F379105

General Info

Members Datasets Scaffolds Average Seq Length
273 114 546 188

Family's Representative Sequence

Representative Sequence 3300028654|Ga0265322_10027873|Ga0265322_100278731
Length 191
Sequence MASIINSQIPEFSVQAFHDGKFKTVSNADLKGKWSVFFFYPADFTFVCPTELGDMADKYDKLKGMGVEVYSVSTDTHYVHKAWHDASDTIKKIKFPMLADPTGALSRAFGVYIEDGKDGGLAYRGSFVVNPEGKIKLAEIHDNGIGRNAEELVRKVQAAQFVATHDGEVCPAKWTPGAATLKPGLDLVGKI

Samples

Sample ID Description Type Environment
1 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
2 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
10 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
11 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
12 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
13 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
14 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
15 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
16 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
17 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
18 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
19 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
20 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
21 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
22 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
23 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
24 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
25 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
26 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
27 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
28 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
29 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
30 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
31 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
32 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
33 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
34 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
35 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
36 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
37 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
44 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
45 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
46 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
47 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
48 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
49 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
50 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
51 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
52 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
53 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
54 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
55 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
63 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
64 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
65 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
66 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
67 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
68 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
69 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
70 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
71 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
72 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
73 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
84 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
89 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
93 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
94 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
95 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
96 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
105 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
