Ga0209564_1028587 3300025295 Bacteria 1778
75 Ga0209758_1012319 3300025297 Bacteria 4800
76 Ga0209758_1015091 3300025297 Bacteria 4035
77 Ga0209758_1046491 3300025297 Bacteria 1564
78 Ga0209758_1050832 3300025297 Bacteria 1449
79 Ga0209050_1000692 3300025298 Bacteria 50268
80 Ga0207426_1000489 3300025302 Bacteria 59657
81 Ga0207426_1001681 3300025302 Bacteria 17099
82 Ga0207426_1010128 3300025302 Unclassified 3681
83 Ga0209051_1032548 3300025303 Bacteria 1987
84 Ga0209257_1000025 3300025304 Bacteria 724838
85 Ga0207655_1006304 3300025728 Bacteria 7885
86 Ga0207647_10077212 3300025904 Unclassified 2002
87 Ga0207705_10871110 3300025909 Bacteria 698
88 Ga0207695_11200348 3300025913 Unclassified 639
89 Ga0207660_11024798 3300025917 Bacteria 673
90 Ga0207657_10599518 3300025919 Bacteria 860
91 Ga0207652_10025915 3300025921 Bacteria 4878
92 Ga0207652_10459640 3300025921 Bacteria 1147
93 Ga0207652_10859464 3300025921 Bacteria 803
94 Ga0207690_10476405 3300025932 Unclassified 1007
95 Ga0207709_10000010 3300025935 Bacteria 601305
96 Ga0207709_10061190 3300025935 Bacteria 2351
97 Ga0207667_10087498 3300025949 Bacteria 3222
98 Ga0207667_10222471 3300025949 Unclassified 1934
99 Ga0207667_10713345 3300025949 Unclassified 1005
100 Ga0207639_10328086 3300026041 Bacteria 1361
101 Ga0207639_10893351 3300026041 Bacteria 830
102 Ga0207648_12197293 3300026089 Bacteria 513
103 Ga0207676_10801801 3300026095 Unclassified 919
104 Ga0207674_10028979 3300026116 Bacteria 5836
105 Ga0207674_11098818 3300026116 Unclassified 764
106 Ga0268266_10003519 3300028379 Bacteria 15544
107 Ga0307515_10123139 3300028794 Bacteria 2919
108 Ga0307513_10054261 3300031456 Bacteria 4299
109 Ga0307508_10009948 3300031616 Bacteria 8718
110 Ga0307405_10581855 3300031731 Bacteria 911
111 Ga0307413_10549024 3300031824 Bacteria 937
112 Ga0307413_11223361 3300031824 Unclassified 654
113 Ga0307406_10131044 3300031901 Bacteria 1760
114 Ga0307406_10521421 3300031901 Unclassified 967
115 Ga0307412_10000012 3300031911 Bacteria 404180
116 Ga0307409_100929028 3300031995 Bacteria 885
117 Ga0307416_100000039 3300032002 Bacteria 133298
118 Ga0307414_10000224 3300032004 Bacteria 37374
119 Ga0307414_10024147 3300032004 Bacteria 3871
120 Ga0307414_10024385 3300032004 Bacteria 3857
121 Ga0307414_10031088 3300032004 Unclassified 3497
122 Ga0307414_10038359 3300032004 Bacteria 3217
123 Ga0307414_10086896 3300032004 Bacteria 2309
124 Ga0307414_10111756 3300032004 Bacteria 2081
125 Ga0307414_10522558 3300032004 Bacteria 1054
126 Ga0307414_11993461 3300032004 Bacteria 542
127 Ga0373945_0080357 3300035116 Bacteria 1248
128 Ga0373927_0120953 3300035695 Bacteria 1708
129 Ga0395899_0000006 3300037312 Bacteria 666341
130 Ga0395899_0006559 3300037312 Bacteria 9023
131 Ga0395900_0112247 3300037418 Bacteria 2799
132 Ga0395900_0217466 3300037418 Bacteria 1927
133 Ga0395898_0011579 3300037466 Bacteria 9158
134 Ga0395901_0002099 3300038443 Bacteria 20468
135 Ga0395901_0017211 3300038443 Bacteria 7375
136 Ga0439465_0017203 3300041413 Bacteria 2256
137 Ga0439465_0071163 3300041413 Bacteria 1166
138 Ga0451793_0268753 3300041452 Bacteria 628
139 Ga0451793_0443989 3300041452 Bacteria 1437
140 Ga0451797_0131841 3300041453 Bacteria 514
