F379204

General Info

Members Datasets Scaffolds Average Seq Length
273 183 546 375

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0110081|Ga0466958_0110081_222_1481
Length 419
Sequence VLSCRSSPRPAEITGTVKNVLAVLAPGQGAQKPGMLTDWLDLPGAEPFFRWAGAIADADLLELGTTGDAEAIKDTAVTQPLVVAMSLFVARELGGLPGPVQHTPSAGRDVVITGHSVGELTAAALAGVLSVEAAIALTAVRGRAMARACAQTPTGMSAVLGGDPEEVLAALDKLGLTPANRNGAGQVVAAGPLEALAELKADPPVKARIMPLSVAGAFHTEYMASARAELEGLVGGLTPADPSRLLLSNADGAAVGTGRQALDRLVSQVTSPVRFDACLATLRELGVTAAVELPPAGALAGLAKREWKGSDIEILALSGPGDLDRARELIEAERGRTEAEHLPDWRVVVSPVRGTVSPADIAEGTHLTAGTALGCIRSRREEVNVSAGYDGVLAEWLVHEGDLVDAGDPLARLYPEVTA

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2506783011 Frankia datiscae Dg1 Isolate Nodule
174 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
175 2619618881 Frankia sp. ACN1ag Isolate Unclassified
176 2619619003 Frankia sp. CpI1-P Isolate Nodule
177 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
178 2626541554 Frankia sp. AvcI.1 Isolate Nodule
179 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
180 2773857933 Frankia sp. BMG5.30 Isolate Nodule
181 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
182 8054920844 Frankia tisae Agncl-8 Isolate Nodule
183 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 1.47
Isolates 4.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 2.56
Rhizoplane 7.69
Rhizosphere 86.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0110081 3300045836 Bacteria 1719
2 Ga0070658_10001274 3300005327 Bacteria 21563
3 Ga0070683_100005947 3300005329 Bacteria 10211
4 Ga0070683_100009992 3300005329 Bacteria 8137
5 Ga0070690_100042740 3300005330 Bacteria 2871
6 Ga0068869_100002329 3300005334 Bacteria 11428
7 Ga0070666_10020502 3300005335 Bacteria 4273
8 Ga0070680_100009998 3300005336 Bacteria 7310
9 Ga0070682_100023932 3300005337 Bacteria 3630
10 Ga0070682_100027887 3300005337 Bacteria 3392
11 Ga0068868_100002672 3300005338 Bacteria 12363
12 Ga0068868_100019715 3300005338 Bacteria 5057
13 Ga0070660_100085046 3300005339 Bacteria 2487
14 Ga0070675_100001574 3300005354 Bacteria 16861
15 Ga0070659_100001913 3300005366 Bacteria 14881
16 Ga0070709_10011361 3300005434 Bacteria 4961
17 Ga0070713_100182251 3300005436 Bacteria 1887
18 Ga0070713_100230624 3300005436 Bacteria 1683
19 Ga0070708_100101335 3300005445 Bacteria 2637
20 Ga0070663_100011480 3300005455 Bacteria 5564
21 Ga0070678_100086482 3300005456 Bacteria 2392
22 Ga0070662_100020691 3300005457 Bacteria 4486
23 Ga0070662_100031890 3300005457 Bacteria 3702
24 Ga0070681_10078547 3300005458 Bacteria 3257
25 Ga0068867_100062202 3300005459 Bacteria 2773
26 Ga0070679_100072651 3300005530 Bacteria 3432
27 Ga0070684_100001545 3300005535 Bacteria 16600
28 Ga0070665_100058793 3300005548 Bacteria 3854
29 Ga0070665_100327289 3300005548 Bacteria 1537
30 Ga0070704_100048749 3300005549 Bacteria 2966
31 Ga0068855_100006445 3300005563 Bacteria 14292
32 Ga0068855_100036150 3300005563 Bacteria 5881
33 Ga0068855_100148074 3300005563 Bacteria 2671
34 Ga0068855_100377851 3300005563 Bacteria 1556
35 Ga0070664_100000299 3300005564 Bacteria 36049
36 Ga0070664_100245435 3300005564 Bacteria 1608
