F379150

General Info

Members Datasets Scaffolds Average Seq Length
273 190 546 153

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0031414|Ga0373947_0031414_791_1312
Length 173
Sequence MIAVVRISDPRDSLEIAMSTTIKVNGVDRAVDVDGDTPLLWVLRDVLGMTGTKFGCGMALCGACTVHVDGVATRSCITSIDSLGTSEVTTIEAIGATPAGAKIQKAWLDREVVQCGYCQSGQIMSASALLASNPHPTDGDIDDAMSGNICRCGTYVRIREAIKQAAQSGGQGG

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
71 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
72 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
73 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
109 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
121 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
131 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
187 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
188 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
189 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
190 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 1.1
Rhizoplane 5.13
Rhizosphere 83.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0031414 3300035725 Bacteria 3126
2 Ga0070676_10322216 3300005328 Bacteria 1054
3 Ga0070690_100478849 3300005330 Bacteria 928
4 Ga0070689_100115577 3300005340 Bacteria 2139
5 Ga0070691_10083750 3300005341 Bacteria 1565
6 Ga0070687_100155937 3300005343 Bacteria 1345
7 Ga0070668_100520577 3300005347 Bacteria 1032
8 Ga0070674_100850884 3300005356 Bacteria 791
9 Ga0070688_100021888 3300005365 Bacteria 3739
10 Ga0070667_100091694 3300005367 Bacteria 2613
11 Ga0070709_10010046 3300005434 Bacteria 5232
12 Ga0070709_10060502 3300005434 Bacteria 2408
13 Ga0070714_100059474 3300005435 Bacteria 3276
14 Ga0070714_100186079 3300005435 Bacteria 1892
15 Ga0070713_100022038 3300005436 Bacteria 4915
16 Ga0070713_100052230 3300005436 Bacteria 3383
17 Ga0070710_10001434 3300005437 Bacteria 11262
18 Ga0070710_10006716 3300005437 Bacteria 5545
19 Ga0070710_10392484 3300005437 Bacteria 928
20 Ga0070711_100005811 3300005439 Bacteria 7408
21 Ga0070711_100011825 3300005439 Bacteria 5431
22 Ga0070711_101109469 3300005439 Bacteria 682
23 Ga0070705_100403285 3300005440 Bacteria 1013
24 Ga0070694_100151572 3300005444 Bacteria 1694
25 Ga0070708_100036336 3300005445 Bacteria 4296
26 Ga0070708_100057243 3300005445 Bacteria 3470
27 Ga0070708_100274270 3300005445 Bacteria 1586
28 Ga0070708_100559932 3300005445 Bacteria 1078
29 Ga0070678_100358846 3300005456 Bacteria 1255
30 Ga0068867_100596410 3300005459 Bacteria 963
31 Ga0070706_100013709 3300005467 Bacteria 7496
32 Ga0070706_100909905 3300005467 Bacteria 813
33 Ga0070707_100017405 3300005468 Bacteria 6755
34 Ga0070698_100035603 3300005471 Bacteria 5146
35 Ga0070698_100285965 3300005471 Bacteria 1580
36 Ga0070698_100485238 3300005471 Bacteria 1173
37 Ga0068853_101346380 3300005539 Bacteria 690
38 Ga0070672_100313069 3300005543 Bacteria 1333
39 Ga0070665_100638843 3300005548 Bacteria 1077
40 Ga0070704_100424124 3300005549 Bacteria 1140
41 Ga0070704_100498927 3300005549 Bacteria 1056
42 Ga0068857_100809206 3300005577 Bacteria 895
43 Ga0068856_101471784 3300005614 Bacteria 695