141 Ga0451833_0223653 3300041491 Bacteria 1133
142 Ga0451851_0350033 3300041507 Bacteria 836
143 Ga0451843_0555739 3300041509 Bacteria 914
144 Ga0439433_0154481 3300041999 Bacteria 592
145 Ga0466972_0050000 3300044658 Bacteria 2019
146 Ga0466968_0029117 3300044735 Bacteria 2282
147 Ga0466968_0328643 3300044735 Bacteria 740
148 Ga0466970_0766182 3300044765 Bacteria 564
149 Ga0466957_0947111 3300044842 Bacteria 617
150 Ga0466959_0066689 3300045049 Bacteria 2611
151 Ga0495627_000002 3300046453 Bacteria 903861
152 Ga0495627_003072 3300046453 Bacteria 7589
153 Ga0495627_012329 3300046453 Bacteria 3039
154 Ga0495638_0221222 3300046460 Bacteria 1058
155 Ga0495638_0532090 3300046460 Bacteria 587
156 Ga0495596_0001419 3300046500 Bacteria 13745
157 Ga0495606_0027813 3300046507 Bacteria 4001
158 Ga0495606_0032880 3300046507 Bacteria 3586
159 Ga0495610_0000001 3300046512 Bacteria 1620061
160 Ga0495632_0004920 3300046519 Bacteria 8959
161 Ga0495632_0097264 3300046519 Bacteria 1390
162 Ga0495643_0025644 3300046522 Bacteria 3334
163 Ga0495654_0000001 3300046530 Bacteria 1513197
164 Ga0495633_0000005 3300046558 Bacteria 357644
165 Ga0495633_0000008 3300046558 Bacteria 301830
166 Ga0495633_0001538 3300046558 Bacteria 17716
167 Ga0495668_0013953 3300046616 Bacteria 4723
168 Ga0495668_0255455 3300046616 Unclassified 959
169 Ga0495625_0008088 3300046660 Bacteria 9020
170 Ga0495625_0138157 3300046660 Bacteria 1646
171 Ga0495625_0655033 3300046660 Bacteria 625
172 Ga0495660_0025915 3300046810 Bacteria 3326
173 Ga0495686_0000118 3300047472 Bacteria 165897
174 Ga0495686_0005553 3300047472 Bacteria 9917
175 Ga0496102_0028993 3300048905 Bacteria 4948
176 Ga0496103_0091848 3300048906 Bacteria 1916
177 Ga0496105_0139516 3300048908 Bacteria 1996
178 Ga0496116_0000022 3300048919 Bacteria 482506
179 Ga0496117_0000064 3300048920 Bacteria 254248
180 Ga0496118_0003294 3300048921 Bacteria 20529
181 Ga0496119_0000025 3300048922 Bacteria 257069
182 Ga0496120_0089202 3300048923 Bacteria 1651
183 Ga0496121_0237340 3300048924 Bacteria 1273
184 Ga0496122_0001362 3300048925 Bacteria 39760
185 Ga0496122_0001579 3300048925 Bacteria 35800
186 Ga0496122_0002590 3300048925 Bacteria 25350
187 Ga0496123_0000897 3300048926 Bacteria 47137
188 Ga0496123_0071424 3300048926 Bacteria 2165
189 Ga0496123_0221304 3300048926 Bacteria 954
190 Ga0496124_0000287 3300048927 Bacteria 95238
191 Ga0496125_0000662 3300048928 Bacteria 57446
192 Ga0496125_0025978 3300048928 Bacteria 5349
193 Ga0496125_0597226 3300048928 Bacteria 603
194 Ga0496126_0001868 3300048929 Bacteria 30681
195 Ga0496126_0118361 3300048929 Bacteria 2300
196 Ga0501033_0016432 3300049570 Bacteria 5606
197 Ga0501033_0679165 3300049570 Unclassified 702
198 Ga0501034_0898994 3300049571 Bacteria 773
199 Ga0501070_0766595 3300049586 Bacteria 759
200 Ga0501072_0734895 3300049588 Bacteria 775
201 Ga0501202_039878 3300049652 Bacteria 1011
202 Ga0501217_115037 3300049661 Bacteria 776
203 Ga0501233_145140 3300049668 Bacteria 658
204 Ga0501235_167384 3300049669 Bacteria 579
205 Ga0501242_000533 3300049674 Bacteria 3385
206 Ga0501250_025804 3300049680 Bacteria 789
207 Ga0501253_011739 3300049683 Bacteria 1355