37 Ga0068857_100017281 3300005577 Bacteria 6321
38 Ga0068857_100040516 3300005577 Bacteria 4130
39 Ga0068854_100093888 3300005578 Bacteria 2237
40 Ga0068856_100032946 3300005614 Bacteria 5074
41 Ga0068856_100049330 3300005614 Bacteria 4149
42 Ga0070702_100088857 3300005615 Bacteria 1869
43 Ga0068852_100035397 3300005616 Bacteria 4165
44 Ga0068859_100162191 3300005617 Bacteria 2314
45 Ga0068864_100008693 3300005618 Bacteria 8379
46 Ga0068863_100016805 3300005841 Bacteria 7020
47 Ga0068863_100087490 3300005841 Bacteria 2952
48 Ga0068858_100146341 3300005842 Bacteria 2219
49 Ga0068860_100179628 3300005843 Bacteria 2045
50 Ga0081455_10008500 3300005937 Bacteria 10665
51 Ga0081540_1000395 3300005983 Bacteria 43174
52 Ga0081540_1001235 3300005983 Bacteria 22296
53 Ga0081539_10004768 3300005985 Bacteria 14638
54 Ga0070717_10122326 3300006028 Bacteria 2230
55 Ga0070716_100024244 3300006173 Bacteria 3227
56 Ga0075428_100411150 3300006844 Bacteria 1450
57 Ga0075430_100002584 3300006846 Bacteria 15104
58 Ga0075429_100186632 3300006880 Bacteria 1817
59 Ga0075429_100194427 3300006880 Bacteria 1777
60 Ga0097620_100162194 3300006931 Bacteria 2314
61 Ga0075435_100043702 3300007076 Bacteria 3587
62 Ga0105240_10504049 3300009093 Bacteria 1345
63 Ga0111539_10002578 3300009094 Bacteria 23991
64 Ga0111539_10087117 3300009094 Bacteria 3669
65 Ga0105245_10035850 3300009098 Bacteria 4404
66 Ga0105247_10007294 3300009101 Bacteria 6794
67 Ga0114129_10558724 3300009147 Bacteria 1487
68 Ga0105241_10042137 3300009174 Bacteria 3452
69 Ga0105242_10002883 3300009176 Bacteria 13461
70 Ga0105248_10038669 3300009177 Bacteria 5340
71 Ga0105237_10166476 3300009545 Bacteria 2204
72 Ga0105238_10015465 3300009551 Bacteria 7722
73 Ga0105249_10013580 3300009553 Bacteria 7195
74 Ga0105239_10071368 3300010375 Bacteria 3815
75 Ga0105239_10075104 3300010375 Bacteria 3716
76 Ga0105246_10083045 3300011119 Bacteria 2288
77 Ga0157370_10076175 3300013104 Bacteria 3160
78 Ga0157369_10037297 3300013105 Bacteria 5321
79 Ga0157369_10155964 3300013105 Bacteria 2411
80 Ga0157374_10169806 3300013296 Bacteria 2127
81 Ga0157378_10020003 3300013297 Bacteria 5885
82 Ga0163162_10084207 3300013306 Bacteria 3255
83 Ga0157372_10116002 3300013307 Bacteria 3070
84 Ga0163163_10015967 3300014325 Bacteria 6959
85 Ga0163163_10077377 3300014325 Bacteria 3322
86 Ga0157379_10054835 3300014968 Bacteria 3561
87 Ga0157376_10442793 3300014969 Bacteria 1265
88 Ga0163161_10007659 3300017792 Bacteria 7469
89 Ga0197907_10562781 3300020069 Bacteria 1872
90 Ga0206356_10908117 3300020070 Bacteria 4711
91 Ga0206353_10757050 3300020082 Bacteria 3001
92 Ga0207710_10051342 3300025900 Bacteria 1852
93 Ga0207699_10015015 3300025906 Bacteria 4012
94 Ga0207699_10072614 3300025906 Bacteria 2108
95 Ga0207705_10001769 3300025909 Bacteria 17054
96 Ga0207707_10138329 3300025912 Bacteria 2129
97 Ga0207695_10355679 3300025913 Bacteria 1351
98 Ga0207693_10001527 3300025915 Bacteria 20443
99 Ga0207660_10243070 3300025917 Bacteria 1418
100 Ga0207657_10007823 3300025919 Bacteria 10908
101 Ga0207657_10117109 3300025919 Bacteria 2194
102 Ga0207649_10177207 3300025920 Bacteria 1490
103 Ga0207652_10047051 3300025921 Bacteria 3684