106 2643221660 Methylibium sp. Root1272 Isolate Unclassified
107 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
108 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
109 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
110 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
111 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
112 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
113 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
114 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 56.41
Metatranscriptomes 40.29
Isolates 3.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.83
Nodule 1.1
Rhizoplane 2.56
Rhizosphere 89.74
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265322_10027873 3300028654 Bacteria 1614
2 Ga0007416J51690_1020378 3300003577 Bacteria 1025
3 Ga0007429J51699_1011626 3300003579 Bacteria 1330
4 Ga0032354_1005578 3300003693 Bacteria 797
5 Ga0058860_12205729 3300004801 Bacteria 659
6 Ga0065704_10072568 3300005289 Bacteria 8317
7 Ga0070677_10521052 3300005333 Bacteria 647
8 Ga0068856_100003494 3300005614 Bacteria 15867
9 Ga0075430_100446017 3300006846 Bacteria 1068
10 Ga0207702_10032293 3300026078 Bacteria 4369
11 Ga0268265_10227452 3300028380 Bacteria 1637
12 Ga0265337_1013295 3300028556 Bacteria 2767
13 Ga0265326_10040569 3300028558 Bacteria 1322
14 Ga0265326_10093729 3300028558 Bacteria 851
15 Ga0265334_10029623 3300028573 Bacteria 2194
16 Ga0265318_10012043 3300028577 Bacteria 3696
17 Ga0265318_10074075 3300028577 Bacteria 1261
18 Ga0265318_10102440 3300028577 Bacteria 1053
19 Ga0265318_10102812 3300028577 Bacteria 1051
20 Ga0265323_10013214 3300028653 Bacteria 3297
21 Ga0265338_10024161 3300028800 Bacteria 6219
22 Ga0265338_10033220 3300028800 Bacteria 5012
23 Ga0265338_10062335 3300028800 Bacteria 3259
24 Ga0265338_10122619 3300028800 Bacteria 2068
25 Ga0311001_1008130 3300029277 Bacteria 711
26 Ga0265324_10000159 3300029957 Bacteria 52051
27 Ga0265324_10000321 3300029957 Bacteria 35228
28 Ga0265324_10020581 3300029957 Bacteria 2369
29 Ga0265330_10003410 3300031235 Bacteria 8318
30 Ga0265330_10003478 3300031235 Bacteria 8215
31 Ga0265330_10010956 3300031235 Bacteria 4259
32 Ga0265330_10069855 3300031235 Bacteria 1520
33 Ga0265332_10022804 3300031238 Bacteria 2762
34 Ga0265332_10111181 3300031238 Bacteria 1154
35 Ga0265328_10041563 3300031239 Bacteria 1693
36 Ga0265325_10020335 3300031241 Bacteria 3660
37 Ga0265325_10055342 3300031241 Bacteria 2029
38 Ga0265325_10127521 3300031241 Bacteria 1221
39 Ga0265329_10000205 3300031242 Bacteria 30796
40 Ga0265340_10000326 3300031247 Bacteria 25222
41 Ga0265340_10038970 3300031247 Bacteria 2348
42 Ga0265339_10000009 3300031249 Bacteria 221449
43 Ga0265339_10000036 3300031249 Bacteria 124408
44 Ga0265339_10007574 3300031249 Bacteria 6996
45 Ga0265331_10006925 3300031250 Bacteria 6620
46 Ga0265331_10162264 3300031250 Bacteria 1013
47 Ga0265327_10012762 3300031251 Bacteria 5640
48 Ga0265327_10103044 3300031251 Bacteria 1374
49 Ga0265316_10000042 3300031344 Bacteria 134990
50 Ga0265316_10000941 3300031344 Bacteria 31718
51 Ga0265316_10005703 3300031344 Bacteria 12036
52 Ga0265316_10013393 3300031344 Bacteria 7291
53 Ga0265316_10129592 3300031344 Bacteria 1901
54 Ga0265316_10571314 3300031344 Bacteria 803
55 Ga0265313_10008161 3300031595 Bacteria 6998
56 Ga0265313_10040099 3300031595 Bacteria 2317
57 Ga0265314_10000080 3300031711 Bacteria 144008
58 Ga0265314_10006613 3300031711 Bacteria 10201
59 Ga0265314_10021193 3300031711 Bacteria 5004
60 Ga0265314_10056062 3300031711 Bacteria 2715
61 Ga0265314_10056915 3300031711 Bacteria 2689
62 Ga0265342_10000373 3300031712 Bacteria 49369
63 Ga0265342_10001570 3300031712 Bacteria 21102
64 Ga0265342_10006838 3300031712 Bacteria 8427
65 Ga0265342_10092448 3300031712 Bacteria 1733
66 Ga0265342_10114893 3300031712 Bacteria 1520
67 Ga0316576_10078488 3300031727 Bacteria 2446
68 Ga0316578_10189495 3300031728 Bacteria 1239