44 Ga0070702_101257129 3300005615 Bacteria 599
45 Ga0068859_100155921 3300005617 Bacteria 2361
46 Ga0068859_100680399 3300005617 Bacteria 1120
47 Ga0068863_100071091 3300005841 Bacteria 3292
48 Ga0068863_100919149 3300005841 Bacteria 876
49 Ga0068858_100288924 3300005842 Bacteria 1563
50 Ga0081455_10232758 3300005937 Bacteria 1359
51 Ga0081538_10223808 3300005981 Bacteria 743
52 Ga0070717_10007835 3300006028 Bacteria 7949
53 Ga0070717_10019686 3300006028 Bacteria 5298
54 Ga0075365_10015975 3300006038 Bacteria 4553
55 Ga0075365_10190576 3300006038 Bacteria 1435
56 Ga0075368_10191319 3300006042 Bacteria 864
57 Ga0075363_100049638 3300006048 Bacteria 2235
58 Ga0070715_10117810 3300006163 Bacteria 1262
59 Ga0070716_100022732 3300006173 Bacteria 3317
60 Ga0070712_100032611 3300006175 Bacteria 3518
61 Ga0070712_100054442 3300006175 Bacteria 2797
62 Ga0070712_100544437 3300006175 Bacteria 977
63 Ga0075367_10183748 3300006178 Bacteria 1304
64 Ga0075367_10563844 3300006178 Bacteria 723
65 Ga0075369_10374310 3300006186 Bacteria 670
66 Ga0075366_10219513 3300006195 Bacteria 1158
67 Ga0075428_100014294 3300006844 Bacteria 8825
68 Ga0075428_100738602 3300006844 Bacteria 1048
69 Ga0075428_101178795 3300006844 Bacteria 808
70 Ga0075430_100009311 3300006846 Bacteria 8302
71 Ga0075430_100064989 3300006846 Bacteria 3066
72 Ga0075430_100311872 3300006846 Bacteria 1301
73 Ga0075431_100002452 3300006847 Bacteria 17855
74 Ga0075431_101100958 3300006847 Bacteria 759
75 Ga0075433_10059028 3300006852 Bacteria 3357
76 Ga0075433_10140975 3300006852 Bacteria 2143
77 Ga0075434_100007999 3300006871 Bacteria 9802
78 Ga0075434_100200393 3300006871 Bacteria 2016
79 Ga0075434_101710271 3300006871 Bacteria 637
80 Ga0075429_100009283 3300006880 Bacteria 8537
81 Ga0075436_100010863 3300006914 Bacteria 6248
82 Ga0097620_100155930 3300006931 Bacteria 2361
83 Ga0097620_100680528 3300006931 Bacteria 1120
84 Ga0099794_10005031 3300007265 Bacteria 5266
85 Ga0099795_10003317 3300007788 Bacteria 3967
86 Ga0099795_10041834 3300007788 Bacteria 1633
87 Ga0111539_10007797 3300009094 Bacteria 13672
88 Ga0111539_10026748 3300009094 Bacteria 7050
89 Ga0111539_10146429 3300009094 Bacteria 2765
90 Ga0111539_12271534 3300009094 Bacteria 629
91 Ga0114129_10001297 3300009147 Bacteria 33328
92 Ga0114129_10292252 3300009147 Bacteria 2174
93 Ga0114129_10653674 3300009147 Bacteria 1356
94 Ga0105243_10967291 3300009148 Bacteria 852
95 Ga0105242_10350445 3300009176 Bacteria 1363
96 Ga0105248_10817080 3300009177 Bacteria 1052
97 Ga0105248_11158693 3300009177 Bacteria 874
98 Ga0105249_11624050 3300009553 Bacteria 719
99 Ga0099796_10002295 3300010159 Bacteria 4161
100 Ga0157374_10208717 3300013296 Bacteria 1915
101 Ga0157378_10470485 3300013297 Bacteria 1250
102 Ga0163162_10974326 3300013306 Bacteria 958
103 Ga0157375_10008584 3300013308 Bacteria 8946
104 Ga0182008_10079116 3300014497 Bacteria 1617
105 Ga0182008_10129613 3300014497 Bacteria 1257
106 Ga0157376_11050193 3300014969 Bacteria 839
107 Ga0157376_11196884 3300014969 Bacteria 788
108 Ga0163161_10059406 3300017792 Bacteria 2780
109 Ga0163161_11442368 3300017792 Bacteria 602