104 Ga0207681_10029580 3300025923 Bacteria 3561
105 Ga0207694_10044275 3300025924 Bacteria 3437
106 Ga0207694_10091777 3300025924 Bacteria 2397
107 Ga0207659_10002367 3300025926 Bacteria 11222
108 Ga0207687_10174212 3300025927 Bacteria 1662
109 Ga0207664_10174616 3300025929 Bacteria 1841
110 Ga0207690_10006463 3300025932 Bacteria 6948
111 Ga0207706_10018559 3300025933 Bacteria 6258
112 Ga0207706_10033838 3300025933 Bacteria 4548
113 Ga0207709_10036431 3300025935 Bacteria 2915
114 Ga0207669_10032671 3300025937 Bacteria 2926
115 Ga0207665_10029575 3300025939 Bacteria 3621
116 Ga0207691_10075707 3300025940 Bacteria 3034
117 Ga0207661_10001300 3300025944 Bacteria 16703
118 Ga0207661_10010367 3300025944 Bacteria 6707
119 Ga0207661_10139367 3300025944 Bacteria 2086
120 Ga0207679_10116269 3300025945 Bacteria 2120
121 Ga0207679_10116928 3300025945 Bacteria 2115
122 Ga0207679_10216813 3300025945 Bacteria 1608
123 Ga0207667_10041399 3300025949 Bacteria 4899
124 Ga0207667_10046420 3300025949 Bacteria 4600
125 Ga0207667_10061479 3300025949 Bacteria 3929
126 Ga0207667_10149298 3300025949 Bacteria 2406
127 Ga0207667_10214431 3300025949 Bacteria 1973
128 Ga0207677_10001636 3300026023 Bacteria 11877
129 Ga0207702_10066392 3300026078 Bacteria 3092
130 Ga0207641_10072260 3300026088 Bacteria 2971
131 Ga0207641_10105260 3300026088 Bacteria 2492
132 Ga0207641_10183089 3300026088 Bacteria 1920
133 Ga0207676_10119389 3300026095 Bacteria 2220
134 Ga0207674_10013770 3300026116 Bacteria 8949
135 Ga0207674_10026478 3300026116 Bacteria 6157
136 Ga0207674_10035380 3300026116 Bacteria 5212
137 Ga0207674_10043978 3300026116 Bacteria 4603
138 Ga0207683_10005205 3300026121 Bacteria 11170
139 Ga0207698_10093504 3300026142 Bacteria 2469
140 Ga0207428_10024005 3300027907 Bacteria 5121
141 Ga0268266_10126791 3300028379 Bacteria 2279
142 Ga0268264_10085400 3300028381 Bacteria 2709
143 Ga0307405_10000216 3300031731 Bacteria 20774
144 Ga0307405_10056573 3300031731 Bacteria 2461
145 Ga0307413_10018714 3300031824 Bacteria 3642
146 Ga0307410_10244339 3300031852 Bacteria 1393
147 Ga0307406_10109475 3300031901 Bacteria 1899
148 Ga0307407_10029805 3300031903 Bacteria 2936
149 Ga0307409_100096469 3300031995 Bacteria 2439
150 Ga0307409_100448351 3300031995 Bacteria 1245
151 Ga0307416_100033325 3300032002 Bacteria 3904
152 Ga0307416_100155678 3300032002 Bacteria 2103
153 Ga0307414_10031723 3300032004 Bacteria 3470
154 Ga0307415_100043373 3300032126 Bacteria 3001
155 Ga0307415_100117181 3300032126 Bacteria 1988
156 Ga0373939_0011244 3300035114 Bacteria 2254
157 Ga0373931_0046366 3300035691 Bacteria 2297
158 Ga0395899_0078063 3300037312 Bacteria 2414
159 Ga0395900_0003504 3300037418 Bacteria 16936
160 Ga0395900_0022445 3300037418 Bacteria 6455
161 Ga0395898_0035586 3300037466 Bacteria 4949
162 Ga0436365_1083895 3300039437 Bacteria 1541
163 Ga0466969_0009099 3300044656 Bacteria 5266
164 Ga0466969_0037278 3300044656 Bacteria 2453
165 Ga0466972_0004801 3300044658 Bacteria 6775
166 Ga0466972_0014106 3300044658 Bacteria 4005
167 Ga0466965_0006507 3300044683 Bacteria 5311
168 Ga0466966_0003340 3300044684 Bacteria 10578