69 Ga0316577_10270970 3300031733 Bacteria 960
70 Ga0316580_10007314 3300032139 Bacteria 3285
71 Ga0316593_10011071 3300032168 Bacteria 2611
72 Ga0316593_10011920 3300032168 Bacteria 2540
73 Ga0316593_10014303 3300032168 Bacteria 2364
74 Ga0316593_10014541 3300032168 Bacteria 2349
75 Ga0316593_10014621 3300032168 Bacteria 2345
76 Ga0316593_10018720 3300032168 Bacteria 2132
77 Ga0316593_10019472 3300032168 Bacteria 2098
78 Ga0316593_10043759 3300032168 Bacteria 1496
79 Ga0316593_10068578 3300032168 Bacteria 1223
80 Ga0316593_10101295 3300032168 Bacteria 1022
81 Ga0316593_10107604 3300032168 Bacteria 994
82 Ga0316593_10124996 3300032168 Bacteria 925
83 Ga0316593_10175868 3300032168 Bacteria 786
84 Ga0316593_10192047 3300032168 Bacteria 753
85 Ga0316592_1004863 3300033524 Bacteria 2523
86 Ga0316592_1005059 3300033524 Bacteria 2485
87 Ga0316592_1006128 3300033524 Bacteria 2305
88 Ga0316592_1009553 3300033524 Bacteria 1942
89 Ga0316592_1012558 3300033524 Bacteria 1738
90 Ga0316592_1017600 3300033524 Bacteria 1501
91 Ga0316592_1018740 3300033524 Bacteria 1460
92 Ga0316592_1019858 3300033524 Bacteria 1424
93 Ga0316592_1024112 3300033524 Bacteria 1308
94 Ga0316592_1038623 3300033524 Bacteria 1053
95 Ga0316592_1038890 3300033524 Bacteria 1050
96 Ga0316592_1040894 3300033524 Bacteria 1026
97 Ga0316592_1044930 3300033524 Bacteria 982
98 Ga0316592_1045941 3300033524 Bacteria 972
99 Ga0316592_1046614 3300033524 Bacteria 965
100 Ga0316592_1052928 3300033524 Bacteria 908
101 Ga0316592_1058965 3300033524 Bacteria 861
102 Ga0316592_1060883 3300033524 Bacteria 848
103 Ga0316592_1061394 3300033524 Bacteria 844
104 Ga0316592_1062720 3300033524 Bacteria 835
105 Ga0316592_1074033 3300033524 Bacteria 772
106 Ga0316592_1085372 3300033524 Bacteria 720
107 Ga0316592_1091377 3300033524 Bacteria 696
108 Ga0316592_1106616 3300033524 Bacteria 646
109 Ga0316586_1016997 3300033527 Bacteria 1171
110 Ga0316586_1065609 3300033527 Bacteria 664
111 Ga0316586_1068725 3300033527 Bacteria 651
112 Ga0316588_1005983 3300033528 Bacteria 2408
113 Ga0316588_1006560 3300033528 Bacteria 2330
114 Ga0316588_1012287 3300033528 Bacteria 1844
115 Ga0316588_1016349 3300033528 Bacteria 1644
116 Ga0316588_1017274 3300033528 Bacteria 1607
117 Ga0316588_1026423 3300033528 Bacteria 1345
118 Ga0316588_1030791 3300033528 Bacteria 1258
119 Ga0316588_1031211 3300033528 Bacteria 1250
120 Ga0316588_1032905 3300033528 Bacteria 1221
121 Ga0316588_1043503 3300033528 Bacteria 1078
122 Ga0316588_1046742 3300033528 Bacteria 1044
123 Ga0316588_1052379 3300033528 Bacteria 991
124 Ga0316588_1055373 3300033528 Bacteria 964
125 Ga0316588_1070467 3300033528 Bacteria 858
126 Ga0316588_1071160 3300033528 Bacteria 855
127 Ga0316588_1089827 3300033528 Bacteria 765
128 Ga0316588_1090045 3300033528 Bacteria 764
129 Ga0316588_1096827 3300033528 Bacteria 737
130 Ga0316588_1112120 3300033528 Bacteria 687
131 Ga0316587_1009075 3300033529 Bacteria 1574
132 Ga0316587_1017899 3300033529 Bacteria 1191
133 Ga0316587_1022023 3300033529 Bacteria 1090
134 Ga0316587_1022778 3300033529 Bacteria 1075
135 Ga0316587_1026286 3300033529 Bacteria 1014
136 Ga0316587_1030587 3300033529 Viruses 950
137 Ga0316587_1036711 3300033529 Unclassified 878
138 Ga0316587_1039634 3300033529 Bacteria 849
139 Ga0316587_1040393 3300033529 Bacteria 842
140 Ga0316587_1040584 3300033529 Bacteria 840
141 Ga0316587_1060080 3300033529 Bacteria 703
142 Ga0316587_1071175 3300033529 Bacteria 651
143 Ga0316596_1005685 3300033541 Bacteria 2861
144 Ga0316596_1008993 3300033541 Bacteria 2392
145 Ga0316596_1009821 3300033541 Bacteria 2302
146 Ga0316596_1011729 3300033541 Bacteria 2147
147 Ga0316596_1023879 3300033541 Bacteria 1568
148 Ga0316596_1025381 3300033541 Bacteria 1525
149 Ga0316596_1035791 3300033541 Bacteria 1297
150 Ga0316596_1056887 3300033541 Bacteria 1040
151 Ga0316596_1057311 3300033541 Bacteria 1037
152 Ga0316596_1057581 3300033541 Bacteria 1034