110 Ga0214542_1015864 3300021321 Bacteria 7610
111 Ga0214543_1001580 3300021327 Bacteria 44273
112 Ga0213873_10000811 3300021358 Bacteria 5043
113 Ga0213872_10031335 3300021361 Bacteria 2437
114 Ga0213872_10069302 3300021361 Bacteria 1591
115 Ga0213875_10088756 3300021388 Bacteria 1442
116 Ga0213875_10393328 3300021388 Bacteria 661
117 Ga0213871_10000161 3300021441 Bacteria 7214
118 Ga0213871_10021599 3300021441 Bacteria 1606
119 Ga0207692_10007178 3300025898 Bacteria 4553
120 Ga0207692_10069320 3300025898 Bacteria 1852
121 Ga0207692_10332118 3300025898 Bacteria 933
122 Ga0207692_10607415 3300025898 Bacteria 704
123 Ga0207685_10007884 3300025905 Bacteria 2999
124 Ga0207699_10004550 3300025906 Bacteria 6625
125 Ga0207699_10092583 3300025906 Bacteria 1900
126 Ga0207684_10087682 3300025910 Bacteria 2651
127 Ga0207693_10001772 3300025915 Bacteria 18926
128 Ga0207693_10031677 3300025915 Bacteria 4178
129 Ga0207693_10054865 3300025915 Bacteria 3126
130 Ga0207693_10432440 3300025915 Bacteria 1029
131 Ga0207693_10702249 3300025915 Bacteria 783
132 Ga0207663_10008912 3300025916 Bacteria 5276
133 Ga0207646_10127200 3300025922 Bacteria 2291
134 Ga0207700_10052799 3300025928 Bacteria 3041
135 Ga0207664_10032161 3300025929 Bacteria 4019
136 Ga0207664_10254114 3300025929 Bacteria 1535
137 Ga0207670_10083871 3300025936 Bacteria 2236
138 Ga0207669_10403974 3300025937 Bacteria 1071
139 Ga0207665_10001072 3300025939 Bacteria 18388
140 Ga0207691_10001929 3300025940 Bacteria 20238
141 Ga0207691_10104699 3300025940 Bacteria 2521
142 Ga0207658_10140303 3300025986 Bacteria 1955
143 Ga0207708_10195240 3300026075 Bacteria 1613
144 Ga0207641_11618866 3300026088 Bacteria 649
145 Ga0207648_11103846 3300026089 Bacteria 744
146 Ga0207675_100193713 3300026118 Bacteria 1950
147 Ga0207683_10137800 3300026121 Bacteria 2197
148 Ga0209179_1001525 3300027512 Bacteria 2866
149 Ga0209588_1046450 3300027671 Bacteria 1404
150 Ga0209813_10104971 3300027866 Bacteria 966
151 Ga0207428_10005645 3300027907 Bacteria 11630
152 Ga0207428_10098193 3300027907 Bacteria 2266
153 Ga0207428_10229689 3300027907 Bacteria 1389
154 Ga0268264_10068832 3300028381 Bacteria 2993
155 Ga0265327_10020990 3300031251 Bacteria 3957
156 Ga0265316_10111618 3300031344 Bacteria 2070
157 Ga0307513_10009419 3300031456 Bacteria 12353
158 Ga0307513_10529231 3300031456 Bacteria 893
159 Ga0307513_10683566 3300031456 Bacteria 732
160 Ga0307516_10047019 3300031730 Bacteria 4255
161 Ga0373929_0033791 3300035085 Bacteria 1107
162 Ga0373939_0341189 3300035114 Bacteria 607
163 Ga0373943_0008026 3300035170 Bacteria 4739
164 Ga0373943_0181147 3300035170 Bacteria 1158
165 Ga0373946_0004365 3300035171 Bacteria 5064
166 Ga0373946_0021900 3300035171 Bacteria 2483
167 Ga0373946_0203339 3300035171 Bacteria 950
168 Ga0373955_0089883 3300035172 Bacteria 1749
169 Ga0373962_0018625 3300035242 Bacteria 1809
170 Ga0373935_0059678 3300035692 Bacteria 2439
171 Ga0373927_0004169 3300035695 Bacteria 10157
172 Ga0373947_0011282 3300035725 Bacteria 5128
173 Ga0373937_0154794 3300036401 Bacteria 2148
174 Ga0373925_0008051 3300037068 Bacteria 7678