169 Ga0466966_0061211 3300044684 Bacteria 2375
170 Ga0466961_0005410 3300044693 Bacteria 8042
171 Ga0466961_0022083 3300044693 Bacteria 4095
172 Ga0466961_0056811 3300044693 Bacteria 2493
173 Ga0466961_0064318 3300044693 Bacteria 2331
174 Ga0466961_0123122 3300044693 Bacteria 1627
175 Ga0466963_0002819 3300044694 Bacteria 9801
176 Ga0466963_0006921 3300044694 Bacteria 6745
177 Ga0466963_0007944 3300044694 Bacteria 6351
178 Ga0466963_0018922 3300044694 Bacteria 4313
179 Ga0466963_0022599 3300044694 Bacteria 3984
180 Ga0466963_0053478 3300044694 Bacteria 2681
181 Ga0466963_0062441 3300044694 Bacteria 2492
182 Ga0466963_0097075 3300044694 Bacteria 2013
183 Ga0466964_0021287 3300044706 Bacteria 2506
184 Ga0466971_0010641 3300044719 Bacteria 4023
185 Ga0466971_0013159 3300044719 Bacteria 3629
186 Ga0466971_0015240 3300044719 Bacteria 3383
187 Ga0466971_0077898 3300044719 Bacteria 1510
188 Ga0466970_0077486 3300044765 Bacteria 1792
189 Ga0466957_0010670 3300044842 Bacteria 5281
190 Ga0466957_0030202 3300044842 Bacteria 3235
191 Ga0466957_0071493 3300044842 Bacteria 2146
192 Ga0466957_0134255 3300044842 Bacteria 1589
193 Ga0466960_0016672 3300044901 Bacteria 3192
194 Ga0466960_0029698 3300044901 Bacteria 2510
195 Ga0466959_0021095 3300045049 Bacteria 4804
196 Ga0466959_0022125 3300045049 Bacteria 4697
197 Ga0466959_0025871 3300045049 Bacteria 4352
198 Ga0466959_0051907 3300045049 Bacteria 3005
199 Ga0466959_0087291 3300045049 Bacteria 2244
200 Ga0466958_0004286 3300045836 Bacteria 7512
201 Ga0466958_0030444 3300045836 Bacteria 3206
202 Ga0466958_0061625 3300045836 Bacteria 2285
203 Ga0466958_0150035 3300045836 Bacteria 1470
204 Ga0466967_0000224 3300045976 Bacteria 24348
205 Ga0466967_0011635 3300045976 Bacteria 6682
206 Ga0466967_0011937 3300045976 Bacteria 6618
207 Ga0466967_0017011 3300045976 Bacteria 5754
208 Ga0466967_0018240 3300045976 Bacteria 5601
209 Ga0466967_0026673 3300045976 Bacteria 4790
210 Ga0466967_0043297 3300045976 Bacteria 3897
211 Ga0466967_0131576 3300045976 Bacteria 2323
212 Ga0466967_0140658 3300045976 Bacteria 2248
213 Ga0466967_0339350 3300045976 Bacteria 1452
214 Ga0466967_0520820 3300045976 Bacteria 1168
215 Ga0495594_0038551 3300046499 Bacteria 2610
216 Ga0495631_0044247 3300046518 Bacteria 1963
217 Ga0495676_0045950 3300047321 Bacteria 3550
218 Ga0496100_0111120 3300048903 Bacteria 1904
219 Ga0496101_0034057 3300048904 Bacteria 3596
220 Ga0496102_0000090 3300048905 Bacteria 127346
221 Ga0496102_0008346 3300048905 Bacteria 8871
222 Ga0496103_0000034 3300048906 Bacteria 189284
223 Ga0496103_0008454 3300048906 Bacteria 6114
224 Ga0496104_0004596 3300048907 Bacteria 12035
225 Ga0496104_0188591 3300048907 Bacteria 1973
226 Ga0496108_0034795 3300048911 Bacteria 4185
227 Ga0496109_0024542 3300048912 Bacteria 5361
228 Ga0496109_0033599 3300048912 Bacteria 4615
229 Ga0496109_0058452 3300048912 Bacteria 3522
230 Ga0496110_0001373 3300048913 Bacteria 17540
231 Ga0496110_0122176 3300048913 Bacteria 2347
232 Ga0496110_0163049 3300048913 Bacteria 2021
233 Ga0496110_0247177 3300048913 Bacteria 1623
234 Ga0496111_0196109 3300048914 Bacteria 1501
235 Ga0496112_0191934 3300048915 Bacteria 2004