208 Ga0501257_236634 3300049686 Bacteria 537
209 Ga0501259_012495 3300049688 Bacteria 1417
210 Ga0501245_109832 3300049708 Bacteria 569
211 Ga0501080_0546508 3300049742 Unclassified 1032
212 Ga0501241_000013 3300049758 Bacteria 104728
213 Ga0501268_033316 3300049765 Bacteria 942
214 Ga0501269_000241 3300049766 Bacteria 16034
215 Ga0501035_0091424 3300049822 Bacteria 2679
216 Ga0501044_0137662 3300049823 Bacteria 2432
217 Ga0501204_001258 3300049850 Unclassified 2449
218 Ga0500578_0000074 3300053086 Bacteria 109442
219 Ga0500578_0081536 3300053086 Bacteria 2057
220 Ga0500644_0000415 3300053088 Bacteria 20101
221 Ga0500646_0076739 3300053090 Bacteria 1012
222 Ga0500651_0302727 3300053093 Bacteria 917
223 Ga0500562_023474 3300053108 Unclassified 1610
224 Ga0500562_180171 3300053108 Bacteria 574
225 Ga0500569_002250 3300053109 Bacteria 3776
226 Ga0500607_269518 3300053121 Bacteria 659
227 Ga0500652_002791 3300053131 Bacteria 5275
228 Ga0500559_0067645 3300053136 Bacteria 1604
229 Ga0500568_0011902 3300053139 Bacteria 4016
230 Ga0500568_0050490 3300053139 Bacteria 1639
231 Ga0500590_027347 3300053148 Bacteria 2958
232 Ga0500604_0118670 3300053151 Bacteria 883
233 Ga0500604_0256217 3300053151 Bacteria 606
234 Ga0500616_0028292 3300053153 Bacteria 3090
235 Ga0500622_0000010 3300053156 Bacteria 398804
236 Ga0500622_0000035 3300053156 Bacteria 182924
237 Ga0500622_0202260 3300053156 Bacteria 903
238 Ga0500627_0431384 3300053158 Bacteria 557
239 Ga0500633_0000800 3300053160 Bacteria 5378
240 Ga0500634_0042490 3300053161 Bacteria 2466
241 Ga0500639_319734 3300053163 Bacteria 570
242 Ga0500636_0091885 3300053177 Bacteria 1737
243 Ga0500656_044716 3300053732 Unclassified 629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0546508 Ga0501080_0546508_591_1004 111
2 3300041453 Ga0451797_0131841 Ga0451797_0131841_80_433 117
3 3300046460 Ga0495638_0532090 Ga0495638_0532090_205_558 117
4 3300049661 Ga0501217_115037 Ga0501217_115037_404_757 117
5 3300049686 Ga0501257_236634 Ga0501257_236634_19_372 117
6 3300049765 Ga0501268_033316 Ga0501268_033316_15_368 117
7 iso_pu_bacteria 2751185877 2753672506 120
8 iso_pu_bacteria 2585428115 2587942982 123
9 iso_pu_bacteria 2585428187 2588233555 123
10 iso_pu_bacteria 2775506739 2775672985 123
11 iso_pu_bacteria 2919097161 2919099403 123
12 3300003784 Ga0055534_1004472 Ga0055534_10044722 124
13 3300005337 Ga0070682_100000705 Ga0070682_10000070515 124
14 3300025919 Ga0207657_10599518 Ga0207657_105995182 124
15 3300032004 Ga0307414_10111756 Ga0307414_101117561 124
16 iso_pu_bacteria 2582581278 2585141401 124
17 iso_pu_bacteria 2585428045 2587680995 124
18 iso_pu_bacteria 2585428095 2587866463 124
19 iso_pu_bacteria 2585428182 2588208019 124
20 iso_pu_bacteria 2585428184 2588220011 124
21 iso_pu_bacteria 2585428185 2588223691 124
22 iso_pu_bacteria 2588254255 2590600603 124
23 iso_pu_bacteria 2588254257 2590612118 124
24 iso_pu_bacteria 2739367874 2740057910 124
25 iso_pu_bacteria 2765235839 2765572809 124
26 iso_pu_bacteria 2772190705 2772607444 124
27 iso_pu_bacteria 2816332188 2816873143 124
28 iso_pu_bacteria 2818991460 2819677979 124
29 iso_pu_bacteria 2842083920 2842084352 124
30 iso_pu_bacteria 2871720351 2871722730 124
