F379053
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 178 | 256 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300020082|Ga0206353_11040240|Ga0206353_110402401 |
| Length | 199 |
| Sequence | VLSNLGVVERRQKMSGQDRRQQVLAIAAEEFADSGLRGASTEVIARRAEITQAYIFRMFGTKKSLFLEVVIAAFDRVTDGMRAAAGARTGLAALTRMGAQYNQMLAERTSLLLQLQGFAACGDPEIRAAVRDSFGRMWQTVADTTGLDPVTIKAFLAFGMLLNNSAALHVAELDSPWAEGVRTRIQAGLFQHITTETNQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 2 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 3 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 4 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 5 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 6 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 7 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 8 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 9 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 10 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 11 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 12 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 13 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 14 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 15 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 116 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 118 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 119 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 120 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 126 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 127 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 130 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 131 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 132 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 133 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 136 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 137 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 153 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 154 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 155 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 157 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 158 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 159 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.48 |
| Metatranscriptomes | 3.3 |
| Isolates | 6.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 87.18 |
| Stem | 0 |
| Stem Tuber | 0.37 |
| Unclassified | 9.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10015126 | 3300001979 | Bacteria | 2824 |
| 2 | JGI24740J21852_10049702 | 3300001979 | Unclassified | 1210 |
| 3 | JGI24739J22299_10082731 | 3300001989 | Bacteria | 984 |
| 4 | JGI24737J22298_10055855 | 3300001990 | Unclassified | 1193 |
| 5 | JGI24735J21928_10014729 | 3300002067 | Bacteria | 2447 |
| 6 | JGI25404J52841_10039761 | 3300003659 | Bacteria | 996 |
| 7 | Ga0070658_10017491 | 3300005327 | Bacteria | 5736 |
| 8 | Ga0070658_10209420 | 3300005327 | Bacteria | 1647 |
| 9 | Ga0070683_100192793 | 3300005329 | Unclassified | 1935 |
| 10 | Ga0070683_100239727 | 3300005329 | Bacteria | 1725 |
| 11 | Ga0070683_100404785 | 3300005329 | Bacteria | 1301 |
| 12 | Ga0070670_100825490 | 3300005331 | Bacteria | 838 |
| 13 | Ga0070666_10019903 | 3300005335 | Bacteria | 4335 |
| 14 | Ga0070680_100117136 | 3300005336 | Unclassified | 2221 |
| 15 | Ga0070682_100752865 | 3300005337 | Bacteria | 787 |
| 16 | Ga0070660_100035098 | 3300005339 | Bacteria | 3794 |
| 17 | Ga0070668_100684132 | 3300005347 | Unclassified | 903 |
| 18 | Ga0070671_100005313 | 3300005355 | Bacteria | 10276 |
| 19 | Ga0070659_100158914 | 3300005366 | Bacteria | 1847 |
| 20 | Ga0070667_100021598 | 3300005367 | Bacteria | 5343 |
| 21 | Ga0070709_10561950 | 3300005434 | Bacteria | 874 |
| 22 | Ga0070714_100150694 | 3300005435 | Bacteria | 2096 |
| 23 | Ga0070714_100220768 | 3300005435 | Bacteria | 1742 |
| 24 | Ga0070714_100565995 | 3300005435 | Bacteria | 1089 |
| 25 | Ga0070713_100182130 | 3300005436 | Bacteria | 1888 |
| 26 | Ga0070713_100287526 | 3300005436 | Bacteria | 1510 |
| 27 | Ga0070713_100333582 | 3300005436 | Bacteria | 1403 |
| 28 | Ga0070713_101049968 | 3300005436 | Unclassified | 787 |
| 29 | Ga0070710_10764888 | 3300005437 | Bacteria | 687 |
| 30 | Ga0070711_100169657 | 3300005439 | Bacteria | 1662 |
| 31 | Ga0070711_100818354 | 3300005439 | Bacteria | 791 |
| 32 | Ga0070705_100411307 | 3300005440 | Bacteria | 1004 |
| 33 | Ga0070681_10020036 | 3300005458 | Bacteria | 6701 |
| 34 | Ga0070681_10047859 | 3300005458 | Bacteria | 4274 |
| 35 | Ga0070681_10374620 | 3300005458 | Bacteria | 1334 |
| 36 | Ga0070681_10621907 | 3300005458 | Bacteria | 994 |
| 37 | Ga0070681_10668643 | 3300005458 | Unclassified | 954 |
| 38 | Ga0070679_100061242 | 3300005530 | Unclassified | 3751 |
| 39 | Ga0070679_100076960 | 3300005530 | Bacteria | 3325 |
| 40 | Ga0070679_100096629 | 3300005530 | Bacteria | 2942 |