175 Ga0373925_0394360 3300037068 Bacteria 1128
176 Ga0436364_1060115 3300037853 Bacteria 1683
177 Ga0436364_1097094 3300037853 Bacteria 573
178 Ga0436365_1925747 3300039437 Bacteria 1834
179 Ga0436360_0525362 3300039438 Bacteria 909
180 Ga0436360_0608758 3300039438 Bacteria 5905
181 Ga0436360_0993224 3300039438 Bacteria 3222
182 Ga0436361_0795914 3300039447 Bacteria 15178
183 Ga0436361_0993394 3300039447 Bacteria 4166
184 Ga0436363_0819229 3300039450 Bacteria 1318
185 Ga0436363_1394473 3300039450 Bacteria 905
186 Ga0436362_0462054 3300039453 Bacteria 13636
187 Ga0439464_0106882 3300042439 Bacteria 854
188 Ga0495617_073762 3300046452 Bacteria 1121
189 Ga0495603_0016575 3300046455 Bacteria 4458
190 Ga0495638_0078798 3300046460 Bacteria 2004
191 Ga0495641_0021767 3300046461 Bacteria 3219
192 Ga0495580_0199021 3300046472 Bacteria 1381
193 Ga0495582_0013127 3300046473 Bacteria 4560
194 Ga0495605_0144942 3300046474 Bacteria 1063
195 Ga0495605_0278653 3300046474 Bacteria 711
196 Ga0495639_0026099 3300046475 Bacteria 2580
197 Ga0495664_0145755 3300046477 Bacteria 1436
198 Ga0495585_0056656 3300046492 Bacteria 2164
199 Ga0495607_0280524 3300046501 Bacteria 791
200 Ga0495608_0745209 3300046511 Bacteria 581
201 Ga0495631_0065082 3300046518 Bacteria 1578
202 Ga0495644_0025174 3300046523 Bacteria 2260
203 Ga0495648_0000671 3300046524 Bacteria 36562
204 Ga0495642_0079182 3300046528 Bacteria 1382
205 Ga0495665_0167583 3300046531 Bacteria 1144
206 Ga0495640_0328441 3300046533 Bacteria 946
207 Ga0495598_0002621 3300046537 Bacteria 3722
208 Ga0495621_0386167 3300046539 Bacteria 592
209 Ga0495622_0227328 3300046557 Bacteria 825
210 Ga0495633_0074226 3300046558 Bacteria 1585
211 Ga0495656_0092641 3300046615 Bacteria 1384
212 Ga0495611_0146868 3300046648 Bacteria 1101
213 Ga0495659_0459609 3300046664 Bacteria 555
214 Ga0495661_0194126 3300046665 Bacteria 1067
215 Ga0495588_0046046 3300046674 Bacteria 2237
216 Ga0495613_0230318 3300046689 Bacteria 1298
217 Ga0495624_0143199 3300046690 Bacteria 1463
218 Ga0495670_0018375 3300046691 Bacteria 3442
219 Ga0495604_0475538 3300047317 Bacteria 813
220 Ga0495636_0478608 3300047318 Bacteria 600
221 Ga0495674_0582003 3300047319 Bacteria 888
222 Ga0495672_0000912 3300047320 Bacteria 30930
223 Ga0495676_0006508 3300047321 Bacteria 10767
224 Ga0495676_0251643 3300047321 Bacteria 1205
225 Ga0495677_0110780 3300047445 Bacteria 1044
226 Ga0495685_235522 3300047447 Bacteria 582
227 Ga0495673_0069968 3300047469 Bacteria 1479
228 Ga0495615_0007680 3300048090 Bacteria 2057
229 Ga0496102_0207964 3300048905 Bacteria 1845
230 Ga0496105_0390008 3300048908 Bacteria 1107
231 Ga0496106_0003613 3300048909 Bacteria 11533
232 Ga0496106_0922321 3300048909 Bacteria 689
233 Ga0496107_0004244 3300048910 Bacteria 9686
234 Ga0496108_0001446 3300048911 Bacteria 18765
235 Ga0496108_0025433 3300048911 Bacteria 4879
236 Ga0496108_0559256 3300048911 Bacteria 998
237 Ga0496110_0121771 3300048913 Bacteria 2351
238 Ga0496112_0341006 3300048915 Bacteria 1442
239 Ga0496112_0436077 3300048915 Bacteria 1248
240 Ga0496113_0122949 3300048916 Bacteria 2031
241 Ga0496114_0250521 3300048917 Bacteria 1558