31 iso_pu_bacteria 2884791551 2884792265 124
32 iso_pu_bacteria 2889290771 2889291484 124
33 iso_pu_bacteria 2896085136 2896088104 124
34 iso_pu_bacteria 2905999023 2906001891 124
35 iso_pu_bacteria 2919399522 2919403075 124
36 iso_pu_bacteria 2929239360 2929242420 124
37 iso_pu_bacteria 2946019816 2946021579 124
38 iso_pu_bacteria 8003151029 8003153174 124
39 iso_pu_bacteria 2929921140 2929924109 125
40 3300037312 Ga0395899_0000006 Ga0395899_0000006_506884_507279 126
41 3300037418 Ga0395900_0112247 Ga0395900_0112247_1616_2011 126
42 3300006844 Ga0075428_100795518 Ga0075428_1007955181 127
43 3300025949 Ga0207667_10713345 Ga0207667_107133452 127
44 3300031456 Ga0307513_10054261 Ga0307513_100542612 127
45 3300031616 Ga0307508_10009948 Ga0307508_100099482 127
46 3300031731 Ga0307405_10581855 Ga0307405_105818551 127
47 3300032004 Ga0307414_10024147 Ga0307414_100241473 127
48 3300032004 Ga0307414_10522558 Ga0307414_105225581 127
49 3300038443 Ga0395901_0002099 Ga0395901_0002099_17686_18090 127
50 3300041413 Ga0439465_0017203 Ga0439465_0017203_888_1286 127
51 3300041452 Ga0451793_0443989 Ga0451793_0443989_148_552 127
52 3300041999 Ga0439433_0154481 Ga0439433_0154481_174_572 127
53 3300046453 Ga0495627_012329 Ga0495627_012329_1531_1929 127
54 3300046519 Ga0495632_0004920 Ga0495632_0004920_4023_4421 127
55 3300046522 Ga0495643_0025644 Ga0495643_0025644_1583_1981 127
56 3300046558 Ga0495633_0000008 Ga0495633_0000008_102491_102889 127
57 3300046558 Ga0495633_0001538 Ga0495633_0001538_7898_8296 127
58 3300046660 Ga0495625_0008088 Ga0495625_0008088_6521_6919 127
59 3300047472 Ga0495686_0000118 Ga0495686_0000118_63494_63892 127
60 3300049758 Ga0501241_000013 Ga0501241_000013_5871_6269 127
61 3300049766 Ga0501269_000241 Ga0501269_000241_15510_15908 127
62 3300053139 Ga0500568_0011902 Ga0500568_0011902_2529_2921 127
63 3300053156 Ga0500622_0000035 Ga0500622_0000035_132194_132577 127
64 3300053158 Ga0500627_0431384 Ga0500627_0431384_122_505 127
65 3300001989 JGI24739J22299_10002426 JGI24739J22299_1000242611 128
66 3300001989 JGI24739J22299_10056179 JGI24739J22299_100561792 128
67 3300002738 JGI25154J39366_1000025 JGI25154J39366_1000025119 128
68 3300002741 JGI25157J39369_1004218 JGI25157J39369_10042182 128
69 3300003215 JGI25153J46596_10013969 JGI25153J46596_100139692 128
70 3300003215 JGI25153J46596_10017948 JGI25153J46596_100179485 128
71 3300003215 JGI25153J46596_10032332 JGI25153J46596_100323322 128
72 3300003215 JGI25153J46596_10057212 JGI25153J46596_100572122 128
73 3300003320 rootH2_10016090 rootH2_100160902 128
74 3300003322 rootL2_10055485 rootL2_100554856 128
75 3300003322 rootL2_10155383 rootL2_101553832 128
76 3300003323 rootH1_10047570 rootH1_100475705 128
77 3300003323 rootH1_10136306 rootH1_101363063 128
78 3300003323 rootH1_10220112 rootH1_102201122 128
79 3300003323 rootH1_10370527 rootH1_103705272 128
80 3300003354 JGI25160J50197_1004070 JGI25160J50197_10040705 128
81 3300003354 JGI25160J50197_1007037 JGI25160J50197_10070372 128
82 3300003578 Ga0006562J51391_1050289 Ga0006562J51391_10502891 128
83 3300003771 Ga0055526_1011279 Ga0055526_10112791 128
84 3300003771 Ga0055526_1029048 Ga0055526_10290483 128
