F379168

General Info

Members Datasets Scaffolds Average Seq Length
273 214 259 215

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0033789|Ga0436365_0033789_1106_1804
Length 232
Sequence MSQGGAFGSKGAAMADLASALSEAPQFDAAFRAMFAELVAWRRDVRHFRPDRAPDEATLAELFHLAALAPSVGNCQPTRFVRVDDNARRASVRANFEAANRDALSAYAGERAALYARLKLAGLRDAPIQLAIFCDEATEQGHGLGARTMPETRRYSTVCALHTFWLAARAYGLGVGWVSILDSGAIAAALDVPQAWTFIAYLCVGFPLEEHLIPELERVGWQRREPHPVLRR

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
5 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
6 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
7 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
8 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
9 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
10 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
115 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
206 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
207 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
208 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
212 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
213 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
214 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.51
Metatranscriptomes 0.37
Isolates 5.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 3.66
Rhizoplane 15.38
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10124462 3300005327 Bacteria 2145
2 Ga0070658_10303796 3300005327 Bacteria 1361
3 Ga0070676_10071289 3300005328 Bacteria 2087
4 Ga0070680_100453367 3300005336 Bacteria 1096
5 Ga0070660_100026898 3300005339 Bacteria 4287
6 Ga0070689_100046059 3300005340 Bacteria 3360
7 Ga0070668_100272582 3300005347 Bacteria 1411
8 Ga0070675_100235917 3300005354 Bacteria 1597
9 Ga0070674_100093749 3300005356 Bacteria 2173
10 Ga0070688_100426085 3300005365 Bacteria 987
11 Ga0070714_100927665 3300005435 Bacteria 846
12 Ga0070713_100934265 3300005436 Bacteria 835
13 Ga0070701_10191828 3300005438 Bacteria 1203
14 Ga0070711_100104802 3300005439 Bacteria 2064
15 Ga0070711_100478571 3300005439 Bacteria 1023
16 Ga0070681_10007484 3300005458 Bacteria 10672
17 Ga0070681_10383131 3300005458 Unclassified 1317
18 Ga0070679_100004568 3300005530 Bacteria 12787
19 Ga0068853_100517770 3300005539 Bacteria 1127
20 Ga0070695_100171378 3300005545 Bacteria 1531
21 Ga0070665_100266390 3300005548 Bacteria 1715
22 Ga0070664_100033730 3300005564 Bacteria 4290
23 Ga0068856_100057259 3300005614 Bacteria 3848
24 Ga0068856_100255362 3300005614 Bacteria 1768
25 Ga0068859_100563773 3300005617 Bacteria 1233
26 Ga0068870_10297758 3300005840 Bacteria 1017
27 Ga0068858_100184638 3300005842 Bacteria 1970
28 Ga0068860_100401546 3300005843 Bacteria 1356
29 Ga0068860_100421039 3300005843 Bacteria 1324
30 Ga0081455_10028468 3300005937 Bacteria 5105
31 Ga0081540_1205018 3300005983 Bacteria 714
32 Ga0075368_10109629 3300006042 Bacteria 1137
33 Ga0070716_100475060 3300006173 Bacteria 917
34 Ga0075367_10033848 3300006178 Bacteria 2948
35 Ga0075367_10085758 3300006178 Bacteria 1911
36 Ga0075369_10027917 3300006186 Bacteria 2362
37 Ga0075370_10005880 3300006353 Bacteria 6133
38 Ga0075434_100067152 3300006871 Bacteria 3573
39 Ga0075434_100298384 3300006871 Bacteria 1632
40 Ga0068865_100257934 3300006881 Bacteria 1379
41 Ga0097620_100563858 3300006931 Bacteria 1233
42 Ga0099795_10127675 3300007788 Bacteria 1023
43 Ga0105240_10171088 3300009093 Bacteria 2573
44 Ga0111539_10202378 3300009094 Bacteria 2315
45 Ga0105247_10011960 3300009101 Bacteria 5214
46 Ga0105241_10357181 3300009174 Bacteria 1270
47 Ga0105237_10103398 3300009545 Bacteria 2840
48 Ga0105238_10363083 3300009551 Bacteria 1438
49 Ga0105249_10381990 3300009553 Bacteria 1435
50 Ga0099796_10136722 3300010159 Bacteria 955
51 Ga0105239_10287196 3300010375 Bacteria 1852
52 Ga0105246_10426458 3300011119 Bacteria 1108
53 Ga0157373_10295382 3300013100 Bacteria 1149
54 Ga0157370_10010394 3300013104 Bacteria 9813
55 Ga0157369_10187610 3300013105 Bacteria 2174
56 Ga0157372_11132465 3300013307 Bacteria 905