242 nmdc:mga03n38_34010_c1 3300050490 Bacteria 2173
243 nmdc:mga0yw44_28188_c1 3300050492 Bacteria 3228
244 nmdc:mga0yw44_71978_c1 3300050492 Bacteria 2147
245 nmdc:mga0k408_383903_c1 3300050493 Bacteria 837
246 nmdc:mga06z11_155270_c1 3300050494 Bacteria 1304
247 nmdc:mga04h51_124018_c1 3300050495 Bacteria 965
248 nmdc:mga05p37_333379_c1 3300050507 Bacteria 1791
249 nmdc:mga05p37_507602_c1 3300050507 Bacteria 1382
250 nmdc:mga05p37_901_c1 3300050507 Bacteria 33493
251 nmdc:mga09592_12262_c1 3300050508 Bacteria 6977
252 nmdc:mga09592_376360_c1 3300050508 Bacteria 1228
253 nmdc:mga0qj67_327234_c1 3300050509 Bacteria 1240
254 nmdc:mga0qj67_68472_c1 3300050509 Bacteria 2829
255 nmdc:mga06r32_237312_c1 3300050510 Bacteria 1811
256 nmdc:mga06r32_2589_c1 3300050510 Bacteria 16152
257 nmdc:mga08y16_1083_c1 3300050511 Bacteria 26813
258 nmdc:mga08y16_1694630_c1 3300050511 Bacteria 587
259 nmdc:mga08y16_297716_c1 3300050511 Bacteria 1663
260 nmdc:mga08y16_4664_c1 3300050511 Bacteria 14279
261 nmdc:mga08y16_533913_c1 3300050511 Bacteria 1189
262 nmdc:mga0n895_12880_c1 3300050512 Bacteria 7516
263 nmdc:mga0rr50_33380_c1 3300050513 Bacteria 3675
264 nmdc:mga08x19_41303_c1 3300050514 Bacteria 2937
265 nmdc:mga0a205_275619_c1 3300050515 Bacteria 1558
266 nmdc:mga0sz30_97119_c1 3300050516 Bacteria 1285
267 Ga0495595_0429544 3300053084 Bacteria 671
268 Ga0495619_0015529 3300053085 Bacteria 4818
269 Ga0500641_0217589 3300053096 Bacteria 811
270 Ga0500562_076421 3300053108 Bacteria 905
271 2514592627 2513237351 Bacteria 6968952
272 2770197743 2767802442 Bacteria 5747986
273 2894656706 2894652903 Bacteria 4587256
274 Ga0373947_0031414
275 Ga0070676_10322216
276 Ga0070690_100478849
277 Ga0070689_100115577
278 Ga0070691_10083750
279 Ga0070687_100155937
280 Ga0070668_100520577
281 Ga0070674_100850884
282 Ga0070688_100021888
283 Ga0070667_100091694
284 Ga0070709_10010046
285 Ga0070709_10060502
286 Ga0070714_100059474
287 Ga0070714_100186079
288 Ga0070713_100022038
289 Ga0070713_100052230
290 Ga0070710_10001434
291 Ga0070710_10006716
292 Ga0070710_10392484
293 Ga0070711_100005811
294 Ga0070711_100011825
295 Ga0070711_101109469
296 Ga0070705_100403285
297 Ga0070694_100151572
298 Ga0070708_100036336
299 Ga0070708_100057243
300 Ga0070708_100274270
301 Ga0070708_100559932
302 Ga0070678_100358846
303 Ga0068867_100596410
304 Ga0070706_100013709
305 Ga0070706_100909905
306 Ga0070707_100017405
307 Ga0070698_100035603
308 Ga0070698_100285965
309 Ga0070698_100485238
310 Ga0068853_101346380
311 Ga0070672_100313069
312 Ga0070665_100638843
313 Ga0070704_100424124
314 Ga0070704_100498927
315 Ga0068857_100809206
316 Ga0068856_101471784
317 Ga0070702_101257129
318 Ga0068859_100155921
319 Ga0068859_100680399
320 Ga0068863_100071091
321 Ga0068863_100919149
322 Ga0068858_100288924
323 Ga0081455_10232758
324 Ga0081538_10223808
325 Ga0070717_10007835
326 Ga0070717_10019686
327 Ga0075365_10015975
328 Ga0075365_10190576
329 Ga0075368_10191319
330 Ga0075363_100049638
331 Ga0070715_10117810
332 Ga0070716_100022732
333 Ga0070712_100032611
334 Ga0070712_100054442
335 Ga0070712_100544437