85 3300003790 Ga0055528_1002094 Ga0055528_100209411 128
86 3300003794 Ga0055531_10000139 Ga0055531_1000013976 128
87 3300004625 Ga0055543_1013035 Ga0055543_10130352 128
88 3300005262 Ga0065165_1000038 Ga0065165_1000038173 128
89 3300005289 Ga0065704_10001223 Ga0065704_100012239 128
90 3300005327 Ga0070658_10031923 Ga0070658_100319235 128
91 3300005327 Ga0070658_11058183 Ga0070658_110581831 128
92 3300005339 Ga0070660_100478722 Ga0070660_1004787221 128
93 3300005347 Ga0070668_100246962 Ga0070668_1002469622 128
94 3300005353 Ga0070669_101395427 Ga0070669_1013954271 128
95 3300005366 Ga0070659_100177847 Ga0070659_1001778474 128
96 3300005458 Ga0070681_10123773 Ga0070681_101237732 128
97 3300005530 Ga0070679_100790385 Ga0070679_1007903851 128
98 3300005530 Ga0070679_101172668 Ga0070679_1011726682 128
99 3300005539 Ga0068853_100889175 Ga0068853_1008891752 128
100 3300005548 Ga0070665_100003215 Ga0070665_10000321516 128
101 3300005563 Ga0068855_100033157 Ga0068855_1000331579 128
102 3300005563 Ga0068855_100822956 Ga0068855_1008229563 128
103 3300005564 Ga0070664_101692631 Ga0070664_1016926311 128
104 3300005577 Ga0068857_100134262 Ga0068857_1001342622 128
105 3300006195 Ga0075366_10080199 Ga0075366_100801992 128
106 3300009036 Ga0105244_10000164 Ga0105244_1000016460 128
107 3300009148 Ga0105243_10000004 Ga0105243_10000004434 128
108 3300009148 Ga0105243_10001078 Ga0105243_1000107825 128
109 3300009174 Ga0105241_12609080 Ga0105241_126090801 128
110 3300010375 Ga0105239_10157270 Ga0105239_101572702 128
111 3300010375 Ga0105239_11376742 Ga0105239_113767422 128
112 3300012495 Ga0157323_1002096 Ga0157323_10020961 128
113 3300013100 Ga0157373_10175866 Ga0157373_101758662 128
114 3300013100 Ga0157373_10222910 Ga0157373_102229103 128
115 3300013100 Ga0157373_10363991 Ga0157373_103639912 128
116 3300013102 Ga0157371_10030074 Ga0157371_100300742 128
117 3300013102 Ga0157371_10542952 Ga0157371_105429522 128
118 3300013104 Ga0157370_10007144 Ga0157370_100071443 128
119 3300013104 Ga0157370_10164386 Ga0157370_101643862 128
120 3300013104 Ga0157370_10395826 Ga0157370_103958263 128
121 3300013105 Ga0157369_10353316 Ga0157369_103533162 128
122 3300013307 Ga0157372_10035741 Ga0157372_100357415 128
123 3300013307 Ga0157372_10588431 Ga0157372_105884312 128
124 3300013307 Ga0157372_10781521 Ga0157372_107815212 128
125 3300013307 Ga0157372_10958970 Ga0157372_109589702 128
126 3300013307 Ga0157372_12462723 Ga0157372_124627231 128
127 3300014325 Ga0163163_10091785 Ga0163163_100917854 128
128 3300015261 Ga0182006_1000011 Ga0182006_1000011391 128
129 3300025246 Ga0209646_1000037 Ga0209646_1000037121 128
130 3300025250 Ga0209026_1000256 Ga0209026_100025645 128
131 3300025273 Ga0209673_1000123 Ga0209673_1000123122 128
132 3300025273 Ga0209673_1018188 Ga0209673_10181884 128
133 3300025291 Ga0209675_1000033 Ga0209675_1000033234 128
134 3300025295 Ga0209564_1001874 Ga0209564_100187412 128
135 3300025295 Ga0209564_1028587 Ga0209564_10285872 128
136 3300025297 Ga0209758_1012319 Ga0209758_10123195 128
137 3300025297 Ga0209758_1015091 Ga0209758_10150915 128
138 3300025297 Ga0209758_1046491 Ga0209758_10464912 128
139 3300025297 Ga0209758_1050832 Ga0209758_10508322 128
140 3300025298 Ga0209050_1000692 Ga0209050_100069252 128