57 Ga0157375_10003490 3300013308 Bacteria 13634
58 Ga0163163_10448012 3300014325 Bacteria 1351
59 Ga0157379_10071900 3300014968 Bacteria 3095
60 Ga0157376_10411364 3300014969 Bacteria 1310
61 Ga0206356_10533954 3300020070 Bacteria 1324
62 Ga0213873_10093265 3300021358 Bacteria 858
63 Ga0213871_10080563 3300021441 Bacteria 932
64 Ga0207710_10184863 3300025900 Bacteria 1024
65 Ga0207699_10391323 3300025906 Bacteria 988
66 Ga0207705_10354503 3300025909 Bacteria 1131
67 Ga0207695_10499933 3300025913 Bacteria 1098
68 Ga0207671_10184601 3300025914 Bacteria 1624
69 Ga0207671_10236039 3300025914 Bacteria 1435
70 Ga0207663_10075175 3300025916 Bacteria 2191
71 Ga0207660_10576116 3300025917 Bacteria 916
72 Ga0207657_10038674 3300025919 Bacteria 4245
73 Ga0207652_10645086 3300025921 Bacteria 947
74 Ga0207694_10371584 3300025924 Bacteria 1186
75 Ga0207659_10298249 3300025926 Bacteria 1323
76 Ga0207700_10201262 3300025928 Bacteria 1678
77 Ga0207644_10409303 3300025931 Bacteria 1110
78 Ga0207690_10180459 3300025932 Bacteria 1589
79 Ga0207690_10378221 3300025932 Bacteria 1125
80 Ga0207709_10145714 3300025935 Bacteria 1634
81 Ga0207670_10287117 3300025936 Bacteria 1284
82 Ga0207704_10278176 3300025938 Bacteria 1271
83 Ga0207665_10270419 3300025939 Bacteria 1262
84 Ga0207668_10493020 3300025972 Bacteria 1053
85 Ga0207703_10209983 3300026035 Bacteria 1735
86 Ga0207678_10973047 3300026067 Bacteria 751
87 Ga0207702_10395167 3300026078 Bacteria 1332
88 Ga0207648_10143476 3300026089 Bacteria 2106
89 Ga0207675_101215535 3300026118 Bacteria 774
90 Ga0207683_10321336 3300026121 Bacteria 1418
91 Ga0209588_1012384 3300027671 Bacteria 2589
92 Ga0268264_10481511 3300028381 Bacteria 1207
93 Ga0307515_10515370 3300028794 Bacteria 806
94 Ga0265338_10049395 3300028800 Bacteria 3814
95 Ga0265330_10004700 3300031235 Bacteria 6896
96 Ga0265325_10010387 3300031241 Bacteria 5395
97 Ga0265329_10069737 3300031242 Bacteria 1112
98 Ga0265340_10003376 3300031247 Bacteria 9020
99 Ga0265340_10013000 3300031247 Bacteria 4385
100 Ga0265340_10051742 3300031247 Bacteria 1988
101 Ga0265339_10002412 3300031249 Bacteria 13406
102 Ga0307513_10286566 3300031456 Bacteria 1421
103 Ga0265313_10000270 3300031595 Bacteria 56761
104 Ga0265314_10193075 3300031711 Bacteria 1210
105 Ga0373923_0011208 3300035111 Bacteria 3282
106 Ga0373923_0060509 3300035111 Unclassified 1608
107 Ga0373936_0003239 3300035113 Bacteria 6104
108 Ga0373945_0001726 3300035116 Bacteria 6743
109 Ga0373953_0006119 3300035117 Bacteria 3948
110 Ga0373954_0001507 3300035118 Bacteria 9468
111 Ga0373956_0152624 3300035119 Bacteria 1087
112 Ga0373957_0016037 3300035120 Bacteria 2588
113 Ga0373943_0001641 3300035170 Bacteria 10156
114 Ga0373946_0007458 3300035171 Bacteria 3999
115 Ga0373955_0000084 3300035172 Bacteria 38310
116 Ga0373962_0120552 3300035242 Bacteria 836
117 Ga0373924_0000931 3300035410 Bacteria 9226
118 Ga0373931_0015700 3300035691 Bacteria 3717
119 Ga0373935_0000333 3300035692 Bacteria 23819
120 Ga0373927_0065198 3300035695 Bacteria 2356
121 Ga0373947_0001540 3300035725 Bacteria 14142
122 Ga0373937_0000006 3300036401 Bacteria 194781
123 Ga0373925_0000002 3300037068 Bacteria 368879
124 Ga0395905_0103225 3300037471 Bacteria 2677
125 Ga0395905_0212361 3300037471 Bacteria 1813
126 Ga0436365_0033789 3300039437 Bacteria 2006
127 Ga0436365_1783249 3300039437 Bacteria 1549
128 Ga0436360_1020402 3300039438 Bacteria 879
129 Ga0436360_1021194 3300039438 Bacteria 1235
130 Ga0436360_1340661 3300039438 Bacteria 5975
131 Ga0436361_0574252 3300039447 Bacteria 2155
132 Ga0436361_0589198 3300039447 Bacteria 1157
133 Ga0436361_0617783 3300039447 Bacteria 7544
134 Ga0436361_0848129 3300039447 Bacteria 1343
135 Ga0436361_1089422 3300039447 Bacteria 1281
136 Ga0436362_0253562 3300039453 Bacteria 1194
137 Ga0436362_0543150 3300039453 Bacteria 872
138 Ga0436362_0663057 3300039453 Bacteria 1764
139 Ga0439458_0029179 3300042157 Bacteria 1308
140 Ga0495592_0000039 3300046454 Bacteria 124471
141 Ga0495629_0007298 3300046459 Bacteria 8142