236 Ga0496113_0001481 3300048916 Bacteria 13115
237 Ga0496113_0271529 3300048916 Bacteria 1355
238 Ga0496115_0090511 3300048918 Bacteria 2499
239 Ga0496119_0000092 3300048922 Bacteria 131512
240 Ga0496120_0001652 3300048923 Bacteria 25805
241 Ga0501317_006685 3300049533 Bacteria 1277
242 Ga0501032_0004017 3300049569 Bacteria 11151
243 Ga0501038_0001921 3300049574 Bacteria 19179
244 Ga0501043_0047859 3300049579 Bacteria 3362
245 Ga0501047_0035945 3300049581 Bacteria 4786
246 Ga0501048_0001498 3300049582 Bacteria 17679
247 Ga0501070_0059660 3300049586 Bacteria 3163
248 Ga0501035_0018993 3300049822 Bacteria 6328
249 Ga0501044_0074125 3300049823 Bacteria 3459
250 Ga0501044_0322468 3300049823 Bacteria 1469
251 nmdc:mga05p37_306176_c1 3300050507 Bacteria 1885
252 nmdc:mga09592_247142_c1 3300050508 Bacteria 1546
253 nmdc:mga0qj67_1509_c1 3300050509 Bacteria 16317
254 nmdc:mga08y16_2409_c1 3300050511 Bacteria 19211
255 nmdc:mga0rr50_15979_c1 3300050513 Bacteria 4971
256 nmdc:mga08x19_102173_c1 3300050514 Bacteria 1903
257 nmdc:mga0a205_31015_c1 3300050515 Bacteria 5120
258 Ga0500646_0000306 3300053090 Bacteria 15028
259 Ga0500568_0002759 3300053139 Bacteria 10165
260 Ga0500588_0002703 3300053146 Bacteria 3646
261 Ga0501082_0268513 3300060353 Bacteria 1485
262 Ga0466962_0002995 3300061719 Bacteria 8058
263 2506868130 2506783011 Bacteria 5323186
264 2579853085 2579778521 Bacteria 7624758
265 2619855908 2619618881 Bacteria 7521104
266 2620348350 2619619003 Bacteria 7619552
267 2623498412 2622736605 Bacteria 4992138
268 2626635399 2626541554 Bacteria 7741902
269 2676482115 2675903059 Bacteria 8644972
270 2774902553 2773857933 Bacteria 5818019
271 8054920308 8054913762 Bacteria 7713009
272 8054921088 8054920844 Bacteria 7068637
273 8055163119 8055157932 Bacteria 6429399
274 Ga0466958_0110081
275 Ga0070658_10001274
276 Ga0070683_100005947
277 Ga0070683_100009992
278 Ga0070690_100042740
279 Ga0068869_100002329
280 Ga0070666_10020502
281 Ga0070680_100009998
282 Ga0070682_100023932
283 Ga0070682_100027887
284 Ga0068868_100002672
285 Ga0068868_100019715
286 Ga0070660_100085046
287 Ga0070675_100001574
288 Ga0070659_100001913
289 Ga0070709_10011361
290 Ga0070713_100182251
291 Ga0070713_100230624
292 Ga0070708_100101335
293 Ga0070663_100011480
294 Ga0070678_100086482
295 Ga0070662_100020691
296 Ga0070662_100031890
297 Ga0070681_10078547
298 Ga0068867_100062202
299 Ga0070679_100072651
300 Ga0070684_100001545
301 Ga0070665_100058793
302 Ga0070665_100327289
303 Ga0070704_100048749
304 Ga0068855_100006445
305 Ga0068855_100036150
306 Ga0068855_100148074
307 Ga0068855_100377851
308 Ga0070664_100000299
309 Ga0070664_100245435
310 Ga0068857_100017281
311 Ga0068857_100040516
312 Ga0068854_100093888
313 Ga0068856_100032946
314 Ga0068856_100049330
315 Ga0070702_100088857
316 Ga0068852_100035397
317 Ga0068859_100162191
318 Ga0068864_100008693
319 Ga0068863_100016805
320 Ga0068863_100087490
321 Ga0068858_100146341
322 Ga0068860_100179628
323 Ga0081455_10008500
324 Ga0081540_1000395
325 Ga0081540_1001235
326 Ga0081539_10004768
327 Ga0070717_10122326
328 Ga0070716_100024244
329 Ga0075428_100411150
330 Ga0075430_100002584