141 3300025302 Ga0207426_1000489 Ga0207426_100048943 128
142 3300025302 Ga0207426_1001681 Ga0207426_10016819 128
143 3300025302 Ga0207426_1010128 Ga0207426_10101282 128
144 3300025303 Ga0209051_1032548 Ga0209051_10325483 128
145 3300025304 Ga0209257_1000025 Ga0209257_100002581 128
146 3300025728 Ga0207655_1006304 Ga0207655_10063045 128
147 3300025904 Ga0207647_10077212 Ga0207647_100772122 128
148 3300025909 Ga0207705_10871110 Ga0207705_108711101 128
149 3300025913 Ga0207695_11200348 Ga0207695_112003481 128
150 3300025917 Ga0207660_11024798 Ga0207660_110247982 128
151 3300025921 Ga0207652_10025915 Ga0207652_100259154 128
152 3300025921 Ga0207652_10459640 Ga0207652_104596402 128
153 3300025921 Ga0207652_10859464 Ga0207652_108594642 128
154 3300025932 Ga0207690_10476405 Ga0207690_104764052 128
155 3300025935 Ga0207709_10000010 Ga0207709_10000010436 128
156 3300025935 Ga0207709_10061190 Ga0207709_100611902 128
157 3300025949 Ga0207667_10087498 Ga0207667_100874983 128
158 3300025949 Ga0207667_10222471 Ga0207667_102224712 128
159 3300026041 Ga0207639_10328086 Ga0207639_103280863 128
160 3300026041 Ga0207639_10893351 Ga0207639_108933512 128
161 3300026089 Ga0207648_12197293 Ga0207648_121972931 128
162 3300026095 Ga0207676_10801801 Ga0207676_108018012 128
163 3300026116 Ga0207674_10028979 Ga0207674_100289792 128
164 3300026116 Ga0207674_11098818 Ga0207674_110988182 128
165 3300028379 Ga0268266_10003519 Ga0268266_100035194 128
166 3300028794 Ga0307515_10123139 Ga0307515_101231393 128
167 3300031824 Ga0307413_10549024 Ga0307413_105490241 128
168 3300031824 Ga0307413_11223361 Ga0307413_112233612 128
169 3300031901 Ga0307406_10131044 Ga0307406_101310442 128
170 3300031901 Ga0307406_10521421 Ga0307406_105214211 128
171 3300031911 Ga0307412_10000012 Ga0307412_1000001230 128
172 3300031995 Ga0307409_100929028 Ga0307409_1009290282 128
173 3300032002 Ga0307416_100000039 Ga0307416_100000039128 128
174 3300032004 Ga0307414_10000224 Ga0307414_1000022428 128
175 3300032004 Ga0307414_10024385 Ga0307414_100243853 128
176 3300032004 Ga0307414_10031088 Ga0307414_100310884 128
177 3300032004 Ga0307414_10038359 Ga0307414_100383591 128
178 3300032004 Ga0307414_10086896 Ga0307414_100868964 128
179 3300032004 Ga0307414_11993461 Ga0307414_119934611 128
180 3300035116 Ga0373945_0080357 Ga0373945_0080357_527_913 128
181 3300035695 Ga0373927_0120953 Ga0373927_0120953_179_565 128
182 3300037312 Ga0395899_0006559 Ga0395899_0006559_1531_1917 128
183 3300037418 Ga0395900_0217466 Ga0395900_0217466_11_397 128
184 3300037466 Ga0395898_0011579 Ga0395898_0011579_2050_2436 128
185 3300038443 Ga0395901_0017211 Ga0395901_0017211_3096_3482 128
186 3300041413 Ga0439465_0071163 Ga0439465_0071163_342_728 128
187 3300041452 Ga0451793_0268753 Ga0451793_0268753_154_540 128
188 3300041491 Ga0451833_0223653 Ga0451833_0223653_439_825 128
189 3300041507 Ga0451851_0350033 Ga0451851_0350033_11_397 128
190 3300041509 Ga0451843_0555739 Ga0451843_0555739_159_545 128
191 3300044658 Ga0466972_0050000 Ga0466972_0050000_1191_1577 128
192 3300044735 Ga0466968_0029117 Ga0466968_0029117_327_713 128
193 3300044735 Ga0466968_0328643 Ga0466968_0328643_47_433 128