| 41 | Ga0070679_100493925 | 3300005530 | Bacteria | 1168 |
| 42 | Ga0070684_100321042 | 3300005535 | Bacteria | 1422 |
| 43 | Ga0070684_100568325 | 3300005535 | Bacteria | 1053 |
| 44 | Ga0070684_100707595 | 3300005535 | Unclassified | 939 |
| 45 | Ga0070686_100231012 | 3300005544 | Bacteria | 1342 |
| 46 | Ga0070665_100001472 | 3300005548 | Bacteria | 27593 |
| 47 | Ga0070665_100095930 | 3300005548 | Bacteria | 2971 |
| 48 | Ga0070665_100268088 | 3300005548 | Unclassified | 1709 |
| 49 | Ga0068855_100060461 | 3300005563 | Bacteria | 4431 |
| 50 | Ga0068855_100232447 | 3300005563 | Bacteria | 2064 |
| 51 | Ga0068855_100786340 | 3300005563 | Unclassified | 1012 |
| 52 | Ga0068857_100069801 | 3300005577 | Unclassified | 3129 |
| 53 | Ga0068857_100349944 | 3300005577 | Bacteria | 1368 |
| 54 | Ga0068857_100771886 | 3300005577 | Bacteria | 916 |
| 55 | Ga0068857_100827311 | 3300005577 | Bacteria | 885 |
| 56 | Ga0068854_100318263 | 3300005578 | Bacteria | 1264 |
| 57 | Ga0068856_100256795 | 3300005614 | Bacteria | 1763 |
| 58 | Ga0068852_100004427 | 3300005616 | Bacteria | 9927 |
| 59 | Ga0068852_100164424 | 3300005616 | Bacteria | 2075 |
| 60 | Ga0068859_100022352 | 3300005617 | Bacteria | 6341 |
| 61 | Ga0068859_101076991 | 3300005617 | Bacteria | 884 |
| 62 | Ga0068861_100396747 | 3300005719 | Bacteria | 1223 |
| 63 | Ga0068861_100417489 | 3300005719 | Unclassified | 1195 |
| 64 | Ga0068863_100003231 | 3300005841 | Bacteria | 16136 |
| 65 | Ga0068863_100457996 | 3300005841 | Bacteria | 1252 |
| 66 | Ga0068858_100041699 | 3300005842 | Bacteria | 4255 |
| 67 | Ga0068860_100000054 | 3300005843 | Bacteria | 206114 |
| 68 | Ga0068860_100816867 | 3300005843 | Bacteria | 946 |
| 69 | Ga0081455_10016797 | 3300005937 | Bacteria | 7042 |
| 70 | Ga0081455_10017198 | 3300005937 | Bacteria | 6942 |
| 71 | Ga0081455_10070412 | 3300005937 | Bacteria | 2904 |
| 72 | Ga0081455_10231867 | 3300005937 | Bacteria | 1362 |
| 73 | Ga0081540_1004906 | 3300005983 | Bacteria | 10074 |
| 74 | Ga0070717_10273740 | 3300006028 | Bacteria | 1496 |
| 75 | Ga0070717_10380275 | 3300006028 | Bacteria | 1266 |
| 76 | Ga0070717_10700435 | 3300006028 | Bacteria | 920 |
| 77 | Ga0075365_10221026 | 3300006038 | Bacteria | 1329 |
| 78 | Ga0070716_100492232 | 3300006173 | Bacteria | 903 |
| 79 | Ga0070712_100308932 | 3300006175 | Bacteria | 1282 |
| 80 | Ga0097620_100022350 | 3300006931 | Bacteria | 6341 |
| 81 | Ga0097620_101076712 | 3300006931 | Bacteria | 884 |
| 82 | Ga0105240_10294488 | 3300009093 | Bacteria | 1859 |
| 83 | Ga0111539_12531585 | 3300009094 | Bacteria | 595 |
| 84 | Ga0105247_10020713 | 3300009101 | Bacteria | 3953 |
| 85 | Ga0105243_10185413 | 3300009148 | Bacteria | 1813 |
| 86 | Ga0105241_10011240 | 3300009174 | Bacteria | 6563 |
| 87 | Ga0105237_10062915 | 3300009545 | Bacteria | 3710 |
| 88 | Ga0105237_10309971 | 3300009545 | Bacteria | 1581 |
| 89 | Ga0105249_10108155 | 3300009553 | Bacteria | 2625 |
| 90 | Ga0157371_10153317 | 3300013102 | Bacteria | 1644 |
| 91 | Ga0157370_10046651 | 3300013104 | Bacteria | 4154 |
| 92 | Ga0157369_10026724 | 3300013105 | Bacteria | 6402 |
| 93 | Ga0157369_10038040 | 3300013105 | Bacteria | 5263 |
| 94 | Ga0157369_10113127 | 3300013105 | Bacteria | 2884 |
| 95 | Ga0157369_10169301 | 3300013105 | Bacteria | 2302 |
| 96 | Ga0157369_10513412 | 3300013105 | Bacteria | 1240 |
| 97 | Ga0157374_10390238 | 3300013296 | Bacteria | 1387 |
| 98 | Ga0163162_11841541 | 3300013306 | Unclassified | 692 |
| 99 | Ga0163163_10354708 | 3300014325 | Bacteria | 1523 |
| 100 | Ga0206354_10302703 | 3300020081 | Bacteria | 1480 |
| 101 | Ga0206354_11086801 | 3300020081 | Bacteria | 2025 |
| 102 | Ga0206353_10103952 | 3300020082 | Bacteria | 2254 |
| 103 | Ga0206353_11040240 | 3300020082 | Unclassified | 1103 |
| 104 | Ga0206353_11376558 | 3300020082 | Bacteria | 953 |
| 105 | Ga0206353_11482142 | 3300020082 | Bacteria | 1007 |
| 106 | Ga0213875_10002167 | 3300021388 | Bacteria | 11983 |
| 107 | Ga0213875_10002477 | 3300021388 | Bacteria | 11025 |
| 108 | Ga0224712_10030717 | 3300022467 | Bacteria | 1942 |
| 109 | Ga0207710_10010251 | 3300025900 | Bacteria | 3942 |
| 110 | Ga0207647_10002199 | 3300025904 | Bacteria | 14870 |
| 111 | Ga0207647_10005798 | 3300025904 | Bacteria | 9006 |
| 112 | Ga0207647_10042360 | 3300025904 | Bacteria | 2857 |
| 113 | Ga0207647_10050909 | 3300025904 | Bacteria | 2562 |
| 114 | Ga0207647_10082709 | 3300025904 | Unclassified | 1923 |
| 115 | Ga0207647_10149996 | 3300025904 | Bacteria | 1363 |
| 116 | Ga0207699_10628496 | 3300025906 | Bacteria | 783 |
| 117 | Ga0207705_10015461 | 3300025909 | Bacteria | 5476 |
| 118 | Ga0207707_10007089 | 3300025912 | Bacteria | 9769 |
| 119 | Ga0207707_10052715 | 3300025912 | Bacteria | 3540 |
| 120 | Ga0207707_10193294 | 3300025912 | Unclassified | 1775 |
| 121 | Ga0207707_10322299 | 3300025912 | Bacteria | 1334 |