142 Ga0495638_0009008 3300046460 Bacteria 7035
143 Ga0495651_0000376 3300046462 Bacteria 34540
144 Ga0495653_0000006 3300046463 Bacteria 363285
145 Ga0495582_0019194 3300046473 Bacteria 3740
146 Ga0495662_0009584 3300046476 Bacteria 4747
147 Ga0495664_0000002 3300046477 Bacteria 625183
148 Ga0495608_0000009 3300046511 Bacteria 266614
149 Ga0495618_0000027 3300046514 Bacteria 112522
150 Ga0495628_0000002 3300046516 Bacteria 589399
151 Ga0495630_0000912 3300046517 Bacteria 20616
152 Ga0495632_0083167 3300046519 Bacteria 1525
153 Ga0495652_0000004 3300046529 Bacteria 588877
154 Ga0495652_0034466 3300046529 Bacteria 4411
155 Ga0495665_0384453 3300046531 Bacteria 713
156 Ga0495640_0000005 3300046533 Bacteria 318271
157 Ga0495640_0129436 3300046533 Bacteria 1635
158 Ga0495587_0000007 3300046536 Bacteria 290788
159 Ga0495587_0059470 3300046536 Bacteria 2243
160 Ga0495645_0000003 3300046543 Bacteria 570133
161 Ga0495667_0000002 3300046559 Bacteria 437535
162 Ga0495634_0000022 3300046642 Bacteria 118988
163 Ga0495635_0000022 3300046663 Bacteria 160907
164 Ga0495657_0320307 3300046675 Bacteria 922
165 Ga0495599_0000001 3300046678 Bacteria 537563
166 Ga0495623_0000001 3300046679 Bacteria 313861
167 Ga0495646_0000014 3300046680 Bacteria 143781
168 Ga0495600_0000006 3300046809 Bacteria 151916
169 Ga0495604_0000005 3300047317 Bacteria 424516
170 Ga0495674_0000003 3300047319 Bacteria 562126
171 Ga0495672_0024366 3300047320 Bacteria 3900
172 Ga0495675_0000010 3300047444 Bacteria 153375
173 Ga0495684_0000028 3300047471 Bacteria 123549
174 Ga0495593_0002409 3300047673 Bacteria 11255
175 Ga0495602_0000054 3300048088 Bacteria 111411
176 Ga0495602_0189933 3300048088 Bacteria 1576
177 Ga0496100_0026979 3300048903 Bacteria 3527
178 Ga0496100_0080839 3300048903 Bacteria 2194
179 Ga0496100_0134851 3300048903 Bacteria 1743
180 Ga0496100_0142833 3300048903 Bacteria 1699
181 Ga0496100_0318329 3300048903 Bacteria 1168
182 Ga0496101_0037820 3300048904 Bacteria 3426
183 Ga0496101_0302461 3300048904 Bacteria 1253
184 Ga0496101_0336012 3300048904 Bacteria 1186
185 Ga0496101_0589951 3300048904 Bacteria 878
186 Ga0496102_0083851 3300048905 Bacteria 2941
187 Ga0496102_0152179 3300048905 Bacteria 2174
188 Ga0496102_0237097 3300048905 Bacteria 1720
189 Ga0496102_0989830 3300048905 Bacteria 761
190 Ga0496103_0293265 3300048906 Bacteria 1046
191 Ga0496104_0002993 3300048907 Bacteria 14567
192 Ga0496104_0134064 3300048907 Bacteria 2379
193 Ga0496104_0406095 3300048907 Bacteria 1274
194 Ga0496104_0590810 3300048907 Bacteria 1021
195 Ga0496105_0114916 3300048908 Bacteria 2220
196 Ga0496105_0163565 3300048908 Bacteria 1826
197 Ga0496105_0252413 3300048908 Bacteria 1428
198 Ga0496106_0140216 3300048909 Bacteria 1901
199 Ga0496106_0467206 3300048909 Bacteria 1013
200 Ga0496107_0031349 3300048910 Bacteria 3792
201 Ga0496107_0094981 3300048910 Bacteria 2181
202 Ga0496107_0518893 3300048910 Bacteria 883
203 Ga0496108_0026784 3300048911 Bacteria 4758
204 Ga0496108_0193612 3300048911 Bacteria 1763
205 Ga0496109_0041316 3300048912 Bacteria 4177
206 Ga0496109_0096006 3300048912 Bacteria 2746
207 Ga0496110_0007046 3300048913 Bacteria 8945
208 Ga0496110_0121660 3300048913 Bacteria 2352
209 Ga0496110_0731083 3300048913 Bacteria 892
210 Ga0496111_0010495 3300048914 Bacteria 6220
211 Ga0496111_0103268 3300048914 Bacteria 2096
212 Ga0496112_0001912 3300048915 Bacteria 16436
213 Ga0496112_0047756 3300048915 Bacteria 4199
214 Ga0496112_0735557 3300048915 Bacteria 913
215 Ga0496113_0072858 3300048916 Bacteria 2615
216 Ga0496114_0048765 3300048917 Bacteria 3523
217 Ga0496115_0141061 3300048918 Bacteria 1988
218 Ga0496115_0246548 3300048918 Bacteria 1471
219 Ga0496121_0026512 3300048924 Bacteria 5459
220 Ga0496126_0020736 3300048929 Bacteria 6434
221 Ga0496126_0076731 3300048929 Bacteria 2964
222 Ga0501036_0078965 3300049572 Bacteria 2784
223 Ga0501037_0648795 3300049573 Unclassified 706
224 Ga0501038_0205877 3300049574 Bacteria 1577
225 Ga0501039_0128258 3300049575 Bacteria 1990
226 Ga0501041_0140750 3300049577 Bacteria 1504