336 Ga0075367_10183748
337 Ga0075367_10563844
338 Ga0075369_10374310
339 Ga0075366_10219513
340 Ga0075428_100014294
341 Ga0075428_100738602
342 Ga0075428_101178795
343 Ga0075430_100009311
344 Ga0075430_100064989
345 Ga0075430_100311872
346 Ga0075431_100002452
347 Ga0075431_101100958
348 Ga0075433_10059028
349 Ga0075433_10140975
350 Ga0075434_100007999
351 Ga0075434_100200393
352 Ga0075434_101710271
353 Ga0075429_100009283
354 Ga0075436_100010863
355 Ga0097620_100155930
356 Ga0097620_100680528
357 Ga0099794_10005031
358 Ga0099795_10003317
359 Ga0099795_10041834
360 Ga0111539_10007797
361 Ga0111539_10026748
362 Ga0111539_10146429
363 Ga0111539_12271534
364 Ga0114129_10001297
365 Ga0114129_10292252
366 Ga0114129_10653674
367 Ga0105243_10967291
368 Ga0105242_10350445
369 Ga0105248_10817080
370 Ga0105248_11158693
371 Ga0105249_11624050
372 Ga0099796_10002295
373 Ga0157374_10208717
374 Ga0157378_10470485
375 Ga0163162_10974326
376 Ga0157375_10008584
377 Ga0182008_10079116
378 Ga0182008_10129613
379 Ga0157376_11050193
380 Ga0157376_11196884
381 Ga0163161_10059406
382 Ga0163161_11442368
383 Ga0214542_1015864
384 Ga0214543_1001580
385 Ga0213873_10000811
386 Ga0213872_10031335
387 Ga0213872_10069302
388 Ga0213875_10088756
389 Ga0213875_10393328
390 Ga0213871_10000161
391 Ga0213871_10021599
392 Ga0207692_10007178
393 Ga0207692_10069320
394 Ga0207692_10332118
395 Ga0207692_10607415
396 Ga0207685_10007884
397 Ga0207699_10004550
398 Ga0207699_10092583
399 Ga0207684_10087682
400 Ga0207693_10001772
401 Ga0207693_10031677
402 Ga0207693_10054865
403 Ga0207693_10432440
404 Ga0207693_10702249
405 Ga0207663_10008912
406 Ga0207646_10127200
407 Ga0207700_10052799
408 Ga0207664_10032161
409 Ga0207664_10254114
410 Ga0207670_10083871
411 Ga0207669_10403974
412 Ga0207665_10001072
413 Ga0207691_10001929
414 Ga0207691_10104699
415 Ga0207658_10140303
416 Ga0207708_10195240
417 Ga0207641_11618866
418 Ga0207648_11103846
419 Ga0207675_100193713
420 Ga0207683_10137800
421 Ga0209179_1001525
422 Ga0209588_1046450
423 Ga0209813_10104971
424 Ga0207428_10005645
425 Ga0207428_10098193
426 Ga0207428_10229689
427 Ga0268264_10068832
428 Ga0265327_10020990
429 Ga0265316_10111618
430 Ga0307513_10009419
431 Ga0307513_10529231
432 Ga0307513_10683566
433 Ga0307516_10047019
434 Ga0373929_0033791
435 Ga0373939_0341189
436 Ga0373943_0008026
437 Ga0373943_0181147
438 Ga0373946_0004365
439 Ga0373946_0021900
440 Ga0373946_0203339
441 Ga0373955_0089883
442 Ga0373962_0018625
443 Ga0373935_0059678
444 Ga0373927_0004169
445 Ga0373947_0011282
446 Ga0373937_0154794
447 Ga0373925_0008051
448 Ga0373925_0394360
449 Ga0436364_1060115
450 Ga0436364_1097094
451 Ga0436365_1925747
452 Ga0436360_0525362
453 Ga0436360_0608758
454 Ga0436360_0993224
455 Ga0436361_0795914
456 Ga0436361_0993394
457 Ga0436363_0819229
458 Ga0436363_1394473
459 Ga0436362_0462054
460 Ga0439464_0106882
461 Ga0495617_073762
462 Ga0495603_0016575
463 Ga0495638_0078798
464 Ga0495641_0021767
465 Ga0495580_0199021
466 Ga0495582_0013127
467 Ga0495605_0144942
468 Ga0495605_0278653
469 Ga0495639_0026099
470 Ga0495664_0145755
471 Ga0495585_0056656
472 Ga0495607_0280524