| 122 | Ga0207695_10008767 | 3300025913 | Bacteria | 12612 |
| 123 | Ga0207671_10000654 | 3300025914 | Bacteria | 45328 |
| 124 | Ga0207671_10155365 | 3300025914 | Bacteria | 1769 |
| 125 | Ga0207693_10283547 | 3300025915 | Bacteria | 1298 |
| 126 | Ga0207693_10314890 | 3300025915 | Bacteria | 1225 |
| 127 | Ga0207663_10090490 | 3300025916 | Bacteria | 2029 |
| 128 | Ga0207660_10776870 | 3300025917 | Unclassified | 782 |
| 129 | Ga0207657_10036081 | 3300025919 | Bacteria | 4428 |
| 130 | Ga0207652_10016115 | 3300025921 | Bacteria | 6096 |
| 131 | Ga0207652_10091601 | 3300025921 | Bacteria | 2673 |
| 132 | Ga0207652_10181406 | 3300025921 | Bacteria | 1892 |
| 133 | Ga0207652_10280393 | 3300025921 | Unclassified | 1503 |
| 134 | Ga0207694_10002696 | 3300025924 | Bacteria | 14361 |
| 135 | Ga0207650_10805157 | 3300025925 | Bacteria | 796 |
| 136 | Ga0207700_10235115 | 3300025928 | Bacteria | 1560 |
| 137 | Ga0207700_10237603 | 3300025928 | Bacteria | 1552 |
| 138 | Ga0207700_10450883 | 3300025928 | Bacteria | 1134 |
| 139 | Ga0207664_10125797 | 3300025929 | Bacteria | 2152 |
| 140 | Ga0207664_10132948 | 3300025929 | Bacteria | 2096 |
| 141 | Ga0207664_10487501 | 3300025929 | Bacteria | 1103 |
| 142 | Ga0207644_10012619 | 3300025931 | Bacteria | 5615 |
| 143 | Ga0207709_10378194 | 3300025935 | Bacteria | 1077 |
| 144 | Ga0207665_10214238 | 3300025939 | Bacteria | 1409 |
| 145 | Ga0207661_10254088 | 3300025944 | Bacteria | 1563 |
| 146 | Ga0207661_10472903 | 3300025944 | Unclassified | 1143 |
| 147 | Ga0207667_10097259 | 3300025949 | Bacteria | 3039 |
| 148 | Ga0207667_10255351 | 3300025949 | Bacteria | 1793 |
| 149 | Ga0207668_10614065 | 3300025972 | Unclassified | 948 |
| 150 | Ga0207640_10172863 | 3300025981 | Bacteria | 1612 |
| 151 | Ga0207658_10013845 | 3300025986 | Bacteria | 5519 |
| 152 | Ga0207703_10020580 | 3300026035 | Bacteria | 5161 |
| 153 | Ga0207639_10065014 | 3300026041 | Bacteria | 2830 |
| 154 | Ga0207678_10035792 | 3300026067 | Bacteria | 4322 |
| 155 | Ga0207678_10058295 | 3300026067 | Bacteria | 3322 |
| 156 | Ga0207702_10532381 | 3300026078 | Bacteria | 1148 |
| 157 | Ga0207641_10005933 | 3300026088 | Bacteria | 10354 |
| 158 | Ga0207674_10195202 | 3300026116 | Bacteria | 1974 |
| 159 | Ga0207674_10241725 | 3300026116 | Unclassified | 1752 |
| 160 | Ga0207674_10266414 | 3300026116 | Bacteria | 1661 |
| 161 | Ga0207675_100395015 | 3300026118 | Bacteria | 1362 |
| 162 | Ga0207675_100533221 | 3300026118 | Unclassified | 1171 |
| 163 | Ga0207698_10032491 | 3300026142 | Bacteria | 3781 |
| 164 | Ga0268266_10012961 | 3300028379 | Bacteria | 7189 |
| 165 | Ga0268266_10100773 | 3300028379 | Bacteria | 2545 |
| 166 | Ga0268266_10114997 | 3300028379 | Bacteria | 2388 |
| 167 | Ga0268264_10000097 | 3300028381 | Bacteria | 229722 |
| 168 | Ga0268264_10685799 | 3300028381 | Bacteria | 1016 |
| 169 | Ga0265326_10072988 | 3300028558 | Bacteria | 970 |
| 170 | Ga0265336_10005483 | 3300028666 | Bacteria | 4676 |
| 171 | Ga0307515_10620632 | 3300028794 | Bacteria | 692 |
| 172 | Ga0265338_10024531 | 3300028800 | Bacteria | 6157 |
| 173 | Ga0307512_10009630 | 3300030522 | Bacteria | 9290 |
| 174 | Ga0265760_10011584 | 3300031090 | Bacteria | 2520 |
| 175 | Ga0307509_10112106 | 3300031507 | Bacteria | 2728 |
| 176 | Ga0307408_101364378 | 3300031548 | Bacteria | 666 |
| 177 | Ga0307413_10277596 | 3300031824 | Bacteria | 1258 |
| 178 | Ga0307518_10001375 | 3300031838 | Bacteria | 18082 |
| 179 | Ga0307406_10321806 | 3300031901 | Bacteria | 1197 |
| 180 | Ga0307407_10136876 | 3300031903 | Bacteria | 1575 |
| 181 | Ga0307412_10896889 | 3300031911 | Bacteria | 777 |
| 182 | Ga0307416_100256551 | 3300032002 | Bacteria | 1706 |
| 183 | Ga0307415_100158584 | 3300032126 | Bacteria | 1751 |
| 184 | Ga0307415_100216275 | 3300032126 | Bacteria | 1533 |
| 185 | Ga0307415_100227876 | 3300032126 | Bacteria | 1498 |
| 186 | Ga0316214_1000392 | 3300033545 | Bacteria | 4370 |
| 187 | Ga0310112_031574 | 3300036458 | Bacteria | 727 |
| 188 | Ga0373925_0000009 | 3300037068 | Bacteria | 243099 |
| 189 | Ga0373925_0000356 | 3300037068 | Bacteria | 47640 |
| 190 | Ga0395899_0766530 | 3300037312 | Bacteria | 599 |
| 191 | Ga0395900_0015956 | 3300037418 | Bacteria | 7653 |
| 192 | Ga0395898_0020094 | 3300037466 | Bacteria | 6786 |
| 193 | Ga0395905_0465820 | 3300037471 | Bacteria | 1162 |
| 194 | Ga0436364_0273664 | 3300037853 | Bacteria | 21979 |
| 195 | Ga0436364_0717404 | 3300037853 | Bacteria | 722 |
| 196 | Ga0436364_0923522 | 3300037853 | Bacteria | 137390 |
| 197 | Ga0395901_0152049 | 3300038443 | Bacteria | 2432 |
| 198 | Ga0395901_0504106 | 3300038443 | Bacteria | 1232 |
| 199 | Ga0466965_0375879 | 3300044683 | Bacteria | 782 |
| 200 | Ga0466961_0035316 | 3300044693 | Bacteria | 3211 |
| 201 | Ga0466963_0194309 | 3300044694 | Bacteria | 1418 |
| 202 | Ga0466971_0115204 | 3300044719 | Bacteria | 1242 |