227 Ga0501042_0316227 3300049578 Bacteria 1128
228 Ga0501043_0111623 3300049579 Bacteria 2147
229 Ga0501068_0084183 3300049584 Bacteria 1956
230 Ga0501071_0120864 3300049587 Bacteria 1941
231 Ga0501071_0135492 3300049587 Bacteria 1832
232 Ga0501071_0529900 3300049587 Bacteria 904
233 Ga0501075_0496146 3300049591 Bacteria 931
234 Ga0501076_0016317 3300049592 Bacteria 5630
235 Ga0501079_0046681 3300049741 Bacteria 3342
236 Ga0501045_0191449 3300049824 Bacteria 1524
237 nmdc:mga03683_13577_c1 3300050489 Bacteria 3001
238 nmdc:mga03n38_221796_c1 3300050490 Bacteria 987
239 nmdc:mga0yw44_93090_c1 3300050492 Bacteria 1908
240 nmdc:mga06z11_1084_c1 3300050494 Bacteria 9910
241 nmdc:mga0qj67_289989_c1 3300050509 Bacteria 1326
242 nmdc:mga08y16_570156_c1 3300050511 Bacteria 1144
243 nmdc:mga0n895_258012_c1 3300050512 Bacteria 1769
244 nmdc:mga0n895_27115_c1 3300050512 Bacteria 5438
245 Ga0495601_0000008 3300053077 Bacteria 362152
246 Ga0495612_0000002 3300053078 Bacteria 310466
247 Ga0495612_0033661 3300053078 Bacteria 2074
248 Ga0495595_0000008 3300053084 Bacteria 196206
249 Ga0495595_0013674 3300053084 Bacteria 3432
250 Ga0495619_0000002 3300053085 Bacteria 530226
251 Ga0495619_0009933 3300053085 Bacteria 5994
252 Ga0500646_0037701 3300053090 Bacteria 1351
253 Ga0500595_002437 3300053119 Bacteria 9244
254 Ga0500588_0061351 3300053146 Bacteria 1206
255 Ga0500620_000036 3300053155 Bacteria 25353
256 Ga0500645_073121 3300053730 Bacteria 983
257 Ga0500601_000016 3300053737 Bacteria 40972
258 Ga0501084_0556049 3300054114 Bacteria 969
259 Ga0501082_0090814 3300060353 Bacteria 2637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026067 Ga0207678_10973047 Ga0207678_109730471 173
2 3300025972 Ga0207668_10493020 Ga0207668_104930201 186
3 3300046519 Ga0495632_0083167 Ga0495632_0083167_915_1478 186
4 3300046529 Ga0495652_0034466 Ga0495652_0034466_2231_2803 188
5 3300031247 Ga0265340_10013000 Ga0265340_100130004 189
6 3300046531 Ga0495665_0384453 Ga0495665_0384453_24_611 193
7 3300046533 Ga0495640_0129436 Ga0495640_0129436_131_730 193
8 3300048904 Ga0496101_0336012 Ga0496101_0336012_126_713 193
9 3300050490 nmdc:mga03n38_221796_c1 nmdc:mga03n38_221796_c1_46_771 200
10 iso_pu_bacteria 8001845381 8001848237 203
11 iso_pu_bacteria 2513237098 2513674489 204
12 iso_pu_bacteria 2513237101 2513695557 204
13 iso_pu_bacteria 2513237104 2513715184 204
14 iso_pu_bacteria 2524023210 2524468185 204
15 iso_pu_bacteria 2844315083 2844319710 204
16 iso_pu_bacteria 2874604998 2874612056 204
17 iso_pu_bacteria 2903768456 2903769441 204
18 iso_pu_bacteria 2906602504 2906609583 204
19 iso_pu_bacteria 2922386360 2922386636 204
20 iso_pu_bacteria 8056673599 8056680030 204
21 iso_pu_bacteria 2937822353 2937829340 206
22 3300005435 Ga0070714_100927665 Ga0070714_1009276651 207
23 3300006173 Ga0070716_100475060 Ga0070716_1004750601 207
24 3300006871 Ga0075434_100067152 Ga0075434_1000671523 207
25 3300006871 Ga0075434_100298384 Ga0075434_1002983842 207
26 3300007788 Ga0099795_10127675 Ga0099795_101276752 207
27 3300010159 Ga0099796_10136722 Ga0099796_101367221 207
28 3300025906 Ga0207699_10391323 Ga0207699_103913231 207
29 3300025928 Ga0207700_10201262 Ga0207700_102012622 207
30 3300025939 Ga0207665_10270419 Ga0207665_102704192 207
31 3300031247 Ga0265340_10051742 Ga0265340_100517422 207
32 3300035111 Ga0373923_0011208 Ga0373923_0011208_1314_1943 207
33 3300035113 Ga0373936_0003239 Ga0373936_0003239_1238_1867 207
34 3300035116 Ga0373945_0001726 Ga0373945_0001726_5008_5637 207
35 3300035117 Ga0373953_0006119 Ga0373953_0006119_1887_2516 207
36 3300035118 Ga0373954_0001507 Ga0373954_0001507_6202_6831 207
37 3300035119 Ga0373956_0152624 Ga0373956_0152624_151_780 207
38 3300035120 Ga0373957_0016037 Ga0373957_0016037_1731_2360 207
39 3300035170 Ga0373943_0001641 Ga0373943_0001641_1411_2040 207
40 3300035171 Ga0373946_0007458 Ga0373946_0007458_1305_1934 207
41 3300035172 Ga0373955_0000084 Ga0373955_0000084_2753_3382 207
42 3300035410 Ga0373924_0000931 Ga0373924_0000931_2750_3379 207