153 Ga0316596_1066754 3300033541 Bacteria 962
154 Ga0316596_1072325 3300033541 Bacteria 924
155 Ga0316596_1076876 3300033541 Bacteria 896
156 Ga0316596_1087265 3300033541 Bacteria 840
157 Ga0316596_1088317 3300033541 Bacteria 835
158 Ga0316596_1089241 3300033541 Bacteria 830
159 Ga0316596_1090140 3300033541 Bacteria 826
160 Ga0316596_1108272 3300033541 Bacteria 754
161 Ga0316596_1117890 3300033541 Bacteria 722
162 Ga0316596_1135907 3300033541 Bacteria 672
163 Ga0316596_1146006 3300033541 Bacteria 649
164 Ga0316596_1150738 3300033541 Bacteria 639
165 Ga0316596_1151425 3300033541 Bacteria 637
166 Ga0316596_1167240 3300033541 Bacteria 606
167 Ga0373959_0099143 3300034820 Bacteria 691
168 Ga0373936_0075577 3300035113 Bacteria 1395
169 Ga0316574_0260806 3300035398 Bacteria 1106
170 Ga0316582_0126578 3300036647 Bacteria 1713
171 Ga0316584_0177914 3300036712 Bacteria 1575
172 Ga0395905_0002527 3300037471 Bacteria 20180
173 Ga0395905_0011230 3300037471 Bacteria 8658
174 Ga0395905_0013329 3300037471 Bacteria 7881
175 Ga0400483_262801 3300039062 Bacteria 4473
176 Ga0400489_34598 3300039093 Bacteria 1444
177 Ga0451795_0341083 3300041456 Bacteria 1096
178 Ga0451795_0432291 3300041456 Bacteria 1116
179 Ga0451795_1584836 3300041456 Bacteria 1484
180 Ga0451795_1589920 3300041456 Bacteria 930
181 Ga0451835_0481963 3300041492 Bacteria 1117
182 Ga0451837_1511800 3300041494 Bacteria 841
183 Ga0451841_0494923 3300041498 Bacteria 622
184 Ga0451852_04788 3300041508 Bacteria 977
185 Ga0451577_0007680 3300042876 Bacteria 10579
186 Ga0451577_0021396 3300042876 Bacteria 5920
187 Ga0451577_0040156 3300042876 Bacteria 4202
188 Ga0451577_0131792 3300042876 Bacteria 2243
189 Ga0451577_0181824 3300042876 Bacteria 1896
190 Ga0451577_0373417 3300042876 Bacteria 1294
191 Ga0453683_0069318 3300044673 Bacteria 2205
192 Ga0453683_0526780 3300044673 Bacteria 768
193 Ga0453684_0012201 3300044712 Bacteria 14241
194 Ga0453684_0048092 3300044712 Bacteria 5646
195 Ga0453684_0065487 3300044712 Bacteria 4634
196 Ga0453684_0106263 3300044712 Bacteria 3421
197 Ga0453684_0189250 3300044712 Unclassified 2409
198 Ga0453684_0266654 3300044712 Bacteria 1959
199 Ga0453684_0542464 3300044712 Bacteria 1282
200 Ga0453684_0645535 3300044712 Bacteria 1155
201 Ga0453684_0860643 3300044712 Bacteria 973
202 Ga0453684_0926832 3300044712 Bacteria 931
203 Ga0466970_0005341 3300044765 Bacteria 6373
204 Ga0466957_0748983 3300044842 Bacteria 692
205 Ga0466960_0193567 3300044901 Bacteria 1108
206 Ga0451576_0000529 3300045051 Bacteria 82682
207 Ga0451576_0000635 3300045051 Bacteria 73052
208 Ga0451576_0004408 3300045051 Bacteria 18317
209 Ga0451576_0116912 3300045051 Bacteria 2776
210 Ga0451576_0135902 3300045051 Bacteria 2564
211 Ga0451576_0385477 3300045051 Bacteria 1469
212 Ga0451576_0742098 3300045051 Bacteria 1031
213 Ga0451576_0755273 3300045051 Bacteria 1021
214 Ga0451576_1308125 3300045051 Bacteria 756
215 Ga0495597_0002118 3300046542 Bacteria 13141
216 Ga0495656_0065347 3300046615 Bacteria 1599
217 Ga0495659_0011883 3300046664 Bacteria 2808
218 Ga0495599_0038445 3300046678 Bacteria 3006
219 Ga0495636_0017066 3300047318 Bacteria 2905
220 Ga0495602_0204355 3300048088 Bacteria 1504
221 Ga0496110_0011809 3300048913 Bacteria 7169
222 Ga0496112_0021396 3300048915 Bacteria 6151
223 Ga0496113_0165462 3300048916 Bacteria 1750
224 Ga0496116_0025927 3300048919 Bacteria 4298
225 Ga0501306_071575 3300049127 Bacteria 586
226 Ga0501343_010341 3300049132 Bacteria 760
227 Ga0501032_0098806 3300049569 Bacteria 1934
228 Ga0501034_0002060 3300049571 Bacteria 25143
229 Ga0501034_0032391 3300049571 Bacteria 5308
230 Ga0501034_0247062 3300049571 Bacteria 1729
231 Ga0501034_0608280 3300049571 Bacteria 998
232 Ga0501034_0977293 3300049571 Bacteria 731
233 Ga0501036_0063701 3300049572 Bacteria 3121
234 Ga0501038_0020342 3300049574 Bacteria 5968
235 Ga0501038_0067897 3300049574 Bacteria 3032