473 Ga0495608_0745209
474 Ga0495631_0065082
475 Ga0495644_0025174
476 Ga0495648_0000671
477 Ga0495642_0079182
478 Ga0495665_0167583
479 Ga0495640_0328441
480 Ga0495598_0002621
481 Ga0495621_0386167
482 Ga0495622_0227328
483 Ga0495633_0074226
484 Ga0495656_0092641
485 Ga0495611_0146868
486 Ga0495659_0459609
487 Ga0495661_0194126
488 Ga0495588_0046046
489 Ga0495613_0230318
490 Ga0495624_0143199
491 Ga0495670_0018375
492 Ga0495604_0475538
493 Ga0495636_0478608
494 Ga0495674_0582003
495 Ga0495672_0000912
496 Ga0495676_0006508
497 Ga0495676_0251643
498 Ga0495677_0110780
499 Ga0495685_235522
500 Ga0495673_0069968
501 Ga0495615_0007680
502 Ga0496102_0207964
503 Ga0496105_0390008
504 Ga0496106_0003613
505 Ga0496106_0922321
506 Ga0496107_0004244
507 Ga0496108_0001446
508 Ga0496108_0025433
509 Ga0496108_0559256
510 Ga0496110_0121771
511 Ga0496112_0341006
512 Ga0496112_0436077
513 Ga0496113_0122949
514 Ga0496114_0250521
515 nmdc:mga03n38_34010_c1
516 nmdc:mga0yw44_28188_c1
517 nmdc:mga0yw44_71978_c1
518 nmdc:mga0k408_383903_c1
519 nmdc:mga06z11_155270_c1
520 nmdc:mga04h51_124018_c1
521 nmdc:mga05p37_333379_c1
522 nmdc:mga05p37_507602_c1
523 nmdc:mga05p37_901_c1
524 nmdc:mga09592_12262_c1
525 nmdc:mga09592_376360_c1
526 nmdc:mga0qj67_327234_c1
527 nmdc:mga0qj67_68472_c1
528 nmdc:mga06r32_237312_c1
529 nmdc:mga06r32_2589_c1
530 nmdc:mga08y16_1083_c1
531 nmdc:mga08y16_1694630_c1
532 nmdc:mga08y16_297716_c1
533 nmdc:mga08y16_4664_c1
534 nmdc:mga08y16_533913_c1
535 nmdc:mga0n895_12880_c1
536 nmdc:mga0rr50_33380_c1
537 nmdc:mga08x19_41303_c1
538 nmdc:mga0a205_275619_c1
539 nmdc:mga0sz30_97119_c1
540 Ga0495595_0429544
541 Ga0495619_0015529
542 Ga0500641_0217589
543 Ga0500562_076421
544 2514592627
545 2770197743
546 2894656706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

90

163

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

22

86

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9485 1 150
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9303 1 150
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9228 2 150
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9155 1 150
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9148 1 150
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9408 1 75 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9387 85 150 1.10.150.120
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9337 1 73 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9334 85 150 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9299 85 150 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A525L8B2-F1-model_v4 (2Fe-2S)-binding protein 0.9858 4 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A508TFB2-F1-model_v4 Isoquinoline 1-oxidoreductase subunit alpha (EC 1.3.99.16) 0.9856 1 149 GO:0046872
GO:0047121
GO:0051537
AF-A0A370WTP1-F1-model_v4 (2Fe-2S)-binding protein 0.9854 3 149 GO:0016491
GO:0046872
GO:0051537
AF-H0SA27-F1-model_v4 (2Fe-2S)-binding domain protein 0.9849 1 150 GO:0016491
GO:0046872
GO:0051537
AF-B8II03-F1-model_v4 (2Fe-2S)-binding domain protein 0.9846 3 149 GO:0016491
GO:0046872
GO:0051537

Map