43 3300035692 Ga0373935_0000333 Ga0373935_0000333_9979_10608 207
44 3300035695 Ga0373927_0065198 Ga0373927_0065198_1263_1892 207
45 3300035725 Ga0373947_0001540 Ga0373947_0001540_4987_5616 207
46 3300036401 Ga0373937_0000006 Ga0373937_0000006_47954_48583 207
47 3300037068 Ga0373925_0000002 Ga0373925_0000002_179530_180159 207
48 3300046454 Ga0495592_0000039 Ga0495592_0000039_52776_53405 207
49 3300046459 Ga0495629_0007298 Ga0495629_0007298_2159_2788 207
50 3300046462 Ga0495651_0000376 Ga0495651_0000376_11276_11905 207
51 3300046463 Ga0495653_0000006 Ga0495653_0000006_179678_180307 207
52 3300046473 Ga0495582_0019194 Ga0495582_0019194_2915_3544 207
53 3300046476 Ga0495662_0009584 Ga0495662_0009584_3390_4019 207
54 3300046477 Ga0495664_0000002 Ga0495664_0000002_215312_215941 207
55 3300046511 Ga0495608_0000009 Ga0495608_0000009_264494_265123 207
56 3300046514 Ga0495618_0000027 Ga0495618_0000027_6667_7296 207
57 3300046516 Ga0495628_0000002 Ga0495628_0000002_179697_180326 207
58 3300046517 Ga0495630_0000912 Ga0495630_0000912_16248_16877 207
59 3300046529 Ga0495652_0000004 Ga0495652_0000004_408557_409186 207
60 3300046533 Ga0495640_0000005 Ga0495640_0000005_264509_265138 207
61 3300046536 Ga0495587_0000007 Ga0495587_0000007_53104_53733 207
62 3300046543 Ga0495645_0000003 Ga0495645_0000003_160948_161577 207
63 3300046559 Ga0495667_0000002 Ga0495667_0000002_257397_258026 207
64 3300046642 Ga0495634_0000022 Ga0495634_0000022_101713_102342 207
65 3300046663 Ga0495635_0000022 Ga0495635_0000022_149980_150609 207
66 3300046678 Ga0495599_0000001 Ga0495599_0000001_318375_319004 207
67 3300046679 Ga0495623_0000001 Ga0495623_0000001_87320_87949 207
68 3300046680 Ga0495646_0000014 Ga0495646_0000014_81724_82353 207
69 3300046809 Ga0495600_0000006 Ga0495600_0000006_48855_49484 207
70 3300047317 Ga0495604_0000005 Ga0495604_0000005_205341_205970 207
71 3300047319 Ga0495674_0000003 Ga0495674_0000003_381800_382429 207
72 3300047444 Ga0495675_0000010 Ga0495675_0000010_136661_137290 207
73 3300047471 Ga0495684_0000028 Ga0495684_0000028_69952_70581 207
74 3300047673 Ga0495593_0002409 Ga0495593_0002409_5529_6158 207
75 3300048088 Ga0495602_0000054 Ga0495602_0000054_18541_19170 207
76 3300050512 nmdc:mga0n895_258012_c1 nmdc:mga0n895_258012_c1_795_1424 207
77 3300050512 nmdc:mga0n895_27115_c1 nmdc:mga0n895_27115_c1_3428_4057 207
78 3300053077 Ga0495601_0000008 Ga0495601_0000008_142416_143045 207
79 3300053078 Ga0495612_0000002 Ga0495612_0000002_91293_91922 207
80 3300053084 Ga0495595_0000008 Ga0495595_0000008_142544_143173 207
81 3300053085 Ga0495619_0000002 Ga0495619_0000002_179700_180329 207
82 iso_pu_bacteria 8006964411 8006970942 207
83 iso_pu_bacteria 8006994254 8006999349 207
84 3300005336 Ga0070680_100453367 Ga0070680_1004533672 208
85 3300005458 Ga0070681_10007484 Ga0070681_100074844 208
86 3300005530 Ga0070679_100004568 Ga0070679_10000456812 208
87 3300005545 Ga0070695_100171378 Ga0070695_1001713781 208
88 3300006178 Ga0075367_10033848 Ga0075367_100338483 208
89 3300006178 Ga0075367_10085758 Ga0075367_100857582 208
90 3300006353 Ga0075370_10005880 Ga0075370_100058807 208
91 3300009093 Ga0105240_10171088 Ga0105240_101710882 208
92 3300009553 Ga0105249_10381990 Ga0105249_103819902 208
93 3300013100 Ga0157373_10295382 Ga0157373_102953822 208
94 3300013104 Ga0157370_10010394 Ga0157370_100103942 208
95 3300013307 Ga0157372_11132465 Ga0157372_111324651 208
96 3300025913 Ga0207695_10499933 Ga0207695_104999332 208
97 3300025914 Ga0207671_10236039 Ga0207671_102360391 208
98 3300025917 Ga0207660_10576116 Ga0207660_105761161 208
99 3300025932 Ga0207690_10378221 Ga0207690_103782212 208
100 3300037471 Ga0395905_0103225 Ga0395905_0103225_325_957 208
101 3300037471 Ga0395905_0212361 Ga0395905_0212361_998_1630 208
102 3300039438 Ga0436360_1021194 Ga0436360_1021194_240_872 208
103 3300039447 Ga0436361_0848129 Ga0436361_0848129_587_1219 208
104 3300047320 Ga0495672_0024366 Ga0495672_0024366_3046_3678 208
105 3300048903 Ga0496100_0026979 Ga0496100_0026979_592_1224 208