236 Ga0501039_0164251 3300049575 Bacteria 1746
237 Ga0501039_0734670 3300049575 Bacteria 771
238 Ga0501043_0234664 3300049579 Bacteria 1416
239 Ga0501046_0000169 3300049580 Bacteria 66470
240 Ga0501047_0002163 3300049581 Bacteria 18800
241 Ga0501068_0000041 3300049584 Bacteria 48045
242 Ga0501069_0091395 3300049585 Bacteria 1721
243 Ga0501072_0000001 3300049588 Bacteria 362697
244 Ga0501074_0000548 3300049590 Bacteria 23143
245 Ga0501076_0012637 3300049592 Bacteria 6318
246 Ga0501077_0012735 3300049593 Bacteria 5268
247 Ga0501079_0021262 3300049741 Bacteria 4962
248 Ga0501080_0014144 3300049742 Bacteria 7344
249 Ga0501044_0019040 3300049823 Bacteria 7349
250 Ga0500643_001183 3300053087 Bacteria 15578
251 Ga0500646_0002753 3300053090 Bacteria 4535
252 Ga0500650_0000015 3300053098 Bacteria 71164
253 Ga0500655_002196 3300053133 Bacteria 3592
254 Ga0500604_0000878 3300053151 Bacteria 8311
255 Ga0501084_0001639 3300054114 Bacteria 17778
256 Ga0587084_023289 3300059477 Bacteria 944
257 Ga0587073_0147634 3300059492 Bacteria 662
258 Ga0587128_039298 3300059630 Bacteria 820
259 Ga0587068_049048 3300059641 Bacteria 785
260 Ga0587107_039619 3300059652 Bacteria 756
261 Ga0587111_0071924 3300060346 Bacteria 809
262 Ga0501082_0228234 3300060353 Bacteria 1621
263 Ga0501082_0328474 3300060353 Bacteria 1332
264 Ga0530510_0009709 3300061734 Bacteria 6752
265 2644337505 2643221660 Bacteria 4208257
266 2746085691 2744054900 Bacteria 8399525
267 2746092725 2744054901 Bacteria 8397047
268 2842332698 2842324504 Bacteria 9364110
269 2842355855 2842348783 Bacteria 9002918
270 2842461085 2842454564 Bacteria 8730687
271 2900640775 2900634093 Bacteria 10263517
272 2916179078 2916178963 Bacteria 5265078
273 2919499358 2919497567 Bacteria 4408621
274 Ga0265322_10027873
275 Ga0007416J51690_1020378
276 Ga0007429J51699_1011626
277 Ga0032354_1005578
278 Ga0058860_12205729
279 Ga0065704_10072568
280 Ga0070677_10521052
281 Ga0068856_100003494
282 Ga0075430_100446017
283 Ga0207702_10032293
284 Ga0268265_10227452
285 Ga0265337_1013295
286 Ga0265326_10040569
287 Ga0265326_10093729
288 Ga0265334_10029623
289 Ga0265318_10012043
290 Ga0265318_10074075
291 Ga0265318_10102440
292 Ga0265318_10102812
293 Ga0265323_10013214
294 Ga0265338_10024161
295 Ga0265338_10033220
296 Ga0265338_10062335
297 Ga0265338_10122619
298 Ga0311001_1008130
299 Ga0265324_10000159
300 Ga0265324_10000321
301 Ga0265324_10020581
302 Ga0265330_10003410
303 Ga0265330_10003478
304 Ga0265330_10010956
305 Ga0265330_10069855
306 Ga0265332_10022804
307 Ga0265332_10111181
308 Ga0265328_10041563
309 Ga0265325_10020335
310 Ga0265325_10055342
311 Ga0265325_10127521
312 Ga0265329_10000205
313 Ga0265340_10000326
314 Ga0265340_10038970
315 Ga0265339_10000009
316 Ga0265339_10000036
317 Ga0265339_10007574
318 Ga0265331_10006925
319 Ga0265331_10162264
320 Ga0265327_10012762
321 Ga0265327_10103044
322 Ga0265316_10000042
323 Ga0265316_10000941
324 Ga0265316_10005703
325 Ga0265316_10013393
326 Ga0265316_10129592
327 Ga0265316_10571314
328 Ga0265313_10008161
329 Ga0265313_10040099
330 Ga0265314_10000080
331 Ga0265314_10006613
332 Ga0265314_10021193
333 Ga0265314_10056062
334 Ga0265314_10056915
335 Ga0265342_10000373
336 Ga0265342_10001570
337 Ga0265342_10006838
338 Ga0265342_10092448
339 Ga0265342_10114893
340 Ga0316576_10078488
341 Ga0316578_10189495
342 Ga0316577_10270970
343 Ga0316580_10007314
344 Ga0316593_10011071
345 Ga0316593_10011920
346 Ga0316593_10014303
347 Ga0316593_10014541
348 Ga0316593_10014621
349 Ga0316593_10018720
350 Ga0316593_10019472
351 Ga0316593_10043759
352 Ga0316593_10068578
353 Ga0316593_10101295
354 Ga0316593_10107604
355 Ga0316593_10124996
356 Ga0316593_10175868
357 Ga0316593_10192047
358 Ga0316592_1004863
359 Ga0316592_1005059
360 Ga0316592_1006128
361 Ga0316592_1009553
362 Ga0316592_1012558
363 Ga0316592_1017600
364 Ga0316592_1018740
365 Ga0316592_1019858
366 Ga0316592_1024112
367 Ga0316592_1038623
368 Ga0316592_1038890