| 203 | Ga0466960_0690787 | 3300044901 | Bacteria | 611 |
| 204 | Ga0466967_0003750 | 3300045976 | Bacteria | 10020 |
| 205 | Ga0466967_0008527 | 3300045976 | Bacteria | 7524 |
| 206 | Ga0466967_0084237 | 3300045976 | Bacteria | 2876 |
| 207 | Ga0466967_0109590 | 3300045976 | Bacteria | 2535 |
| 208 | Ga0466967_0133733 | 3300045976 | Bacteria | 2305 |
| 209 | Ga0466967_0314103 | 3300045976 | Bacteria | 1510 |
| 210 | Ga0466967_0934145 | 3300045976 | Bacteria | 863 |
| 211 | Ga0495592_0092999 | 3300046454 | Bacteria | 2160 |
| 212 | Ga0495651_0023786 | 3300046462 | Bacteria | 4763 |
| 213 | Ga0495664_0113118 | 3300046477 | Bacteria | 1639 |
| 214 | Ga0495652_0003763 | 3300046529 | Bacteria | 14836 |
| 215 | Ga0495586_0076463 | 3300046535 | Bacteria | 1834 |
| 216 | Ga0495645_0089696 | 3300046543 | Bacteria | 2198 |
| 217 | Ga0495645_0093151 | 3300046543 | Bacteria | 2151 |
| 218 | Ga0495634_0085523 | 3300046642 | Bacteria | 2055 |
| 219 | Ga0495635_0046223 | 3300046663 | Bacteria | 3003 |
| 220 | Ga0495623_0109253 | 3300046679 | Bacteria | 1677 |
| 221 | Ga0495646_0134819 | 3300046680 | Bacteria | 1386 |
| 222 | Ga0495600_0035858 | 3300046809 | Bacteria | 3223 |
| 223 | Ga0496102_0000683 | 3300048905 | Bacteria | 33959 |
| 224 | Ga0496102_0220860 | 3300048905 | Bacteria | 1786 |
| 225 | Ga0496103_0007865 | 3300048906 | Bacteria | 6341 |
| 226 | Ga0496103_0097795 | 3300048906 | Bacteria | 1856 |
| 227 | Ga0496109_0648812 | 3300048912 | Bacteria | 992 |
| 228 | Ga0496112_0889891 | 3300048915 | Bacteria | 813 |
| 229 | Ga0496115_0147356 | 3300048918 | Bacteria | 1943 |
| 230 | Ga0496117_0015854 | 3300048920 | Bacteria | 6392 |
| 231 | Ga0496119_0087876 | 3300048922 | Bacteria | 1773 |
| 232 | Ga0496124_0008176 | 3300048927 | Bacteria | 10976 |
| 233 | Ga0496126_0000007 | 3300048929 | Bacteria | 787364 |
| 234 | Ga0496126_0077101 | 3300048929 | Bacteria | 2956 |
| 235 | Ga0496126_0127370 | 3300048929 | Bacteria | 2203 |
| 236 | Ga0496126_0538268 | 3300048929 | Bacteria | 928 |
| 237 | Ga0501036_0456837 | 3300049572 | Bacteria | 1064 |
| 238 | Ga0501067_0095068 | 3300049583 | Bacteria | 1654 |
| 239 | Ga0501068_0009877 | 3300049584 | Bacteria | 5346 |
| 240 | Ga0501069_0106215 | 3300049585 | Bacteria | 1596 |
| 241 | Ga0501070_0120081 | 3300049586 | Bacteria | 2172 |
| 242 | Ga0501071_0052799 | 3300049587 | Bacteria | 2931 |
| 243 | Ga0501072_0016768 | 3300049588 | Bacteria | 5627 |
| 244 | Ga0501073_0015270 | 3300049589 | Bacteria | 5569 |
| 245 | Ga0501074_0000665 | 3300049590 | Bacteria | 21423 |
| 246 | Ga0501077_0186080 | 3300049593 | Bacteria | 1319 |
| 247 | Ga0501080_0021767 | 3300049742 | Bacteria | 5938 |
| 248 | Ga0501083_0024431 | 3300049744 | Bacteria | 4186 |
| 249 | Ga0501035_0941277 | 3300049822 | Bacteria | 682 |
| 250 | Ga0501044_0263083 | 3300049823 | Bacteria | 1663 |
| 251 | Ga0495601_0009780 | 3300053077 | Bacteria | 5672 |
| 252 | Ga0495601_0018728 | 3300053077 | Bacteria | 4214 |
| 253 | Ga0495612_0001934 | 3300053078 | Bacteria | 8530 |
| 254 | Ga0495619_0142483 | 3300053085 | Bacteria | 1651 |
| 255 | Ga0501084_0024753 | 3300054114 | Bacteria | 5009 |
| 256 | Ga0501084_0654447 | 3300054114 | Unclassified | 887 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_12531585 | Ga0111539_125315851 | 162 |
| 2 | 3300005329 | Ga0070683_100239727 | Ga0070683_1002397272 | 176 |
| 3 | 3300020081 | Ga0206354_10302703 | Ga0206354_103027032 | 176 |
| 4 | 3300025904 | Ga0207647_10042360 | Ga0207647_100423602 | 176 |
| 5 | 3300025912 | Ga0207707_10322299 | Ga0207707_103222992 | 176 |
| 6 | 3300025921 | Ga0207652_10181406 | Ga0207652_101814062 | 176 |
| 7 | 3300025949 | Ga0207667_10097259 | Ga0207667_100972592 | 176 |
| 8 | 3300037853 | Ga0436364_0273664 | Ga0436364_0273664_20031_20561 | 176 |
| 9 | 3300044683 | Ga0466965_0375879 | Ga0466965_0375879_228_758 | 176 |
| 10 | 3300045976 | Ga0466967_0934145 | Ga0466967_0934145_22_555 | 177 |
| 11 | iso_pu_bacteria | 2643221632 | 2644182648 | 180 |
| 12 | 3300044693 | Ga0466961_0035316 | Ga0466961_0035316_256_945 | 182 |
| 13 | iso_pu_bacteria | 2585427649 | 2586064620 | 182 |
| 14 | iso_pu_bacteria | 2808606522 | 2809592263 | 182 |
| 15 | iso_pu_bacteria | 2904765812 | 2904769435 | 182 |
| 16 | iso_pu_bacteria | 2919420072 | 2919422643 | 182 |
| 17 | iso_pu_bacteria | 2919432681 | 2919435104 | 182 |
| 18 | 3300049572 | Ga0501036_0456837 | Ga0501036_0456837_122_679 | 185 |
| 19 | 3300049583 | Ga0501067_0095068 | Ga0501067_0095068_437_994 | 185 |
| 20 | 3300049584 | Ga0501068_0009877 | Ga0501068_0009877_2716_3273 | 185 |
| 21 | 3300049585 | Ga0501069_0106215 | Ga0501069_0106215_866_1423 | 185 |
| 22 | 3300049586 | Ga0501070_0120081 | Ga0501070_0120081_895_1452 | 185 |
| 23 | 3300049587 | Ga0501071_0052799 | Ga0501071_0052799_1622_2179 | 185 |
| 24 | 3300049588 | Ga0501072_0016768 | Ga0501072_0016768_4355_4912 | 185 |
| 25 | 3300049589 | Ga0501073_0015270 | Ga0501073_0015270_3002_3559 | 185 |