106 3300048904 Ga0496101_0037820 Ga0496101_0037820_1809_2441 208
107 3300048905 Ga0496102_0152179 Ga0496102_0152179_143_775 208
108 3300048908 Ga0496105_0114916 Ga0496105_0114916_1122_1754 208
109 3300048910 Ga0496107_0094981 Ga0496107_0094981_700_1332 208
110 3300048911 Ga0496108_0026784 Ga0496108_0026784_923_1555 208
111 3300048912 Ga0496109_0096006 Ga0496109_0096006_484_1116 208
112 3300048913 Ga0496110_0007046 Ga0496110_0007046_2416_3048 208
113 3300048914 Ga0496111_0010495 Ga0496111_0010495_4688_5320 208
114 3300048915 Ga0496112_0001912 Ga0496112_0001912_7073_7705 208
115 3300048929 Ga0496126_0020736 Ga0496126_0020736_5765_6397 208
116 3300050489 nmdc:mga03683_13577_c1 nmdc:mga03683_13577_c1_2347_2979 208
117 3300050492 nmdc:mga0yw44_93090_c1 nmdc:mga0yw44_93090_c1_1213_1845 208
118 3300050494 nmdc:mga06z11_1084_c1 nmdc:mga06z11_1084_c1_569_1201 208
119 3300053737 Ga0500601_000016 Ga0500601_000016_4810_5442 208
120 3300021441 Ga0213871_10080563 Ga0213871_100805632 209
121 3300005339 Ga0070660_100026898 Ga0070660_1000268981 210
122 3300005458 Ga0070681_10383131 Ga0070681_103831312 210
123 3300005539 Ga0068853_100517770 Ga0068853_1005177702 210
124 3300005843 Ga0068860_100421039 Ga0068860_1004210392 210
125 3300006042 Ga0075368_10109629 Ga0075368_101096292 210
126 3300025919 Ga0207657_10038674 Ga0207657_100386742 210
127 3300025921 Ga0207652_10645086 Ga0207652_106450862 210
128 3300025932 Ga0207690_10180459 Ga0207690_101804591 210
129 3300028794 Ga0307515_10515370 Ga0307515_105153701 210
130 3300028800 Ga0265338_10049395 Ga0265338_100493955 210
131 3300031241 Ga0265325_10010387 Ga0265325_100103876 210
132 3300031242 Ga0265329_10069737 Ga0265329_100697372 210
133 3300031249 Ga0265339_10002412 Ga0265339_100024128 210
134 3300031456 Ga0307513_10286566 Ga0307513_102865662 210
135 3300031595 Ga0265313_10000270 Ga0265313_1000027057 210
136 3300031711 Ga0265314_10193075 Ga0265314_101930752 210
137 3300042157 Ga0439458_0029179 Ga0439458_0029179_537_1172 210
138 3300048903 Ga0496100_0142833 Ga0496100_0142833_839_1504 210
139 3300053119 Ga0500595_002437 Ga0500595_002437_7843_8481 210
140 3300053155 Ga0500620_000036 Ga0500620_000036_24152_24787 210
141 3300053730 Ga0500645_073121 Ga0500645_073121_254_892 210
142 3300005983 Ga0081540_1205018 Ga0081540_12050181 211
143 3300009094 Ga0111539_10202378 Ga0111539_102023782 211
144 3300039447 Ga0436361_1089422 Ga0436361_1089422_533_1174 211
145 3300048903 Ga0496100_0318329 Ga0496100_0318329_294_935 211
146 3300048905 Ga0496102_0989830 Ga0496102_0989830_17_658 211
147 3300048907 Ga0496104_0002993 Ga0496104_0002993_12489_13130 211
148 3300048908 Ga0496105_0252413 Ga0496105_0252413_81_722 211
149 3300048909 Ga0496106_0140216 Ga0496106_0140216_509_1150 211
150 3300048911 Ga0496108_0193612 Ga0496108_0193612_763_1404 211
151 3300048912 Ga0496109_0041316 Ga0496109_0041316_3164_3805 211
152 3300048913 Ga0496110_0121660 Ga0496110_0121660_232_873 211
153 3300048914 Ga0496111_0103268 Ga0496111_0103268_885_1526 211
154 3300048915 Ga0496112_0047756 Ga0496112_0047756_3226_3867 211
155 3300048915 Ga0496112_0735557 Ga0496112_0735557_251_892 211
156 3300048916 Ga0496113_0072858 Ga0496113_0072858_351_992 211
157 3300050511 nmdc:mga08y16_570156_c1 nmdc:mga08y16_570156_c1_439_1080 211
158 3300005354 Ga0070675_100235917 Ga0070675_1002359172 212
159 3300005436 Ga0070713_100934265 Ga0070713_1009342651 212
160 3300025926 Ga0207659_10298249 Ga0207659_102982492 212
161 3300039437 Ga0436365_1783249 Ga0436365_1783249_34_681 212
162 3300048924 Ga0496121_0026512 Ga0496121_0026512_3601_4257 213
163 3300049573 Ga0501037_0648795 Ga0501037_0648795_42_692 214
164 3300006186 Ga0075369_10027917 Ga0075369_100279171 215
165 3300009551 Ga0105238_10363083 Ga0105238_103630832 215
166 3300011119 Ga0105246_10426458 Ga0105246_104264582 215
167 3300027671 Ga0209588_1012384 Ga0209588_10123842 215
168 3300031235 Ga0265330_10004700 Ga0265330_100047004 215
169 3300031247 Ga0265340_10003376 Ga0265340_100033769 215
170 3300035242 Ga0373962_0120552 Ga0373962_0120552_165_821 216