369 Ga0316592_1040894
370 Ga0316592_1044930
371 Ga0316592_1045941
372 Ga0316592_1046614
373 Ga0316592_1052928
374 Ga0316592_1058965
375 Ga0316592_1060883
376 Ga0316592_1061394
377 Ga0316592_1062720
378 Ga0316592_1074033
379 Ga0316592_1085372
380 Ga0316592_1091377
381 Ga0316592_1106616
382 Ga0316586_1016997
383 Ga0316586_1065609
384 Ga0316586_1068725
385 Ga0316588_1005983
386 Ga0316588_1006560
387 Ga0316588_1012287
388 Ga0316588_1016349
389 Ga0316588_1017274
390 Ga0316588_1026423
391 Ga0316588_1030791
392 Ga0316588_1031211
393 Ga0316588_1032905
394 Ga0316588_1043503
395 Ga0316588_1046742
396 Ga0316588_1052379
397 Ga0316588_1055373
398 Ga0316588_1070467
399 Ga0316588_1071160
400 Ga0316588_1089827
401 Ga0316588_1090045
402 Ga0316588_1096827
403 Ga0316588_1112120
404 Ga0316587_1009075
405 Ga0316587_1017899
406 Ga0316587_1022023
407 Ga0316587_1022778
408 Ga0316587_1026286
409 Ga0316587_1030587
410 Ga0316587_1036711
411 Ga0316587_1039634
412 Ga0316587_1040393
413 Ga0316587_1040584
414 Ga0316587_1060080
415 Ga0316587_1071175
416 Ga0316596_1005685
417 Ga0316596_1008993
418 Ga0316596_1009821
419 Ga0316596_1011729
420 Ga0316596_1023879
421 Ga0316596_1025381
422 Ga0316596_1035791
423 Ga0316596_1056887
424 Ga0316596_1057311
425 Ga0316596_1057581
426 Ga0316596_1066754
427 Ga0316596_1072325
428 Ga0316596_1076876
429 Ga0316596_1087265
430 Ga0316596_1088317
431 Ga0316596_1089241
432 Ga0316596_1090140
433 Ga0316596_1108272
434 Ga0316596_1117890
435 Ga0316596_1135907
436 Ga0316596_1146006
437 Ga0316596_1150738
438 Ga0316596_1151425
439 Ga0316596_1167240
440 Ga0373959_0099143
441 Ga0373936_0075577
442 Ga0316574_0260806
443 Ga0316582_0126578
444 Ga0316584_0177914
445 Ga0395905_0002527
446 Ga0395905_0011230
447 Ga0395905_0013329
448 Ga0400483_262801
449 Ga0400489_34598
450 Ga0451795_0341083
451 Ga0451795_0432291
452 Ga0451795_1584836
453 Ga0451795_1589920
454 Ga0451835_0481963
455 Ga0451837_1511800
456 Ga0451841_0494923
457 Ga0451852_04788
458 Ga0451577_0007680
459 Ga0451577_0021396
460 Ga0451577_0040156
461 Ga0451577_0131792
462 Ga0451577_0181824
463 Ga0451577_0373417
464 Ga0453683_0069318
465 Ga0453683_0526780
466 Ga0453684_0012201
467 Ga0453684_0048092
468 Ga0453684_0065487
469 Ga0453684_0106263
470 Ga0453684_0189250
471 Ga0453684_0266654
472 Ga0453684_0542464
473 Ga0453684_0645535
474 Ga0453684_0860643
475 Ga0453684_0926832
476 Ga0466970_0005341
477 Ga0466957_0748983
478 Ga0466960_0193567
479 Ga0451576_0000529
480 Ga0451576_0000635
481 Ga0451576_0004408
482 Ga0451576_0116912
483 Ga0451576_0135902
484 Ga0451576_0385477
485 Ga0451576_0742098
486 Ga0451576_0755273
487 Ga0451576_1308125
488 Ga0495597_0002118
489 Ga0495656_0065347
490 Ga0495659_0011883
491 Ga0495599_0038445
492 Ga0495636_0017066
493 Ga0495602_0204355
494 Ga0496110_0011809
495 Ga0496112_0021396
496 Ga0496113_0165462
497 Ga0496116_0025927
498 Ga0501306_071575
499 Ga0501343_010341
500 Ga0501032_0098806
501 Ga0501034_0002060
502 Ga0501034_0032391
503 Ga0501034_0247062
504 Ga0501034_0608280
505 Ga0501034_0977293
506 Ga0501036_0063701
507 Ga0501038_0020342
508 Ga0501038_0067897
509 Ga0501039_0164251
510 Ga0501039_0734670
511 Ga0501043_0234664
512 Ga0501046_0000169
513 Ga0501047_0002163
514 Ga0501068_0000041
515 Ga0501069_0091395
516 Ga0501072_0000001
517 Ga0501074_0000548
518 Ga0501076_0012637
519 Ga0501077_0012735
520 Ga0501079_0021262
521 Ga0501080_0014144
522 Ga0501044_0019040
523 Ga0500643_001183
524 Ga0500646_0002753
525 Ga0500650_0000015
526 Ga0500655_002196
527 Ga0500604_0000878
528 Ga0501084_0001639
529 Ga0587084_023289
530 Ga0587073_0147634
531 Ga0587128_039298
532 Ga0587068_049048
533 Ga0587107_039619
534 Ga0587111_0071924
535 Ga0501082_0228234
536 Ga0501082_0328474
537 Ga0530510_0009709
538 2644337505
539 2746085691
540 2746092725
541 2842332698
542 2842355855
543 2842461085
544 2900640775
545 2916179078
546 2919499358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