| 26 | 3300049590 | Ga0501074_0000665 | Ga0501074_0000665_4400_4957 | 185 |
| 27 | 3300049593 | Ga0501077_0186080 | Ga0501077_0186080_249_806 | 185 |
| 28 | 3300049742 | Ga0501080_0021767 | Ga0501080_0021767_1718_2275 | 185 |
| 29 | 3300049744 | Ga0501083_0024431 | Ga0501083_0024431_1649_2206 | 185 |
| 30 | 3300049822 | Ga0501035_0941277 | Ga0501035_0941277_112_669 | 185 |
| 31 | 3300049823 | Ga0501044_0263083 | Ga0501044_0263083_1039_1596 | 185 |
| 32 | 3300054114 | Ga0501084_0024753 | Ga0501084_0024753_1811_2368 | 185 |
| 33 | 3300001979 | JGI24740J21852_10049702 | JGI24740J21852_100497022 | 186 |
| 34 | 3300001990 | JGI24737J22298_10055855 | JGI24737J22298_100558552 | 186 |
| 35 | 3300002067 | JGI24735J21928_10014729 | JGI24735J21928_100147292 | 186 |
| 36 | 3300003659 | JGI25404J52841_10039761 | JGI25404J52841_100397612 | 186 |
| 37 | 3300005327 | Ga0070658_10209420 | Ga0070658_102094202 | 186 |
| 38 | 3300005329 | Ga0070683_100192793 | Ga0070683_1001927932 | 186 |
| 39 | 3300005336 | Ga0070680_100117136 | Ga0070680_1001171362 | 186 |
| 40 | 3300005339 | Ga0070660_100035098 | Ga0070660_1000350984 | 186 |
| 41 | 3300005355 | Ga0070671_100005313 | Ga0070671_1000053131 | 186 |
| 42 | 3300005367 | Ga0070667_100021598 | Ga0070667_1000215982 | 186 |
| 43 | 3300005435 | Ga0070714_100220768 | Ga0070714_1002207682 | 186 |
| 44 | 3300005435 | Ga0070714_100565995 | Ga0070714_1005659952 | 186 |
| 45 | 3300005437 | Ga0070710_10764888 | Ga0070710_107648881 | 186 |
| 46 | 3300005440 | Ga0070705_100411307 | Ga0070705_1004113071 | 186 |
| 47 | 3300005458 | Ga0070681_10020036 | Ga0070681_100200367 | 186 |
| 48 | 3300005458 | Ga0070681_10668643 | Ga0070681_106686431 | 186 |
| 49 | 3300005530 | Ga0070679_100076960 | Ga0070679_1000769601 | 186 |
| 50 | 3300005530 | Ga0070679_100096629 | Ga0070679_1000966293 | 186 |
| 51 | 3300005548 | Ga0070665_100268088 | Ga0070665_1002680882 | 186 |
| 52 | 3300005563 | Ga0068855_100060461 | Ga0068855_1000604614 | 186 |
| 53 | 3300005563 | Ga0068855_100786340 | Ga0068855_1007863401 | 186 |
| 54 | 3300005577 | Ga0068857_100069801 | Ga0068857_1000698013 | 186 |
| 55 | 3300005577 | Ga0068857_100827311 | Ga0068857_1008273112 | 186 |
| 56 | 3300005578 | Ga0068854_100318263 | Ga0068854_1003182632 | 186 |
| 57 | 3300005616 | Ga0068852_100004427 | Ga0068852_1000044275 | 186 |
| 58 | 3300005617 | Ga0068859_100022352 | Ga0068859_1000223526 | 186 |
| 59 | 3300005719 | Ga0068861_100396747 | Ga0068861_1003967471 | 186 |
| 60 | 3300005843 | Ga0068860_100000054 | Ga0068860_1000000541 | 186 |
| 61 | 3300005937 | Ga0081455_10016797 | Ga0081455_100167973 | 186 |
| 62 | 3300005937 | Ga0081455_10231867 | Ga0081455_102318673 | 186 |
| 63 | 3300005983 | Ga0081540_1004906 | Ga0081540_100490610 | 186 |
| 64 | 3300006028 | Ga0070717_10273740 | Ga0070717_102737402 | 186 |
| 65 | 3300006028 | Ga0070717_10380275 | Ga0070717_103802752 | 186 |
| 66 | 3300006175 | Ga0070712_100308932 | Ga0070712_1003089323 | 186 |
| 67 | 3300006931 | Ga0097620_100022350 | Ga0097620_1000223503 | 186 |
| 68 | 3300009101 | Ga0105247_10020713 | Ga0105247_100207132 | 186 |
| 69 | 3300009174 | Ga0105241_10011240 | Ga0105241_100112402 | 186 |
| 70 | 3300009545 | Ga0105237_10309971 | Ga0105237_103099712 | 186 |
| 71 | 3300013296 | Ga0157374_10390238 | Ga0157374_103902382 | 186 |
| 72 | 3300014325 | Ga0163163_10354708 | Ga0163163_103547082 | 186 |
| 73 | 3300021388 | Ga0213875_10002477 | Ga0213875_100024772 | 186 |
| 74 | 3300025900 | Ga0207710_10010251 | Ga0207710_100102513 | 186 |
| 75 | 3300025904 | Ga0207647_10005798 | Ga0207647_1000579810 | 186 |
| 76 | 3300025904 | Ga0207647_10050909 | Ga0207647_100509092 | 186 |
| 77 | 3300025904 | Ga0207647_10082709 | Ga0207647_100827092 | 186 |
| 78 | 3300025912 | Ga0207707_10052715 | Ga0207707_100527153 | 186 |
| 79 | 3300025913 | Ga0207695_10008767 | Ga0207695_1000876711 | 186 |
| 80 | 3300025914 | Ga0207671_10000654 | Ga0207671_1000065415 | 186 |
| 81 | 3300025914 | Ga0207671_10155365 | Ga0207671_101553652 | 186 |
| 82 | 3300025915 | Ga0207693_10283547 | Ga0207693_102835473 | 186 |
| 83 | 3300025915 | Ga0207693_10314890 | Ga0207693_103148902 | 186 |
| 84 | 3300025917 | Ga0207660_10776870 | Ga0207660_107768701 | 186 |
| 85 | 3300025919 | Ga0207657_10036081 | Ga0207657_100360815 | 186 |
| 86 | 3300025921 | Ga0207652_10280393 | Ga0207652_102803931 | 186 |
| 87 | 3300025924 | Ga0207694_10002696 | Ga0207694_1000269612 | 186 |
| 88 | 3300025928 | Ga0207700_10237603 | Ga0207700_102376032 | 186 |
| 89 | 3300025928 | Ga0207700_10450883 | Ga0207700_104508831 | 186 |
| 90 | 3300025929 | Ga0207664_10125797 | Ga0207664_101257974 | 186 |
| 91 | 3300025929 | Ga0207664_10487501 | Ga0207664_104875012 | 186 |
| 92 | 3300025939 | Ga0207665_10214238 | Ga0207665_102142381 | 186 |
| 93 | 3300025944 | Ga0207661_10472903 | Ga0207661_104729031 | 186 |