171 3300035691 Ga0373931_0015700 Ga0373931_0015700_463_1119 216
172 3300048903 Ga0496100_0134851 Ga0496100_0134851_66_722 216
173 3300048904 Ga0496101_0302461 Ga0496101_0302461_569_1225 216
174 3300048910 Ga0496107_0518893 Ga0496107_0518893_39_695 216
175 3300048913 Ga0496110_0731083 Ga0496110_0731083_141_797 216
176 3300021358 Ga0213873_10093265 Ga0213873_100932652 217
177 3300039438 Ga0436360_1020402 Ga0436360_1020402_151_825 217
178 3300039438 Ga0436360_1340661 Ga0436360_1340661_5135_5788 217
179 3300039447 Ga0436361_0574252 Ga0436361_0574252_995_1648 217
180 3300039447 Ga0436361_0617783 Ga0436361_0617783_372_1025 217
181 3300039453 Ga0436362_0253562 Ga0436362_0253562_257_922 217
182 3300039453 Ga0436362_0663057 Ga0436362_0663057_722_1375 217
183 3300005327 Ga0070658_10303796 Ga0070658_103037961 218
184 3300005328 Ga0070676_10071289 Ga0070676_100712892 218
185 3300005340 Ga0070689_100046059 Ga0070689_1000460592 218
186 3300005347 Ga0070668_100272582 Ga0070668_1002725822 218
187 3300005356 Ga0070674_100093749 Ga0070674_1000937491 218
188 3300005365 Ga0070688_100426085 Ga0070688_1004260851 218
189 3300005438 Ga0070701_10191828 Ga0070701_101918281 218
190 3300005439 Ga0070711_100104802 Ga0070711_1001048022 218
191 3300005548 Ga0070665_100266390 Ga0070665_1002663903 218
192 3300005564 Ga0070664_100033730 Ga0070664_1000337308 218
193 3300005614 Ga0068856_100255362 Ga0068856_1002553622 218
194 3300005617 Ga0068859_100563773 Ga0068859_1005637732 218
195 3300005840 Ga0068870_10297758 Ga0068870_102977581 218
196 3300005842 Ga0068858_100184638 Ga0068858_1001846383 218
197 3300005843 Ga0068860_100401546 Ga0068860_1004015463 218
198 3300005937 Ga0081455_10028468 Ga0081455_100284686 218
199 3300006881 Ga0068865_100257934 Ga0068865_1002579342 218
200 3300006931 Ga0097620_100563858 Ga0097620_1005638581 218
201 3300009101 Ga0105247_10011960 Ga0105247_100119602 218
202 3300013308 Ga0157375_10003490 Ga0157375_100034901 218
203 3300014325 Ga0163163_10448012 Ga0163163_104480122 218
204 3300014968 Ga0157379_10071900 Ga0157379_100719001 218
205 3300014969 Ga0157376_10411364 Ga0157376_104113641 218
206 3300025900 Ga0207710_10184863 Ga0207710_101848631 218
207 3300025916 Ga0207663_10075175 Ga0207663_100751752 218
208 3300025931 Ga0207644_10409303 Ga0207644_104093031 218
209 3300025935 Ga0207709_10145714 Ga0207709_101457141 218
210 3300025936 Ga0207670_10287117 Ga0207670_102871172 218
211 3300025938 Ga0207704_10278176 Ga0207704_102781762 218
212 3300026035 Ga0207703_10209983 Ga0207703_102099831 218
213 3300026089 Ga0207648_10143476 Ga0207648_101434763 218
214 3300026118 Ga0207675_101215535 Ga0207675_1012155351 218
215 3300026121 Ga0207683_10321336 Ga0207683_103213362 218
216 3300028381 Ga0268264_10481511 Ga0268264_104815111 218
217 3300035111 Ga0373923_0060509 Ga0373923_0060509_215_907 218
218 3300046460 Ga0495638_0009008 Ga0495638_0009008_650_1330 218
219 3300046536 Ga0495587_0059470 Ga0495587_0059470_1089_1751 218
220 3300046675 Ga0495657_0320307 Ga0495657_0320307_222_884 218
221 3300048904 Ga0496101_0589951 Ga0496101_0589951_159_836 218
222 3300048905 Ga0496102_0237097 Ga0496102_0237097_641_1318 218
223 3300048906 Ga0496103_0293265 Ga0496103_0293265_265_942 218
224 3300048907 Ga0496104_0134064 Ga0496104_0134064_140_817 218
225 3300048907 Ga0496104_0590810 Ga0496104_0590810_328_984 218
226 3300048908 Ga0496105_0163565 Ga0496105_0163565_782_1459 218
227 3300048909 Ga0496106_0467206 Ga0496106_0467206_102_779 218
228 3300048910 Ga0496107_0031349 Ga0496107_0031349_2712_3389 218
229 3300048917 Ga0496114_0048765 Ga0496114_0048765_736_1413 218
230 3300048918 Ga0496115_0141061 Ga0496115_0141061_393_1070 218
231 3300049572 Ga0501036_0078965 Ga0501036_0078965_1315_1992 218
232 3300049574 Ga0501038_0205877 Ga0501038_0205877_689_1366 218
233 3300049575 Ga0501039_0128258 Ga0501039_0128258_196_861 218
234 3300049577 Ga0501041_0140750 Ga0501041_0140750_777_1454 218
235 3300049578 Ga0501042_0316227 Ga0501042_0316227_168_845 218
236 3300049579 Ga0501043_0111623 Ga0501043_0111623_140_817 218