5

138

0.98

PF10417

1-cysPrx_C

C-terminal domain of 1-Cys peroxiredoxin

158

188

0.9

PF08534

Redoxin

Redoxin

5

154

0.87

PF02630

SCO1-SenC

SCO1/SenC

12

79

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3emp-assembly1.cif.gz_D-2 crystal structure of the s-acetanilide modified form of c165s ahpc 0.9901 3 164
4xts-assembly2.cif.gz_T salmonella typhimurium ahpc t43a mutant 0.9885 3 162
4xs1-assembly1.cif.gz_D-2 salmonella typhimurium ahpc t43v mutant 0.9855 3 167
3emp-assembly1.cif.gz_D-2 crystal structure of the s-acetanilide modified form of c165s ahpc 0.984 3 164
4ql7-assembly1.cif.gz_D-2 crystal structure of c-terminus truncated alkylhydroperoxide reductase subunit c (ahpc1-172) from e. coli 0.9825 2 166
ID Description Score Start End Superfamily
5b8aJ00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9581 2 171 3.40.30.10
5b8aJ00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9525 2 171 3.40.30.10
2c0dA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9306 5 168 3.40.30.10
5dvbA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9301 1 182 3.40.30.10
5ijtA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9298 5 158 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7H4LXI5-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9913 48 172 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A5C7TLR2-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) (Thioredoxin peroxidase) 0.9889 2 159 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
GO:0102039
AF-A0A3B1B9A0-F1-model_v4 Alkyl hydroperoxide reductase protein C (EC 1.11.1.15) 0.9849 31 157 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A6I1J208-F1-model_v4 deleted 0.9844 16 164
AF-A0A1H6CQD9-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) (Thioredoxin peroxidase) 0.9823 5 164 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
GO:0102039

Map