| 94 | 3300025949 | Ga0207667_10255351 | Ga0207667_102553511 | 186 |
| 95 | 3300025972 | Ga0207668_10614065 | Ga0207668_106140652 | 186 |
| 96 | 3300025981 | Ga0207640_10172863 | Ga0207640_101728632 | 186 |
| 97 | 3300026041 | Ga0207639_10065014 | Ga0207639_100650141 | 186 |
| 98 | 3300026067 | Ga0207678_10058295 | Ga0207678_100582953 | 186 |
| 99 | 3300026116 | Ga0207674_10241725 | Ga0207674_102417252 | 186 |
| 100 | 3300026118 | Ga0207675_100395015 | Ga0207675_1003950151 | 186 |
| 101 | 3300026142 | Ga0207698_10032491 | Ga0207698_100324914 | 186 |
| 102 | 3300028379 | Ga0268266_10100773 | Ga0268266_101007731 | 186 |
| 103 | 3300028381 | Ga0268264_10000097 | Ga0268264_10000097224 | 186 |
| 104 | 3300028558 | Ga0265326_10072988 | Ga0265326_100729881 | 186 |
| 105 | 3300028666 | Ga0265336_10005483 | Ga0265336_100054833 | 186 |
| 106 | 3300028800 | Ga0265338_10024531 | Ga0265338_100245313 | 186 |
| 107 | 3300030522 | Ga0307512_10009630 | Ga0307512_100096304 | 186 |
| 108 | 3300031090 | Ga0265760_10011584 | Ga0265760_100115842 | 186 |
| 109 | 3300031507 | Ga0307509_10112106 | Ga0307509_101121062 | 186 |
| 110 | 3300031548 | Ga0307408_101364378 | Ga0307408_1013643781 | 186 |
| 111 | 3300031824 | Ga0307413_10277596 | Ga0307413_102775962 | 186 |
| 112 | 3300031838 | Ga0307518_10001375 | Ga0307518_1000137516 | 186 |
| 113 | 3300031901 | Ga0307406_10321806 | Ga0307406_103218062 | 186 |
| 114 | 3300031903 | Ga0307407_10136876 | Ga0307407_101368762 | 186 |
| 115 | 3300031911 | Ga0307412_10896889 | Ga0307412_108968892 | 186 |
| 116 | 3300032126 | Ga0307415_100227876 | Ga0307415_1002278762 | 186 |
| 117 | 3300036458 | Ga0310112_031574 | Ga0310112_031574_69_629 | 186 |
| 118 | 3300037068 | Ga0373925_0000009 | Ga0373925_0000009_133867_134427 | 186 |
| 119 | 3300037312 | Ga0395899_0766530 | Ga0395899_0766530_13_573 | 186 |
| 120 | 3300037418 | Ga0395900_0015956 | Ga0395900_0015956_6849_7409 | 186 |
| 121 | 3300037466 | Ga0395898_0020094 | Ga0395898_0020094_93_653 | 186 |
| 122 | 3300037471 | Ga0395905_0465820 | Ga0395905_0465820_400_960 | 186 |
| 123 | 3300037853 | Ga0436364_0717404 | Ga0436364_0717404_113_673 | 186 |
| 124 | 3300038443 | Ga0395901_0152049 | Ga0395901_0152049_586_1146 | 186 |
| 125 | 3300038443 | Ga0395901_0504106 | Ga0395901_0504106_238_798 | 186 |
| 126 | 3300044901 | Ga0466960_0690787 | Ga0466960_0690787_19_579 | 186 |
| 127 | 3300045976 | Ga0466967_0003750 | Ga0466967_0003750_1930_2490 | 186 |
| 128 | 3300045976 | Ga0466967_0008527 | Ga0466967_0008527_1749_2309 | 186 |
| 129 | 3300045976 | Ga0466967_0133733 | Ga0466967_0133733_1540_2100 | 186 |
| 130 | 3300046462 | Ga0495651_0023786 | Ga0495651_0023786_43_603 | 186 |
| 131 | 3300046477 | Ga0495664_0113118 | Ga0495664_0113118_622_1182 | 186 |
| 132 | 3300046535 | Ga0495586_0076463 | Ga0495586_0076463_1196_1756 | 186 |
| 133 | 3300046642 | Ga0495634_0085523 | Ga0495634_0085523_1484_2044 | 186 |
| 134 | 3300046663 | Ga0495635_0046223 | Ga0495635_0046223_2147_2707 | 186 |
| 135 | 3300046809 | Ga0495600_0035858 | Ga0495600_0035858_1175_1735 | 186 |
| 136 | 3300048920 | Ga0496117_0015854 | Ga0496117_0015854_1604_2164 | 186 |
| 137 | 3300048927 | Ga0496124_0008176 | Ga0496124_0008176_2652_3212 | 186 |
| 138 | 3300048929 | Ga0496126_0000007 | Ga0496126_0000007_754015_754575 | 186 |
| 139 | 3300048929 | Ga0496126_0077101 | Ga0496126_0077101_801_1361 | 186 |
| 140 | 3300048929 | Ga0496126_0127370 | Ga0496126_0127370_1607_2167 | 186 |
| 141 | 3300053077 | Ga0495601_0018728 | Ga0495601_0018728_1089_1649 | 186 |
| 142 | 3300053078 | Ga0495612_0001934 | Ga0495612_0001934_1491_2051 | 186 |
| 143 | 3300053085 | Ga0495619_0142483 | Ga0495619_0142483_461_1021 | 186 |
| 144 | iso_pu_bacteria | 2558860112 | 2558906095 | 186 |
| 145 | iso_pu_bacteria | 2775506925 | 2776372641 | 186 |
| 146 | iso_pu_bacteria | 2775506925 | 2776373264 | 186 |
| 147 | iso_pu_bacteria | 2863067949 | 2863073941 | 186 |
| 148 | iso_pu_bacteria | 2863067949 | 2863074674 | 186 |
| 149 | iso_pu_bacteria | 2866552031 | 2866554643 | 186 |
| 150 | iso_pu_bacteria | 2899370129 | 2899371642 | 186 |
| 151 | iso_pu_bacteria | 2915768154 | 2915774077 | 186 |
| 152 | iso_pu_bacteria | 2870782633 | 2870783670 | 187 |
| 153 | 3300005458 | Ga0070681_10374620 | Ga0070681_103746202 | 188 |
| 154 | 3300005530 | Ga0070679_100493925 | Ga0070679_1004939252 | 188 |
| 155 | 3300005535 | Ga0070684_100568325 | Ga0070684_1005683252 | 188 |
| 156 | 3300005841 | Ga0068863_100457996 | Ga0068863_1004579961 | 188 |
| 157 | 3300006028 | Ga0070717_10700435 | Ga0070717_107004352 | 188 |
| 158 | 3300013105 | Ga0157369_10026724 | Ga0157369_100267248 | 188 |
| 159 | 3300020082 | Ga0206353_11482142 | Ga0206353_114821421 | 188 |
| 160 | 3300032002 | Ga0307416_100256551 | Ga0307416_1002565512 | 188 |
| 161 | 3300032126 | Ga0307415_100158584 | Ga0307415_1001585842 | 188 |
| 162 | 3300032126 | Ga0307415_100216275 | Ga0307415_1002162752 | 188 |