237 3300049584 Ga0501068_0084183 Ga0501068_0084183_49_714 218
238 3300049587 Ga0501071_0120864 Ga0501071_0120864_1070_1747 218
239 3300049587 Ga0501071_0135492 Ga0501071_0135492_1137_1811 218
240 3300049587 Ga0501071_0529900 Ga0501071_0529900_176_844 218
241 3300049591 Ga0501075_0496146 Ga0501075_0496146_127_804 218
242 3300049592 Ga0501076_0016317 Ga0501076_0016317_3428_4105 218
243 3300049741 Ga0501079_0046681 Ga0501079_0046681_843_1520 218
244 3300049824 Ga0501045_0191449 Ga0501045_0191449_617_1294 218
245 3300050509 nmdc:mga0qj67_289989_c1 nmdc:mga0qj67_289989_c1_333_1010 218
246 3300053078 Ga0495612_0033661 Ga0495612_0033661_741_1403 218
247 3300053084 Ga0495595_0013674 Ga0495595_0013674_2241_2903 218
248 3300053085 Ga0495619_0009933 Ga0495619_0009933_1904_2566 218
249 3300053090 Ga0500646_0037701 Ga0500646_0037701_532_1212 218
250 3300053146 Ga0500588_0061351 Ga0500588_0061351_167_847 218
251 3300054114 Ga0501084_0556049 Ga0501084_0556049_123_800 218
252 3300060353 Ga0501082_0090814 Ga0501082_0090814_197_874 218
253 3300005327 Ga0070658_10124462 Ga0070658_101244622 219
254 3300005439 Ga0070711_100478571 Ga0070711_1004785712 219
255 3300005614 Ga0068856_100057259 Ga0068856_1000572594 219
256 3300009174 Ga0105241_10357181 Ga0105241_103571812 219
257 3300009545 Ga0105237_10103398 Ga0105237_101033981 219
258 3300010375 Ga0105239_10287196 Ga0105239_102871962 219
259 3300013105 Ga0157369_10187610 Ga0157369_101876103 219
260 3300020070 Ga0206356_10533954 Ga0206356_105339541 219
261 3300025909 Ga0207705_10354503 Ga0207705_103545032 219
262 3300025914 Ga0207671_10184601 Ga0207671_101846012 219
263 3300025924 Ga0207694_10371584 Ga0207694_103715842 219
264 3300026078 Ga0207702_10395167 Ga0207702_103951672 219
265 3300039437 Ga0436365_0033789 Ga0436365_0033789_1106_1804 219
266 3300039447 Ga0436361_0589198 Ga0436361_0589198_186_845 219
267 3300039453 Ga0436362_0543150 Ga0436362_0543150_68_727 219
268 3300048088 Ga0495602_0189933 Ga0495602_0189933_829_1488 219
269 3300048903 Ga0496100_0080839 Ga0496100_0080839_1198_1857 219
270 3300048905 Ga0496102_0083851 Ga0496102_0083851_984_1643 219
271 3300048907 Ga0496104_0406095 Ga0496104_0406095_309_968 219
272 3300048918 Ga0496115_0246548 Ga0496115_0246548_567_1226 219
273 3300048929 Ga0496126_0076731 Ga0496126_0076731_396_1055 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

39

206

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2isj-assembly1.cif.gz_A blub bound to oxidized fmn 0.8969 8 213
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8779 22 194
3g14-assembly1.cif.gz_B crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.8743 22 194
3kwk-assembly1.cif.gz_A-2 crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (np_809094.1) from bacteroides thetaiotaomicron vpi-5482 at 1.54 a resolution 0.8681 23 198
3m5k-assembly1.cif.gz_B crystal structure of putative nadh dehydrogenase/nad(p)h nitroreductase (bdi_1728) from parabacteroides distasonis atcc 8503 at 1.86 a resolution 0.8498 23 198
ID Description Score Start End Superfamily
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8908 8 200 3.40.109.10
2isjB01 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8864 8 200 3.40.109.10
3g14A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8718 22 194 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8589 13 194 3.40.109.10
af_O07233_1_181_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8502 13 194 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A537Y1A4-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.9448 95 219 GO:0102919
AF-A0A1I3QWK6-F1-model_v4 Cob(II)yrinic acid a,c-diamide reductase 0.9397 7 219 GO:0016491
AF-A0A238JDV8-F1-model_v4 5,6-dimethylbenzimidazole synthase (EC 1.13.11.79) 0.9364 12 219 GO:0102919
AF-A0A2T4YWN1-F1-model_v4 Cob(II)yrinic acid a,c-diamide reductase 0.9358 8 213 GO:0016491
AF-A0A317DZI4-F1-model_v4 5,6-dimethylbenzimidazole synthase 0.9353 8 213 GO:0016491

Feature Viewer

pLDDT pTM Quality
88.03 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map