331 Ga0075429_100186632
332 Ga0075429_100194427
333 Ga0097620_100162194
334 Ga0075435_100043702
335 Ga0105240_10504049
336 Ga0111539_10002578
337 Ga0111539_10087117
338 Ga0105245_10035850
339 Ga0105247_10007294
340 Ga0114129_10558724
341 Ga0105241_10042137
342 Ga0105242_10002883
343 Ga0105248_10038669
344 Ga0105237_10166476
345 Ga0105238_10015465
346 Ga0105249_10013580
347 Ga0105239_10071368
348 Ga0105239_10075104
349 Ga0105246_10083045
350 Ga0157370_10076175
351 Ga0157369_10037297
352 Ga0157369_10155964
353 Ga0157374_10169806
354 Ga0157378_10020003
355 Ga0163162_10084207
356 Ga0157372_10116002
357 Ga0163163_10015967
358 Ga0163163_10077377
359 Ga0157379_10054835
360 Ga0157376_10442793
361 Ga0163161_10007659
362 Ga0197907_10562781
363 Ga0206356_10908117
364 Ga0206353_10757050
365 Ga0207710_10051342
366 Ga0207699_10015015
367 Ga0207699_10072614
368 Ga0207705_10001769
369 Ga0207707_10138329
370 Ga0207695_10355679
371 Ga0207693_10001527
372 Ga0207660_10243070
373 Ga0207657_10007823
374 Ga0207657_10117109
375 Ga0207649_10177207
376 Ga0207652_10047051
377 Ga0207681_10029580
378 Ga0207694_10044275
379 Ga0207694_10091777
380 Ga0207659_10002367
381 Ga0207687_10174212
382 Ga0207664_10174616
383 Ga0207690_10006463
384 Ga0207706_10018559
385 Ga0207706_10033838
386 Ga0207709_10036431
387 Ga0207669_10032671
388 Ga0207665_10029575
389 Ga0207691_10075707
390 Ga0207661_10001300
391 Ga0207661_10010367
392 Ga0207661_10139367
393 Ga0207679_10116269
394 Ga0207679_10116928
395 Ga0207679_10216813
396 Ga0207667_10041399
397 Ga0207667_10046420
398 Ga0207667_10061479
399 Ga0207667_10149298
400 Ga0207667_10214431
401 Ga0207677_10001636
402 Ga0207702_10066392
403 Ga0207641_10072260
404 Ga0207641_10105260
405 Ga0207641_10183089
406 Ga0207676_10119389
407 Ga0207674_10013770
408 Ga0207674_10026478
409 Ga0207674_10035380
410 Ga0207674_10043978
411 Ga0207683_10005205
412 Ga0207698_10093504
413 Ga0207428_10024005
414 Ga0268266_10126791
415 Ga0268264_10085400
416 Ga0307405_10000216
417 Ga0307405_10056573
418 Ga0307413_10018714
419 Ga0307410_10244339
420 Ga0307406_10109475
421 Ga0307407_10029805
422 Ga0307409_100096469
423 Ga0307409_100448351
424 Ga0307416_100033325
425 Ga0307416_100155678
426 Ga0307414_10031723
427 Ga0307415_100043373
428 Ga0307415_100117181
429 Ga0373939_0011244
430 Ga0373931_0046366
431 Ga0395899_0078063
432 Ga0395900_0003504
433 Ga0395900_0022445
434 Ga0395898_0035586
435 Ga0436365_1083895
436 Ga0466969_0009099
437 Ga0466969_0037278
438 Ga0466972_0004801
439 Ga0466972_0014106
440 Ga0466965_0006507
441 Ga0466966_0003340
442 Ga0466966_0061211
443 Ga0466961_0005410
444 Ga0466961_0022083
445 Ga0466961_0056811
446 Ga0466961_0064318
447 Ga0466961_0123122
448 Ga0466963_0002819
449 Ga0466963_0006921
450 Ga0466963_0007944
451 Ga0466963_0018922
452 Ga0466963_0022599
453 Ga0466963_0053478
454 Ga0466963_0062441
455 Ga0466963_0097075
456 Ga0466964_0021287
457 Ga0466971_0010641
458 Ga0466971_0013159
459 Ga0466971_0015240
460 Ga0466971_0077898
461 Ga0466970_0077486
462 Ga0466957_0010670
463 Ga0466957_0030202
464 Ga0466957_0071493
465 Ga0466957_0134255
466 Ga0466960_0016672
467 Ga0466960_0029698
468 Ga0466959_0021095
469 Ga0466959_0022125
470 Ga0466959_0025871
471 Ga0466959_0051907
472 Ga0466959_0087291
473 Ga0466958_0004286
474 Ga0466958_0030444
475 Ga0466958_0061625
476 Ga0466958_0150035
477 Ga0466967_0000224
478 Ga0466967_0011635
479 Ga0466967_0011937
480 Ga0466967_0017011
481 Ga0466967_0018240
482 Ga0466967_0026673
483 Ga0466967_0043297
484 Ga0466967_0131576
485 Ga0466967_0140658
486 Ga0466967_0339350
487 Ga0466967_0520820
488 Ga0495594_0038551
489 Ga0495631_0044247
490 Ga0495676_0045950
491 Ga0496100_0111120
492 Ga0496101_0034057
493 Ga0496102_0000090
494 Ga0496102_0008346
495 Ga0496103_0000034
496 Ga0496103_0008454
497 Ga0496104_0004596
498 Ga0496104_0188591
499 Ga0496108_0034795
500 Ga0496109_0024542
501 Ga0496109_0033599
502 Ga0496109_0058452
503 Ga0496110_0001373
504 Ga0496110_0122176
505 Ga0496110_0163049
506 Ga0496110_0247177
507 Ga0496111_0196109
508 Ga0496112_0191934
509 Ga0496113_0001481
510 Ga0496113_0271529
511 Ga0496115_0090511
512 Ga0496119_0000092
513 Ga0496120_0001652
514 Ga0501317_006685
515 Ga0501032_0004017
516 Ga0501038_0001921
517 Ga0501043_0047859
518 Ga0501047_0035945
519 Ga0501048_0001498
520 Ga0501070_0059660
521 Ga0501035_0018993
522 Ga0501044_0074125
523 Ga0501044_0322468
524 nmdc:mga05p37_306176_c1
525 nmdc:mga09592_247142_c1
526 nmdc:mga0qj67_1509_c1
527 nmdc:mga08y16_2409_c1
528 nmdc:mga0rr50_15979_c1
529 nmdc:mga08x19_102173_c1
530 nmdc:mga0a205_31015_c1
531 Ga0500646_0000306
532 Ga0500568_0002759
533 Ga0500588_0002703
534 Ga0501082_0268513
535 Ga0466962_0002995
536 2506868130
537 2579853085
538 2619855908
539 2620348350
540 2623498412
541 2626635399
542 2676482115
543 2774902553
544 8054920308
545 8054921088
546 8055163119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

377

417

0.93

PF00698

Acyl_transf_1

Acyl transferase domain

23

340

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.9304 258 326
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.9268 257 326
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.9219 258 326
2cdh-assembly1.cif.gz_4 architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution. 0.9214 2 244
5csa-assembly1.cif.gz_B crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.921 258 325
ID Description Score Start End Superfamily
af_Q93W03_192_271_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9568 256 325 2.40.50.100
af_Q2FXX0_70_148_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9518 256 325 2.40.50.100
1nm2A02 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9364 2 238 3.40.366.10
2d5dB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9263 258 326 2.40.50.100
af_I6YEU0_1051_1127_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9254 258 326 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A365UUE1-F1-model_v4 deleted 0.97 256 328
AF-A0A382ZK33-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9425 121 236 GO:0004314
GO:0005829
GO:0006633
AF-A0A2S9VP63-F1-model_v4 deleted 0.9388 256 328
AF-A0A3D3BPH0-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9386 116 236 GO:0004314
GO:0005829
GO:0006633
AF-A0A2C8ESP0-F1-model_v4 Acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 0.9383 256 325

Map