| 163 | 3300045976 | Ga0466967_0109590 | Ga0466967_0109590_1469_2038 | 188 |
| 164 | iso_pu_bacteria | 2904770941 | 2904772991 | 188 |
| 165 | iso_pu_bacteria | 2908811453 | 2908814184 | 188 |
| 166 | 3300044719 | Ga0466971_0115204 | Ga0466971_0115204_602_1183 | 189 |
| 167 | 3300005327 | Ga0070658_10017491 | Ga0070658_100174915 | 190 |
| 168 | 3300005329 | Ga0070683_100404785 | Ga0070683_1004047852 | 190 |
| 169 | 3300005331 | Ga0070670_100825490 | Ga0070670_1008254901 | 190 |
| 170 | 3300005335 | Ga0070666_10019903 | Ga0070666_100199032 | 190 |
| 171 | 3300005337 | Ga0070682_100752865 | Ga0070682_1007528651 | 190 |
| 172 | 3300005347 | Ga0070668_100684132 | Ga0070668_1006841322 | 190 |
| 173 | 3300005366 | Ga0070659_100158914 | Ga0070659_1001589142 | 190 |
| 174 | 3300005434 | Ga0070709_10561950 | Ga0070709_105619501 | 190 |
| 175 | 3300005435 | Ga0070714_100150694 | Ga0070714_1001506942 | 190 |
| 176 | 3300005436 | Ga0070713_100182130 | Ga0070713_1001821302 | 190 |
| 177 | 3300005436 | Ga0070713_100287526 | Ga0070713_1002875262 | 190 |
| 178 | 3300005436 | Ga0070713_100333582 | Ga0070713_1003335822 | 190 |
| 179 | 3300005436 | Ga0070713_101049968 | Ga0070713_1010499681 | 190 |
| 180 | 3300005439 | Ga0070711_100169657 | Ga0070711_1001696572 | 190 |
| 181 | 3300005439 | Ga0070711_100818354 | Ga0070711_1008183541 | 190 |
| 182 | 3300005458 | Ga0070681_10047859 | Ga0070681_100478592 | 190 |
| 183 | 3300005458 | Ga0070681_10621907 | Ga0070681_106219071 | 190 |
| 184 | 3300005530 | Ga0070679_100061242 | Ga0070679_1000612426 | 190 |
| 185 | 3300005535 | Ga0070684_100321042 | Ga0070684_1003210422 | 190 |
| 186 | 3300005535 | Ga0070684_100707595 | Ga0070684_1007075951 | 190 |
| 187 | 3300005544 | Ga0070686_100231012 | Ga0070686_1002310122 | 190 |
| 188 | 3300005548 | Ga0070665_100001472 | Ga0070665_1000014722 | 190 |
| 189 | 3300005548 | Ga0070665_100095930 | Ga0070665_1000959301 | 190 |
| 190 | 3300005577 | Ga0068857_100349944 | Ga0068857_1003499442 | 190 |
| 191 | 3300005577 | Ga0068857_100771886 | Ga0068857_1007718862 | 190 |
| 192 | 3300005614 | Ga0068856_100256795 | Ga0068856_1002567952 | 190 |
| 193 | 3300005616 | Ga0068852_100164424 | Ga0068852_1001644242 | 190 |
| 194 | 3300005719 | Ga0068861_100417489 | Ga0068861_1004174892 | 190 |
| 195 | 3300005841 | Ga0068863_100003231 | Ga0068863_1000032312 | 190 |
| 196 | 3300005842 | Ga0068858_100041699 | Ga0068858_1000416992 | 190 |
| 197 | 3300006038 | Ga0075365_10221026 | Ga0075365_102210262 | 190 |
| 198 | 3300006173 | Ga0070716_100492232 | Ga0070716_1004922322 | 190 |
| 199 | 3300009093 | Ga0105240_10294488 | Ga0105240_102944882 | 190 |
| 200 | 3300009148 | Ga0105243_10185413 | Ga0105243_101854131 | 190 |
| 201 | 3300009545 | Ga0105237_10062915 | Ga0105237_100629154 | 190 |
| 202 | 3300009553 | Ga0105249_10108155 | Ga0105249_101081554 | 190 |
| 203 | 3300013102 | Ga0157371_10153317 | Ga0157371_101533172 | 190 |
| 204 | 3300013104 | Ga0157370_10046651 | Ga0157370_100466512 | 190 |
| 205 | 3300013105 | Ga0157369_10038040 | Ga0157369_100380403 | 190 |
| 206 | 3300013105 | Ga0157369_10113127 | Ga0157369_101131271 | 190 |
| 207 | 3300013306 | Ga0163162_11841541 | Ga0163162_118415411 | 190 |
| 208 | 3300020081 | Ga0206354_11086801 | Ga0206354_110868012 | 190 |
| 209 | 3300020082 | Ga0206353_10103952 | Ga0206353_101039523 | 190 |
| 210 | 3300020082 | Ga0206353_11040240 | Ga0206353_110402401 | 190 |
| 211 | 3300020082 | Ga0206353_11376558 | Ga0206353_113765581 | 190 |
| 212 | 3300021388 | Ga0213875_10002167 | Ga0213875_100021677 | 190 |
| 213 | 3300022467 | Ga0224712_10030717 | Ga0224712_100307172 | 190 |
| 214 | 3300025904 | Ga0207647_10149996 | Ga0207647_101499962 | 190 |
| 215 | 3300025906 | Ga0207699_10628496 | Ga0207699_106284961 | 190 |
| 216 | 3300025909 | Ga0207705_10015461 | Ga0207705_100154612 | 190 |
| 217 | 3300025912 | Ga0207707_10007089 | Ga0207707_100070898 | 190 |
| 218 | 3300025912 | Ga0207707_10193294 | Ga0207707_101932942 | 190 |
| 219 | 3300025916 | Ga0207663_10090490 | Ga0207663_100904902 | 190 |
| 220 | 3300025921 | Ga0207652_10016115 | Ga0207652_100161157 | 190 |
| 221 | 3300025921 | Ga0207652_10091601 | Ga0207652_100916013 | 190 |
| 222 | 3300025925 | Ga0207650_10805157 | Ga0207650_108051572 | 190 |
| 223 | 3300025928 | Ga0207700_10235115 | Ga0207700_102351153 | 190 |
| 224 | 3300025929 | Ga0207664_10132948 | Ga0207664_101329482 | 190 |
| 225 | 3300025931 | Ga0207644_10012619 | Ga0207644_100126191 | 190 |
| 226 | 3300025935 | Ga0207709_10378194 | Ga0207709_103781942 | 190 |
| 227 | 3300025944 | Ga0207661_10254088 | Ga0207661_102540882 | 190 |
| 228 | 3300025986 | Ga0207658_10013845 | Ga0207658_100138452 | 190 |
| 229 | 3300026035 | Ga0207703_10020580 | Ga0207703_100205807 | 190 |
| 230 | 3300026067 | Ga0207678_10035792 | Ga0207678_100357923 | 190 |
| 231 | 3300026078 | Ga0207702_10532381 | Ga0207702_105323812 | 190 |