194 3300044765 Ga0466970_0766182 Ga0466970_0766182_85_480 128
195 3300044842 Ga0466957_0947111 Ga0466957_0947111_44_430 128
196 3300045049 Ga0466959_0066689 Ga0466959_0066689_1831_2217 128
197 3300046453 Ga0495627_000002 Ga0495627_000002_485627_486022 128
198 3300046453 Ga0495627_003072 Ga0495627_003072_4562_4948 128
199 3300046460 Ga0495638_0221222 Ga0495638_0221222_302_697 128
200 3300046500 Ga0495596_0001419 Ga0495596_0001419_1347_1802 128
201 3300046507 Ga0495606_0027813 Ga0495606_0027813_2754_3140 128
202 3300046507 Ga0495606_0032880 Ga0495606_0032880_794_1189 128
203 3300046512 Ga0495610_0000001 Ga0495610_0000001_1615007_1615402 128
204 3300046519 Ga0495632_0097264 Ga0495632_0097264_777_1163 128
205 3300046530 Ga0495654_0000001 Ga0495654_0000001_395090_395485 128
206 3300046558 Ga0495633_0000005 Ga0495633_0000005_29962_30348 128
207 3300046616 Ga0495668_0013953 Ga0495668_0013953_2650_3117 128
208 3300046616 Ga0495668_0255455 Ga0495668_0255455_421_807 128
209 3300046660 Ga0495625_0138157 Ga0495625_0138157_28_417 128
210 3300046660 Ga0495625_0655033 Ga0495625_0655033_88_477 128
211 3300046810 Ga0495660_0025915 Ga0495660_0025915_1582_1968 128
212 3300047472 Ga0495686_0005553 Ga0495686_0005553_4028_4423 128
213 3300048905 Ga0496102_0028993 Ga0496102_0028993_45_440 128
214 3300048906 Ga0496103_0091848 Ga0496103_0091848_276_671 128
215 3300048908 Ga0496105_0139516 Ga0496105_0139516_1526_1921 128
216 3300048919 Ga0496116_0000022 Ga0496116_0000022_464787_465182 128
217 3300048920 Ga0496117_0000064 Ga0496117_0000064_234202_234597 128
218 3300048921 Ga0496118_0003294 Ga0496118_0003294_17901_18296 128
219 3300048922 Ga0496119_0000025 Ga0496119_0000025_22344_22739 128
220 3300048923 Ga0496120_0089202 Ga0496120_0089202_302_697 128
221 3300048924 Ga0496121_0237340 Ga0496121_0237340_831_1226 128
222 3300048925 Ga0496122_0001362 Ga0496122_0001362_21461_21856 128
223 3300048925 Ga0496122_0001579 Ga0496122_0001579_17303_17698 128
224 3300048925 Ga0496122_0002590 Ga0496122_0002590_23304_23699 128
225 3300048926 Ga0496123_0000897 Ga0496123_0000897_28857_29252 128
226 3300048926 Ga0496123_0071424 Ga0496123_0071424_1223_1618 128
227 3300048926 Ga0496123_0221304 Ga0496123_0221304_328_723 128
228 3300048927 Ga0496124_0000287 Ga0496124_0000287_74913_75308 128
229 3300048928 Ga0496125_0000662 Ga0496125_0000662_18511_18906 128
230 3300048928 Ga0496125_0025978 Ga0496125_0025978_943_1338 128
231 3300048928 Ga0496125_0597226 Ga0496125_0597226_36_422 128
232 3300048929 Ga0496126_0001868 Ga0496126_0001868_18524_18919 128
233 3300048929 Ga0496126_0118361 Ga0496126_0118361_1634_2095 128
234 3300049570 Ga0501033_0016432 Ga0501033_0016432_2663_3049 128
235 3300049570 Ga0501033_0679165 Ga0501033_0679165_70_492 128
236 3300049571 Ga0501034_0898994 Ga0501034_0898994_66_452 128
237 3300049586 Ga0501070_0766595 Ga0501070_0766595_357_743 128
238 3300049588 Ga0501072_0734895 Ga0501072_0734895_242_637 128
239 3300049652 Ga0501202_039878 Ga0501202_039878_53_439 128
240 3300049668 Ga0501233_145140 Ga0501233_145140_69_455 128
241 3300049669 Ga0501235_167384 Ga0501235_167384_15_401 128
242 3300049674 Ga0501242_000533 Ga0501242_000533_1773_2159 128
243 3300049680 Ga0501250_025804 Ga0501250_025804_285_671 128
244 3300049683 Ga0501253_011739 Ga0501253_011739_174_560 128
245 3300049688 Ga0501259_012495 Ga0501259_012495_164_550 128
246 3300049708 Ga0501245_109832 Ga0501245_109832_131_517 128
247 3300049822 Ga0501035_0091424 Ga0501035_0091424_1951_2337 128
248 3300049823 Ga0501044_0137662 Ga0501044_0137662_863_1249 128
249 3300049850 Ga0501204_001258 Ga0501204_001258_397_783 128
250 3300053086 Ga0500578_0000074 Ga0500578_0000074_3067_3453 128
251 3300053086 Ga0500578_0081536 Ga0500578_0081536_523_909 128
252 3300053088 Ga0500644_0000415 Ga0500644_0000415_19484_19873 128
253 3300053090 Ga0500646_0076739 Ga0500646_0076739_49_435 128
254 3300053093 Ga0500651_0302727 Ga0500651_0302727_144_530 128
255 3300053108 Ga0500562_023474 Ga0500562_023474_824_1210 128
256 3300053108 Ga0500562_180171 Ga0500562_180171_22_408 128
257 3300053109 Ga0500569_002250 Ga0500569_002250_2836_3222 128
258 3300053121 Ga0500607_269518 Ga0500607_269518_132_518 128
259 3300053131 Ga0500652_002791 Ga0500652_002791_4427_4816 128
260 3300053136 Ga0500559_0067645 Ga0500559_0067645_1026_1415 128
261 3300053139 Ga0500568_0050490 Ga0500568_0050490_347_736 128
262 3300053148 Ga0500590_027347 Ga0500590_027347_1570_1959 128
263 3300053151 Ga0500604_0118670 Ga0500604_0118670_63_449 128
264 3300053151 Ga0500604_0256217 Ga0500604_0256217_157_543 128
265 3300053153 Ga0500616_0028292 Ga0500616_0028292_1898_2284 128
266 3300053156 Ga0500622_0000010 Ga0500622_0000010_44457_44843 128
267 3300053156 Ga0500622_0202260 Ga0500622_0202260_306_692 128
268 3300053160 Ga0500633_0000800 Ga0500633_0000800_50_439 128
269 3300053161 Ga0500634_0042490 Ga0500634_0042490_1910_2302 128
270 3300053163 Ga0500639_319734 Ga0500639_319734_50_436 128
271 3300053177 Ga0500636_0091885 Ga0500636_0091885_697_1086 128
272 3300053732 Ga0500656_044716 Ga0500656_044716_97_483 128
273 iso_pu_bacteria 2585428183 2588213405 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

152

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.9212 3 128
4pav-assembly6.cif.gz_F structure of hypothetical protein sa1046 from s. aureus. 0.9194 3 128
4pav-assembly2.cif.gz_B structure of hypothetical protein sa1046 from s. aureus. 0.8964 3 128
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8793 3 128
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8781 1 128
ID Description Score Start End Superfamily
4pavC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9018 5 128 3.10.180.10
4pavD00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8882 5 128 3.10.180.10
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8871 3 128 3.10.180.10
4pavC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8806 5 128 3.10.180.10
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8674 3 125 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A501Q2E6-F1-model_v4 Glyoxalase 0.9818 1 128
AF-A0A7U7CTX6-F1-model_v4 Glyoxalase 0.9717 1 128
AF-A0A6N7P2M2-F1-model_v4 Glyoxalase 0.9716 1 128
AF-A0A1N7HXS6-F1-model_v4 VOC domain-containing protein 0.9712 1 128
AF-A0A2V2ZA73-F1-model_v4 VOC domain-containing protein 0.9706 1 128

Feature Viewer

pLDDT pTM Quality
92.97 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map