| 232 | 3300026088 | Ga0207641_10005933 | Ga0207641_100059332 | 190 |
| 233 | 3300026116 | Ga0207674_10195202 | Ga0207674_101952021 | 190 |
| 234 | 3300026116 | Ga0207674_10266414 | Ga0207674_102664142 | 190 |
| 235 | 3300026118 | Ga0207675_100533221 | Ga0207675_1005332211 | 190 |
| 236 | 3300028379 | Ga0268266_10012961 | Ga0268266_100129612 | 190 |
| 237 | 3300028379 | Ga0268266_10114997 | Ga0268266_101149974 | 190 |
| 238 | 3300028794 | Ga0307515_10620632 | Ga0307515_106206321 | 190 |
| 239 | 3300033545 | Ga0316214_1000392 | Ga0316214_10003924 | 190 |
| 240 | 3300037068 | Ga0373925_0000356 | Ga0373925_0000356_22076_22660 | 190 |
| 241 | 3300037853 | Ga0436364_0923522 | Ga0436364_0923522_15100_15672 | 190 |
| 242 | 3300044694 | Ga0466963_0194309 | Ga0466963_0194309_526_1119 | 190 |
| 243 | 3300045976 | Ga0466967_0084237 | Ga0466967_0084237_1172_1765 | 190 |
| 244 | 3300045976 | Ga0466967_0314103 | Ga0466967_0314103_748_1332 | 190 |
| 245 | 3300046454 | Ga0495592_0092999 | Ga0495592_0092999_1084_1668 | 190 |
| 246 | 3300046529 | Ga0495652_0003763 | Ga0495652_0003763_930_1514 | 190 |
| 247 | 3300046543 | Ga0495645_0089696 | Ga0495645_0089696_18_611 | 190 |
| 248 | 3300046543 | Ga0495645_0093151 | Ga0495645_0093151_1482_2066 | 190 |
| 249 | 3300046679 | Ga0495623_0109253 | Ga0495623_0109253_479_1063 | 190 |
| 250 | 3300046680 | Ga0495646_0134819 | Ga0495646_0134819_489_1073 | 190 |
| 251 | 3300048905 | Ga0496102_0220860 | Ga0496102_0220860_269_853 | 190 |
| 252 | 3300048906 | Ga0496103_0097795 | Ga0496103_0097795_1206_1790 | 190 |
| 253 | 3300048912 | Ga0496109_0648812 | Ga0496109_0648812_374_958 | 190 |
| 254 | 3300048915 | Ga0496112_0889891 | Ga0496112_0889891_208_792 | 190 |
| 255 | 3300048918 | Ga0496115_0147356 | Ga0496115_0147356_127_711 | 190 |
| 256 | 3300048922 | Ga0496119_0087876 | Ga0496119_0087876_476_1060 | 190 |
| 257 | 3300048929 | Ga0496126_0538268 | Ga0496126_0538268_127_711 | 190 |
| 258 | 3300053077 | Ga0495601_0009780 | Ga0495601_0009780_1613_2197 | 190 |
| 259 | 3300054114 | Ga0501084_0654447 | Ga0501084_0654447_70_660 | 190 |
| 260 | 3300001979 | JGI24740J21852_10015126 | JGI24740J21852_100151263 | 192 |
| 261 | 3300001989 | JGI24739J22299_10082731 | JGI24739J22299_100827311 | 192 |
| 262 | 3300005563 | Ga0068855_100232447 | Ga0068855_1002324472 | 192 |
| 263 | 3300005617 | Ga0068859_101076991 | Ga0068859_1010769912 | 192 |
| 264 | 3300005843 | Ga0068860_100816867 | Ga0068860_1008168671 | 192 |
| 265 | 3300005937 | Ga0081455_10017198 | Ga0081455_100171982 | 192 |
| 266 | 3300005937 | Ga0081455_10070412 | Ga0081455_100704123 | 192 |
| 267 | 3300006931 | Ga0097620_101076712 | Ga0097620_1010767122 | 192 |
| 268 | 3300013105 | Ga0157369_10169301 | Ga0157369_101693012 | 192 |
| 269 | 3300013105 | Ga0157369_10513412 | Ga0157369_105134122 | 192 |
| 270 | 3300025904 | Ga0207647_10002199 | Ga0207647_100021993 | 192 |
| 271 | 3300028381 | Ga0268264_10685799 | Ga0268264_106857992 | 192 |
| 272 | 3300048905 | Ga0496102_0000683 | Ga0496102_0000683_14912_15493 | 192 |
| 273 | 3300048906 | Ga0496103_0007865 | Ga0496103_0007865_2626_3207 | 192 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ui6-assembly1.cif.gz_B | crystal structure of gamma-butyrolactone receptor (arpa-like protein) | 0.8074 | 6 | 111 |
| 4x1e-assembly1.cif.gz_B | crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant | 0.7953 | 13 | 137 |
| 7amt-assembly1.cif.gz_A | structure of luxr with dna (activation) | 0.7917 | 3 | 157 |
| 5h58-assembly1.cif.gz_B | structural and dynamics studies of the tetr family protein, cprb from streptomyces coelicolor in complex with its biological operator sequence | 0.7847 | 8 | 110 |
| 3geu-assembly1.cif.gz_B | crystal structure of icar from staphylococcus aureus, a member of the tetracycline repressor protein family | 0.7811 | 6 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1pb6B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9581 | 6 | 59 | 1.10.10.60 |
| 4jykB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9528 | 10 | 59 | 1.10.10.60 |
| 4xk4A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.945 | 10 | 59 | 1.10.10.60 |
| 4x1eB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.944 | 13 | 59 | 1.10.10.60 |
| 3locA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9433 | 10 | 59 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5ZSW9-F1-model_v4 | AcrR family transcriptional regulator | 0.9629 | 1 | 107 |
GO:0000976
GO:0003700 |
| AF-T1A6S9-F1-model_v4 | TetR family transcriptional regulator | 0.9465 | 1 | 150 |
GO:0000976
GO:0003700 |
| AF-A0A7X5ZSW9-F1-model_v4 | AcrR family transcriptional regulator | 0.9456 | 1 | 107 |
GO:0000976
GO:0003700 |
| AF-D2NPL9-F1-model_v4 | Transcriptional regulator | 0.939 | 2 | 72 |
GO:0000976
GO:0003700 |
| AF-A0A7K2YLE7-F1-model_v4 | TetR family transcriptional regulator | 0.9048 | 1 | 162 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar