F379053

General Info

Members Datasets Scaffolds Average Seq Length
273 178 256 188

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_11040240|Ga0206353_110402401
Length 199
Sequence VLSNLGVVERRQKMSGQDRRQQVLAIAAEEFADSGLRGASTEVIARRAEITQAYIFRMFGTKKSLFLEVVIAAFDRVTDGMRAAAGARTGLAALTRMGAQYNQMLAERTSLLLQLQGFAACGDPEIRAAVRDSFGRMWQTVADTTGLDPVTIKAFLAFGMLLNNSAALHVAELDSPWAEGVRTRIQAGLFQHITTETNQ

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
3 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
4 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
5 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
6 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
7 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
8 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
9 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
10 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
11 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
12 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
13 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
14 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
15 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
127 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
176 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
177 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.48
Metatranscriptomes 3.3
Isolates 6.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 2.56
Rhizosphere 87.18
Stem 0
Stem Tuber 0.37
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10015126 3300001979 Bacteria 2824
2 JGI24740J21852_10049702 3300001979 Unclassified 1210
3 JGI24739J22299_10082731 3300001989 Bacteria 984
4 JGI24737J22298_10055855 3300001990 Unclassified 1193
5 JGI24735J21928_10014729 3300002067 Bacteria 2447
6 JGI25404J52841_10039761 3300003659 Bacteria 996
7 Ga0070658_10017491 3300005327 Bacteria 5736
8 Ga0070658_10209420 3300005327 Bacteria 1647
9 Ga0070683_100192793 3300005329 Unclassified 1935
10 Ga0070683_100239727 3300005329 Bacteria 1725
11 Ga0070683_100404785 3300005329 Bacteria 1301
12 Ga0070670_100825490 3300005331 Bacteria 838
13 Ga0070666_10019903 3300005335 Bacteria 4335
14 Ga0070680_100117136 3300005336 Unclassified 2221
15 Ga0070682_100752865 3300005337 Bacteria 787
16 Ga0070660_100035098 3300005339 Bacteria 3794
17 Ga0070668_100684132 3300005347 Unclassified 903
18 Ga0070671_100005313 3300005355 Bacteria 10276
19 Ga0070659_100158914 3300005366 Bacteria 1847
20 Ga0070667_100021598 3300005367 Bacteria 5343
21 Ga0070709_10561950 3300005434 Bacteria 874
22 Ga0070714_100150694 3300005435 Bacteria 2096
23 Ga0070714_100220768 3300005435 Bacteria 1742
24 Ga0070714_100565995 3300005435 Bacteria 1089
25 Ga0070713_100182130 3300005436 Bacteria 1888
26 Ga0070713_100287526 3300005436 Bacteria 1510
27 Ga0070713_100333582 3300005436 Bacteria 1403
28 Ga0070713_101049968 3300005436 Unclassified 787
29 Ga0070710_10764888 3300005437 Bacteria 687
30 Ga0070711_100169657 3300005439 Bacteria 1662
31 Ga0070711_100818354 3300005439 Bacteria 791
32 Ga0070705_100411307 3300005440 Bacteria 1004
33 Ga0070681_10020036 3300005458 Bacteria 6701
34 Ga0070681_10047859 3300005458 Bacteria 4274
35 Ga0070681_10374620 3300005458 Bacteria 1334
36 Ga0070681_10621907 3300005458 Bacteria 994
37 Ga0070681_10668643 3300005458 Unclassified 954
38 Ga0070679_100061242 3300005530 Unclassified 3751
39 Ga0070679_100076960 3300005530 Bacteria 3325
40 Ga0070679_100096629 3300005530 Bacteria 2942
41 Ga0070679_100493925 3300005530 Bacteria 1168
42 Ga0070684_100321042 3300005535 Bacteria 1422
43 Ga0070684_100568325 3300005535 Bacteria 1053
44 Ga0070684_100707595 3300005535 Unclassified 939
45 Ga0070686_100231012 3300005544 Bacteria 1342
46 Ga0070665_100001472 3300005548 Bacteria 27593
47 Ga0070665_100095930 3300005548 Bacteria 2971
48 Ga0070665_100268088 3300005548 Unclassified 1709
49 Ga0068855_100060461 3300005563 Bacteria 4431
50 Ga0068855_100232447 3300005563 Bacteria 2064
51 Ga0068855_100786340 3300005563 Unclassified 1012
52 Ga0068857_100069801 3300005577 Unclassified 3129
53 Ga0068857_100349944 3300005577 Bacteria 1368
54 Ga0068857_100771886 3300005577 Bacteria 916
55 Ga0068857_100827311 3300005577 Bacteria 885
56 Ga0068854_100318263 3300005578 Bacteria 1264
57 Ga0068856_100256795 3300005614 Bacteria 1763
58 Ga0068852_100004427 3300005616 Bacteria 9927
59 Ga0068852_100164424 3300005616 Bacteria 2075
60 Ga0068859_100022352 3300005617 Bacteria 6341
61 Ga0068859_101076991 3300005617 Bacteria 884
62 Ga0068861_100396747 3300005719 Bacteria 1223
63 Ga0068861_100417489 3300005719 Unclassified 1195
64 Ga0068863_100003231 3300005841 Bacteria 16136
65 Ga0068863_100457996 3300005841 Bacteria 1252
66 Ga0068858_100041699 3300005842 Bacteria 4255
67 Ga0068860_100000054 3300005843 Bacteria 206114
68 Ga0068860_100816867 3300005843 Bacteria 946
69 Ga0081455_10016797 3300005937 Bacteria 7042
70 Ga0081455_10017198 3300005937 Bacteria 6942
71 Ga0081455_10070412 3300005937 Bacteria 2904
72 Ga0081455_10231867 3300005937 Bacteria 1362
73 Ga0081540_1004906 3300005983 Bacteria 10074
74 Ga0070717_10273740 3300006028 Bacteria 1496
75 Ga0070717_10380275 3300006028 Bacteria 1266
76 Ga0070717_10700435 3300006028 Bacteria 920
77 Ga0075365_10221026 3300006038 Bacteria 1329
78 Ga0070716_100492232 3300006173 Bacteria 903
79 Ga0070712_100308932 3300006175 Bacteria 1282
80 Ga0097620_100022350 3300006931 Bacteria 6341
81 Ga0097620_101076712 3300006931 Bacteria 884
82 Ga0105240_10294488 3300009093 Bacteria 1859
83 Ga0111539_12531585 3300009094 Bacteria 595
84 Ga0105247_10020713 3300009101 Bacteria 3953
85 Ga0105243_10185413 3300009148 Bacteria 1813
86 Ga0105241_10011240 3300009174 Bacteria 6563
87 Ga0105237_10062915 3300009545 Bacteria 3710
88 Ga0105237_10309971 3300009545 Bacteria 1581
89 Ga0105249_10108155 3300009553 Bacteria 2625
90 Ga0157371_10153317 3300013102 Bacteria 1644
91 Ga0157370_10046651 3300013104 Bacteria 4154
92 Ga0157369_10026724 3300013105 Bacteria 6402
93 Ga0157369_10038040 3300013105 Bacteria 5263
94 Ga0157369_10113127 3300013105 Bacteria 2884
95 Ga0157369_10169301 3300013105 Bacteria 2302
96 Ga0157369_10513412 3300013105 Bacteria 1240
97 Ga0157374_10390238 3300013296 Bacteria 1387
98 Ga0163162_11841541 3300013306 Unclassified 692
99 Ga0163163_10354708 3300014325 Bacteria 1523
100 Ga0206354_10302703 3300020081 Bacteria 1480
101 Ga0206354_11086801 3300020081 Bacteria 2025
102 Ga0206353_10103952 3300020082 Bacteria 2254
103 Ga0206353_11040240 3300020082 Unclassified 1103
104 Ga0206353_11376558 3300020082 Bacteria 953
105 Ga0206353_11482142 3300020082 Bacteria 1007
106 Ga0213875_10002167 3300021388 Bacteria 11983
107 Ga0213875_10002477 3300021388 Bacteria 11025
108 Ga0224712_10030717 3300022467 Bacteria 1942
109 Ga0207710_10010251 3300025900 Bacteria 3942
110 Ga0207647_10002199 3300025904 Bacteria 14870
111 Ga0207647_10005798 3300025904 Bacteria 9006
112 Ga0207647_10042360 3300025904 Bacteria 2857
113 Ga0207647_10050909 3300025904 Bacteria 2562
114 Ga0207647_10082709 3300025904 Unclassified 1923
115 Ga0207647_10149996 3300025904 Bacteria 1363
116 Ga0207699_10628496 3300025906 Bacteria 783
117 Ga0207705_10015461 3300025909 Bacteria 5476
118 Ga0207707_10007089 3300025912 Bacteria 9769
119 Ga0207707_10052715 3300025912 Bacteria 3540
120 Ga0207707_10193294 3300025912 Unclassified 1775
121 Ga0207707_10322299 3300025912 Bacteria 1334
122 Ga0207695_10008767 3300025913 Bacteria 12612
123 Ga0207671_10000654 3300025914 Bacteria 45328
124 Ga0207671_10155365 3300025914 Bacteria 1769
125 Ga0207693_10283547 3300025915 Bacteria 1298
126 Ga0207693_10314890 3300025915 Bacteria 1225
127 Ga0207663_10090490 3300025916 Bacteria 2029
128 Ga0207660_10776870 3300025917 Unclassified 782
129 Ga0207657_10036081 3300025919 Bacteria 4428
130 Ga0207652_10016115 3300025921 Bacteria 6096
131 Ga0207652_10091601 3300025921 Bacteria 2673
132 Ga0207652_10181406 3300025921 Bacteria 1892
133 Ga0207652_10280393 3300025921 Unclassified 1503
134 Ga0207694_10002696 3300025924 Bacteria 14361
135 Ga0207650_10805157 3300025925 Bacteria 796
136 Ga0207700_10235115 3300025928 Bacteria 1560
137 Ga0207700_10237603 3300025928 Bacteria 1552
138 Ga0207700_10450883 3300025928 Bacteria 1134
139 Ga0207664_10125797 3300025929 Bacteria 2152
140 Ga0207664_10132948 3300025929 Bacteria 2096
141 Ga0207664_10487501 3300025929 Bacteria 1103
142 Ga0207644_10012619 3300025931 Bacteria 5615
143 Ga0207709_10378194 3300025935 Bacteria 1077
144 Ga0207665_10214238 3300025939 Bacteria 1409
145 Ga0207661_10254088 3300025944 Bacteria 1563
146 Ga0207661_10472903 3300025944 Unclassified 1143
147 Ga0207667_10097259 3300025949 Bacteria 3039
148 Ga0207667_10255351 3300025949 Bacteria 1793
149 Ga0207668_10614065 3300025972 Unclassified 948
150 Ga0207640_10172863 3300025981 Bacteria 1612
151 Ga0207658_10013845 3300025986 Bacteria 5519
152 Ga0207703_10020580 3300026035 Bacteria 5161
153 Ga0207639_10065014 3300026041 Bacteria 2830
154 Ga0207678_10035792 3300026067 Bacteria 4322
155 Ga0207678_10058295 3300026067 Bacteria 3322
156 Ga0207702_10532381 3300026078 Bacteria 1148
157 Ga0207641_10005933 3300026088 Bacteria 10354
158 Ga0207674_10195202 3300026116 Bacteria 1974
159 Ga0207674_10241725 3300026116 Unclassified 1752
160 Ga0207674_10266414 3300026116 Bacteria 1661
161 Ga0207675_100395015 3300026118 Bacteria 1362
162 Ga0207675_100533221 3300026118 Unclassified 1171
163 Ga0207698_10032491 3300026142 Bacteria 3781
164 Ga0268266_10012961 3300028379 Bacteria 7189
165 Ga0268266_10100773 3300028379 Bacteria 2545
166 Ga0268266_10114997 3300028379 Bacteria 2388
167 Ga0268264_10000097 3300028381 Bacteria 229722
168 Ga0268264_10685799 3300028381 Bacteria 1016
169 Ga0265326_10072988 3300028558 Bacteria 970
170 Ga0265336_10005483 3300028666 Bacteria 4676
171 Ga0307515_10620632 3300028794 Bacteria 692
172 Ga0265338_10024531 3300028800 Bacteria 6157
173 Ga0307512_10009630 3300030522 Bacteria 9290
174 Ga0265760_10011584 3300031090 Bacteria 2520
175 Ga0307509_10112106 3300031507 Bacteria 2728
176 Ga0307408_101364378 3300031548 Bacteria 666
177 Ga0307413_10277596 3300031824 Bacteria 1258
178 Ga0307518_10001375 3300031838 Bacteria 18082
179 Ga0307406_10321806 3300031901 Bacteria 1197
180 Ga0307407_10136876 3300031903 Bacteria 1575
181 Ga0307412_10896889 3300031911 Bacteria 777
182 Ga0307416_100256551 3300032002 Bacteria 1706
183 Ga0307415_100158584 3300032126 Bacteria 1751
184 Ga0307415_100216275 3300032126 Bacteria 1533
185 Ga0307415_100227876 3300032126 Bacteria 1498
186 Ga0316214_1000392 3300033545 Bacteria 4370
187 Ga0310112_031574 3300036458 Bacteria 727
188 Ga0373925_0000009 3300037068 Bacteria 243099
189 Ga0373925_0000356 3300037068 Bacteria 47640
190 Ga0395899_0766530 3300037312 Bacteria 599
191 Ga0395900_0015956 3300037418 Bacteria 7653
192 Ga0395898_0020094 3300037466 Bacteria 6786
193 Ga0395905_0465820 3300037471 Bacteria 1162
194 Ga0436364_0273664 3300037853 Bacteria 21979
195 Ga0436364_0717404 3300037853 Bacteria 722
196 Ga0436364_0923522 3300037853 Bacteria 137390
197 Ga0395901_0152049 3300038443 Bacteria 2432
198 Ga0395901_0504106 3300038443 Bacteria 1232
199 Ga0466965_0375879 3300044683 Bacteria 782
200 Ga0466961_0035316 3300044693 Bacteria 3211
201 Ga0466963_0194309 3300044694 Bacteria 1418
202 Ga0466971_0115204 3300044719 Bacteria 1242
203 Ga0466960_0690787 3300044901 Bacteria 611
204 Ga0466967_0003750 3300045976 Bacteria 10020
205 Ga0466967_0008527 3300045976 Bacteria 7524
206 Ga0466967_0084237 3300045976 Bacteria 2876
207 Ga0466967_0109590 3300045976 Bacteria 2535
208 Ga0466967_0133733 3300045976 Bacteria 2305
209 Ga0466967_0314103 3300045976 Bacteria 1510
210 Ga0466967_0934145 3300045976 Bacteria 863
211 Ga0495592_0092999 3300046454 Bacteria 2160
212 Ga0495651_0023786 3300046462 Bacteria 4763
213 Ga0495664_0113118 3300046477 Bacteria 1639
214 Ga0495652_0003763 3300046529 Bacteria 14836
215 Ga0495586_0076463 3300046535 Bacteria 1834
216 Ga0495645_0089696 3300046543 Bacteria 2198
217 Ga0495645_0093151 3300046543 Bacteria 2151
218 Ga0495634_0085523 3300046642 Bacteria 2055
219 Ga0495635_0046223 3300046663 Bacteria 3003
220 Ga0495623_0109253 3300046679 Bacteria 1677
221 Ga0495646_0134819 3300046680 Bacteria 1386
222 Ga0495600_0035858 3300046809 Bacteria 3223
223 Ga0496102_0000683 3300048905 Bacteria 33959
224 Ga0496102_0220860 3300048905 Bacteria 1786
225 Ga0496103_0007865 3300048906 Bacteria 6341
226 Ga0496103_0097795 3300048906 Bacteria 1856
227 Ga0496109_0648812 3300048912 Bacteria 992
228 Ga0496112_0889891 3300048915 Bacteria 813
229 Ga0496115_0147356 3300048918 Bacteria 1943
230 Ga0496117_0015854 3300048920 Bacteria 6392
231 Ga0496119_0087876 3300048922 Bacteria 1773
232 Ga0496124_0008176 3300048927 Bacteria 10976
233 Ga0496126_0000007 3300048929 Bacteria 787364
234 Ga0496126_0077101 3300048929 Bacteria 2956
235 Ga0496126_0127370 3300048929 Bacteria 2203
236 Ga0496126_0538268 3300048929 Bacteria 928
237 Ga0501036_0456837 3300049572 Bacteria 1064
238 Ga0501067_0095068 3300049583 Bacteria 1654
239 Ga0501068_0009877 3300049584 Bacteria 5346
240 Ga0501069_0106215 3300049585 Bacteria 1596
241 Ga0501070_0120081 3300049586 Bacteria 2172
242 Ga0501071_0052799 3300049587 Bacteria 2931
243 Ga0501072_0016768 3300049588 Bacteria 5627
244 Ga0501073_0015270 3300049589 Bacteria 5569
245 Ga0501074_0000665 3300049590 Bacteria 21423
246 Ga0501077_0186080 3300049593 Bacteria 1319
247 Ga0501080_0021767 3300049742 Bacteria 5938
248 Ga0501083_0024431 3300049744 Bacteria 4186
249 Ga0501035_0941277 3300049822 Bacteria 682
250 Ga0501044_0263083 3300049823 Bacteria 1663
251 Ga0495601_0009780 3300053077 Bacteria 5672
252 Ga0495601_0018728 3300053077 Bacteria 4214
253 Ga0495612_0001934 3300053078 Bacteria 8530
254 Ga0495619_0142483 3300053085 Bacteria 1651
255 Ga0501084_0024753 3300054114 Bacteria 5009
256 Ga0501084_0654447 3300054114 Unclassified 887

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_12531585 Ga0111539_125315851 162
2 3300005329 Ga0070683_100239727 Ga0070683_1002397272 176
3 3300020081 Ga0206354_10302703 Ga0206354_103027032 176
4 3300025904 Ga0207647_10042360 Ga0207647_100423602 176
5 3300025912 Ga0207707_10322299 Ga0207707_103222992 176
6 3300025921 Ga0207652_10181406 Ga0207652_101814062 176
7 3300025949 Ga0207667_10097259 Ga0207667_100972592 176
8 3300037853 Ga0436364_0273664 Ga0436364_0273664_20031_20561 176
9 3300044683 Ga0466965_0375879 Ga0466965_0375879_228_758 176
10 3300045976 Ga0466967_0934145 Ga0466967_0934145_22_555 177
11 iso_pu_bacteria 2643221632 2644182648 180
12 3300044693 Ga0466961_0035316 Ga0466961_0035316_256_945 182
13 iso_pu_bacteria 2585427649 2586064620 182
14 iso_pu_bacteria 2808606522 2809592263 182
15 iso_pu_bacteria 2904765812 2904769435 182
16 iso_pu_bacteria 2919420072 2919422643 182
17 iso_pu_bacteria 2919432681 2919435104 182
18 3300049572 Ga0501036_0456837 Ga0501036_0456837_122_679 185
19 3300049583 Ga0501067_0095068 Ga0501067_0095068_437_994 185
20 3300049584 Ga0501068_0009877 Ga0501068_0009877_2716_3273 185
21 3300049585 Ga0501069_0106215 Ga0501069_0106215_866_1423 185
22 3300049586 Ga0501070_0120081 Ga0501070_0120081_895_1452 185
23 3300049587 Ga0501071_0052799 Ga0501071_0052799_1622_2179 185
24 3300049588 Ga0501072_0016768 Ga0501072_0016768_4355_4912 185
25 3300049589 Ga0501073_0015270 Ga0501073_0015270_3002_3559 185
26 3300049590 Ga0501074_0000665 Ga0501074_0000665_4400_4957 185
27 3300049593 Ga0501077_0186080 Ga0501077_0186080_249_806 185
28 3300049742 Ga0501080_0021767 Ga0501080_0021767_1718_2275 185
29 3300049744 Ga0501083_0024431 Ga0501083_0024431_1649_2206 185
30 3300049822 Ga0501035_0941277 Ga0501035_0941277_112_669 185
31 3300049823 Ga0501044_0263083 Ga0501044_0263083_1039_1596 185
32 3300054114 Ga0501084_0024753 Ga0501084_0024753_1811_2368 185
33 3300001979 JGI24740J21852_10049702 JGI24740J21852_100497022 186
34 3300001990 JGI24737J22298_10055855 JGI24737J22298_100558552 186
35 3300002067 JGI24735J21928_10014729 JGI24735J21928_100147292 186
36 3300003659 JGI25404J52841_10039761 JGI25404J52841_100397612 186
37 3300005327 Ga0070658_10209420 Ga0070658_102094202 186
38 3300005329 Ga0070683_100192793 Ga0070683_1001927932 186
39 3300005336 Ga0070680_100117136 Ga0070680_1001171362 186
40 3300005339 Ga0070660_100035098 Ga0070660_1000350984 186
41 3300005355 Ga0070671_100005313 Ga0070671_1000053131 186
42 3300005367 Ga0070667_100021598 Ga0070667_1000215982 186
43 3300005435 Ga0070714_100220768 Ga0070714_1002207682 186
44 3300005435 Ga0070714_100565995 Ga0070714_1005659952 186
45 3300005437 Ga0070710_10764888 Ga0070710_107648881 186
46 3300005440 Ga0070705_100411307 Ga0070705_1004113071 186
47 3300005458 Ga0070681_10020036 Ga0070681_100200367 186
48 3300005458 Ga0070681_10668643 Ga0070681_106686431 186
49 3300005530 Ga0070679_100076960 Ga0070679_1000769601 186
50 3300005530 Ga0070679_100096629 Ga0070679_1000966293 186
51 3300005548 Ga0070665_100268088 Ga0070665_1002680882 186
52 3300005563 Ga0068855_100060461 Ga0068855_1000604614 186
53 3300005563 Ga0068855_100786340 Ga0068855_1007863401 186
54 3300005577 Ga0068857_100069801 Ga0068857_1000698013 186
55 3300005577 Ga0068857_100827311 Ga0068857_1008273112 186
56 3300005578 Ga0068854_100318263 Ga0068854_1003182632 186
57 3300005616 Ga0068852_100004427 Ga0068852_1000044275 186
58 3300005617 Ga0068859_100022352 Ga0068859_1000223526 186
59 3300005719 Ga0068861_100396747 Ga0068861_1003967471 186
60 3300005843 Ga0068860_100000054 Ga0068860_1000000541 186
61 3300005937 Ga0081455_10016797 Ga0081455_100167973 186
62 3300005937 Ga0081455_10231867 Ga0081455_102318673 186
63 3300005983 Ga0081540_1004906 Ga0081540_100490610 186
64 3300006028 Ga0070717_10273740 Ga0070717_102737402 186
65 3300006028 Ga0070717_10380275 Ga0070717_103802752 186
66 3300006175 Ga0070712_100308932 Ga0070712_1003089323 186
67 3300006931 Ga0097620_100022350 Ga0097620_1000223503 186
68 3300009101 Ga0105247_10020713 Ga0105247_100207132 186
69 3300009174 Ga0105241_10011240 Ga0105241_100112402 186
70 3300009545 Ga0105237_10309971 Ga0105237_103099712 186
71 3300013296 Ga0157374_10390238 Ga0157374_103902382 186
72 3300014325 Ga0163163_10354708 Ga0163163_103547082 186
73 3300021388 Ga0213875_10002477 Ga0213875_100024772 186
74 3300025900 Ga0207710_10010251 Ga0207710_100102513 186
75 3300025904 Ga0207647_10005798 Ga0207647_1000579810 186
76 3300025904 Ga0207647_10050909 Ga0207647_100509092 186
77 3300025904 Ga0207647_10082709 Ga0207647_100827092 186
78 3300025912 Ga0207707_10052715 Ga0207707_100527153 186
79 3300025913 Ga0207695_10008767 Ga0207695_1000876711 186
80 3300025914 Ga0207671_10000654 Ga0207671_1000065415 186
81 3300025914 Ga0207671_10155365 Ga0207671_101553652 186
82 3300025915 Ga0207693_10283547 Ga0207693_102835473 186
83 3300025915 Ga0207693_10314890 Ga0207693_103148902 186
84 3300025917 Ga0207660_10776870 Ga0207660_107768701 186
85 3300025919 Ga0207657_10036081 Ga0207657_100360815 186
86 3300025921 Ga0207652_10280393 Ga0207652_102803931 186
87 3300025924 Ga0207694_10002696 Ga0207694_1000269612 186
88 3300025928 Ga0207700_10237603 Ga0207700_102376032 186
89 3300025928 Ga0207700_10450883 Ga0207700_104508831 186
90 3300025929 Ga0207664_10125797 Ga0207664_101257974 186
91 3300025929 Ga0207664_10487501 Ga0207664_104875012 186
92 3300025939 Ga0207665_10214238 Ga0207665_102142381 186
93 3300025944 Ga0207661_10472903 Ga0207661_104729031 186
94 3300025949 Ga0207667_10255351 Ga0207667_102553511 186
95 3300025972 Ga0207668_10614065 Ga0207668_106140652 186
96 3300025981 Ga0207640_10172863 Ga0207640_101728632 186
97 3300026041 Ga0207639_10065014 Ga0207639_100650141 186
98 3300026067 Ga0207678_10058295 Ga0207678_100582953 186
99 3300026116 Ga0207674_10241725 Ga0207674_102417252 186
100 3300026118 Ga0207675_100395015 Ga0207675_1003950151 186
101 3300026142 Ga0207698_10032491 Ga0207698_100324914 186
102 3300028379 Ga0268266_10100773 Ga0268266_101007731 186
103 3300028381 Ga0268264_10000097 Ga0268264_10000097224 186
104 3300028558 Ga0265326_10072988 Ga0265326_100729881 186
105 3300028666 Ga0265336_10005483 Ga0265336_100054833 186
106 3300028800 Ga0265338_10024531 Ga0265338_100245313 186
107 3300030522 Ga0307512_10009630 Ga0307512_100096304 186
108 3300031090 Ga0265760_10011584 Ga0265760_100115842 186
109 3300031507 Ga0307509_10112106 Ga0307509_101121062 186
110 3300031548 Ga0307408_101364378 Ga0307408_1013643781 186
111 3300031824 Ga0307413_10277596 Ga0307413_102775962 186
112 3300031838 Ga0307518_10001375 Ga0307518_1000137516 186
113 3300031901 Ga0307406_10321806 Ga0307406_103218062 186
114 3300031903 Ga0307407_10136876 Ga0307407_101368762 186
115 3300031911 Ga0307412_10896889 Ga0307412_108968892 186
116 3300032126 Ga0307415_100227876 Ga0307415_1002278762 186
117 3300036458 Ga0310112_031574 Ga0310112_031574_69_629 186
118 3300037068 Ga0373925_0000009 Ga0373925_0000009_133867_134427 186
119 3300037312 Ga0395899_0766530 Ga0395899_0766530_13_573 186
120 3300037418 Ga0395900_0015956 Ga0395900_0015956_6849_7409 186
121 3300037466 Ga0395898_0020094 Ga0395898_0020094_93_653 186
122 3300037471 Ga0395905_0465820 Ga0395905_0465820_400_960 186
123 3300037853 Ga0436364_0717404 Ga0436364_0717404_113_673 186
124 3300038443 Ga0395901_0152049 Ga0395901_0152049_586_1146 186
125 3300038443 Ga0395901_0504106 Ga0395901_0504106_238_798 186
126 3300044901 Ga0466960_0690787 Ga0466960_0690787_19_579 186
127 3300045976 Ga0466967_0003750 Ga0466967_0003750_1930_2490 186
128 3300045976 Ga0466967_0008527 Ga0466967_0008527_1749_2309 186
129 3300045976 Ga0466967_0133733 Ga0466967_0133733_1540_2100 186
130 3300046462 Ga0495651_0023786 Ga0495651_0023786_43_603 186
131 3300046477 Ga0495664_0113118 Ga0495664_0113118_622_1182 186
132 3300046535 Ga0495586_0076463 Ga0495586_0076463_1196_1756 186
133 3300046642 Ga0495634_0085523 Ga0495634_0085523_1484_2044 186
134 3300046663 Ga0495635_0046223 Ga0495635_0046223_2147_2707 186
135 3300046809 Ga0495600_0035858 Ga0495600_0035858_1175_1735 186
136 3300048920 Ga0496117_0015854 Ga0496117_0015854_1604_2164 186
137 3300048927 Ga0496124_0008176 Ga0496124_0008176_2652_3212 186
138 3300048929 Ga0496126_0000007 Ga0496126_0000007_754015_754575 186
139 3300048929 Ga0496126_0077101 Ga0496126_0077101_801_1361 186
140 3300048929 Ga0496126_0127370 Ga0496126_0127370_1607_2167 186
141 3300053077 Ga0495601_0018728 Ga0495601_0018728_1089_1649 186
142 3300053078 Ga0495612_0001934 Ga0495612_0001934_1491_2051 186
143 3300053085 Ga0495619_0142483 Ga0495619_0142483_461_1021 186
144 iso_pu_bacteria 2558860112 2558906095 186
145 iso_pu_bacteria 2775506925 2776372641 186
146 iso_pu_bacteria 2775506925 2776373264 186
147 iso_pu_bacteria 2863067949 2863073941 186
148 iso_pu_bacteria 2863067949 2863074674 186
149 iso_pu_bacteria 2866552031 2866554643 186
150 iso_pu_bacteria 2899370129 2899371642 186
151 iso_pu_bacteria 2915768154 2915774077 186
152 iso_pu_bacteria 2870782633 2870783670 187
153 3300005458 Ga0070681_10374620 Ga0070681_103746202 188
154 3300005530 Ga0070679_100493925 Ga0070679_1004939252 188
155 3300005535 Ga0070684_100568325 Ga0070684_1005683252 188
156 3300005841 Ga0068863_100457996 Ga0068863_1004579961 188
157 3300006028 Ga0070717_10700435 Ga0070717_107004352 188
158 3300013105 Ga0157369_10026724 Ga0157369_100267248 188
159 3300020082 Ga0206353_11482142 Ga0206353_114821421 188
160 3300032002 Ga0307416_100256551 Ga0307416_1002565512 188
161 3300032126 Ga0307415_100158584 Ga0307415_1001585842 188
162 3300032126 Ga0307415_100216275 Ga0307415_1002162752 188
163 3300045976 Ga0466967_0109590 Ga0466967_0109590_1469_2038 188
164 iso_pu_bacteria 2904770941 2904772991 188
165 iso_pu_bacteria 2908811453 2908814184 188
166 3300044719 Ga0466971_0115204 Ga0466971_0115204_602_1183 189
167 3300005327 Ga0070658_10017491 Ga0070658_100174915 190
168 3300005329 Ga0070683_100404785 Ga0070683_1004047852 190
169 3300005331 Ga0070670_100825490 Ga0070670_1008254901 190
170 3300005335 Ga0070666_10019903 Ga0070666_100199032 190
171 3300005337 Ga0070682_100752865 Ga0070682_1007528651 190
172 3300005347 Ga0070668_100684132 Ga0070668_1006841322 190
173 3300005366 Ga0070659_100158914 Ga0070659_1001589142 190
174 3300005434 Ga0070709_10561950 Ga0070709_105619501 190
175 3300005435 Ga0070714_100150694 Ga0070714_1001506942 190
176 3300005436 Ga0070713_100182130 Ga0070713_1001821302 190
177 3300005436 Ga0070713_100287526 Ga0070713_1002875262 190
178 3300005436 Ga0070713_100333582 Ga0070713_1003335822 190
179 3300005436 Ga0070713_101049968 Ga0070713_1010499681 190
180 3300005439 Ga0070711_100169657 Ga0070711_1001696572 190
181 3300005439 Ga0070711_100818354 Ga0070711_1008183541 190
182 3300005458 Ga0070681_10047859 Ga0070681_100478592 190
183 3300005458 Ga0070681_10621907 Ga0070681_106219071 190
184 3300005530 Ga0070679_100061242 Ga0070679_1000612426 190
185 3300005535 Ga0070684_100321042 Ga0070684_1003210422 190
186 3300005535 Ga0070684_100707595 Ga0070684_1007075951 190
187 3300005544 Ga0070686_100231012 Ga0070686_1002310122 190
188 3300005548 Ga0070665_100001472 Ga0070665_1000014722 190
189 3300005548 Ga0070665_100095930 Ga0070665_1000959301 190
190 3300005577 Ga0068857_100349944 Ga0068857_1003499442 190
191 3300005577 Ga0068857_100771886 Ga0068857_1007718862 190
192 3300005614 Ga0068856_100256795 Ga0068856_1002567952 190
193 3300005616 Ga0068852_100164424 Ga0068852_1001644242 190
194 3300005719 Ga0068861_100417489 Ga0068861_1004174892 190
195 3300005841 Ga0068863_100003231 Ga0068863_1000032312 190
196 3300005842 Ga0068858_100041699 Ga0068858_1000416992 190
197 3300006038 Ga0075365_10221026 Ga0075365_102210262 190
198 3300006173 Ga0070716_100492232 Ga0070716_1004922322 190
199 3300009093 Ga0105240_10294488 Ga0105240_102944882 190
200 3300009148 Ga0105243_10185413 Ga0105243_101854131 190
201 3300009545 Ga0105237_10062915 Ga0105237_100629154 190
202 3300009553 Ga0105249_10108155 Ga0105249_101081554 190
203 3300013102 Ga0157371_10153317 Ga0157371_101533172 190
204 3300013104 Ga0157370_10046651 Ga0157370_100466512 190
205 3300013105 Ga0157369_10038040 Ga0157369_100380403 190
206 3300013105 Ga0157369_10113127 Ga0157369_101131271 190
207 3300013306 Ga0163162_11841541 Ga0163162_118415411 190
208 3300020081 Ga0206354_11086801 Ga0206354_110868012 190
209 3300020082 Ga0206353_10103952 Ga0206353_101039523 190
210 3300020082 Ga0206353_11040240 Ga0206353_110402401 190
211 3300020082 Ga0206353_11376558 Ga0206353_113765581 190
212 3300021388 Ga0213875_10002167 Ga0213875_100021677 190
213 3300022467 Ga0224712_10030717 Ga0224712_100307172 190
214 3300025904 Ga0207647_10149996 Ga0207647_101499962 190
215 3300025906 Ga0207699_10628496 Ga0207699_106284961 190
216 3300025909 Ga0207705_10015461 Ga0207705_100154612 190
217 3300025912 Ga0207707_10007089 Ga0207707_100070898 190
218 3300025912 Ga0207707_10193294 Ga0207707_101932942 190
219 3300025916 Ga0207663_10090490 Ga0207663_100904902 190
220 3300025921 Ga0207652_10016115 Ga0207652_100161157 190
221 3300025921 Ga0207652_10091601 Ga0207652_100916013 190
222 3300025925 Ga0207650_10805157 Ga0207650_108051572 190
223 3300025928 Ga0207700_10235115 Ga0207700_102351153 190
224 3300025929 Ga0207664_10132948 Ga0207664_101329482 190
225 3300025931 Ga0207644_10012619 Ga0207644_100126191 190
226 3300025935 Ga0207709_10378194 Ga0207709_103781942 190
227 3300025944 Ga0207661_10254088 Ga0207661_102540882 190
228 3300025986 Ga0207658_10013845 Ga0207658_100138452 190
229 3300026035 Ga0207703_10020580 Ga0207703_100205807 190
230 3300026067 Ga0207678_10035792 Ga0207678_100357923 190
231 3300026078 Ga0207702_10532381 Ga0207702_105323812 190
232 3300026088 Ga0207641_10005933 Ga0207641_100059332 190
233 3300026116 Ga0207674_10195202 Ga0207674_101952021 190
234 3300026116 Ga0207674_10266414 Ga0207674_102664142 190
235 3300026118 Ga0207675_100533221 Ga0207675_1005332211 190
236 3300028379 Ga0268266_10012961 Ga0268266_100129612 190
237 3300028379 Ga0268266_10114997 Ga0268266_101149974 190
238 3300028794 Ga0307515_10620632 Ga0307515_106206321 190
239 3300033545 Ga0316214_1000392 Ga0316214_10003924 190
240 3300037068 Ga0373925_0000356 Ga0373925_0000356_22076_22660 190
241 3300037853 Ga0436364_0923522 Ga0436364_0923522_15100_15672 190
242 3300044694 Ga0466963_0194309 Ga0466963_0194309_526_1119 190
243 3300045976 Ga0466967_0084237 Ga0466967_0084237_1172_1765 190
244 3300045976 Ga0466967_0314103 Ga0466967_0314103_748_1332 190
245 3300046454 Ga0495592_0092999 Ga0495592_0092999_1084_1668 190
246 3300046529 Ga0495652_0003763 Ga0495652_0003763_930_1514 190
247 3300046543 Ga0495645_0089696 Ga0495645_0089696_18_611 190
248 3300046543 Ga0495645_0093151 Ga0495645_0093151_1482_2066 190
249 3300046679 Ga0495623_0109253 Ga0495623_0109253_479_1063 190
250 3300046680 Ga0495646_0134819 Ga0495646_0134819_489_1073 190
251 3300048905 Ga0496102_0220860 Ga0496102_0220860_269_853 190
252 3300048906 Ga0496103_0097795 Ga0496103_0097795_1206_1790 190
253 3300048912 Ga0496109_0648812 Ga0496109_0648812_374_958 190
254 3300048915 Ga0496112_0889891 Ga0496112_0889891_208_792 190
255 3300048918 Ga0496115_0147356 Ga0496115_0147356_127_711 190
256 3300048922 Ga0496119_0087876 Ga0496119_0087876_476_1060 190
257 3300048929 Ga0496126_0538268 Ga0496126_0538268_127_711 190
258 3300053077 Ga0495601_0009780 Ga0495601_0009780_1613_2197 190
259 3300054114 Ga0501084_0654447 Ga0501084_0654447_70_660 190
260 3300001979 JGI24740J21852_10015126 JGI24740J21852_100151263 192
261 3300001989 JGI24739J22299_10082731 JGI24739J22299_100827311 192
262 3300005563 Ga0068855_100232447 Ga0068855_1002324472 192
263 3300005617 Ga0068859_101076991 Ga0068859_1010769912 192
264 3300005843 Ga0068860_100816867 Ga0068860_1008168671 192
265 3300005937 Ga0081455_10017198 Ga0081455_100171982 192
266 3300005937 Ga0081455_10070412 Ga0081455_100704123 192
267 3300006931 Ga0097620_101076712 Ga0097620_1010767122 192
268 3300013105 Ga0157369_10169301 Ga0157369_101693012 192
269 3300013105 Ga0157369_10513412 Ga0157369_105134122 192
270 3300025904 Ga0207647_10002199 Ga0207647_100021993 192
271 3300028381 Ga0268264_10685799 Ga0268264_106857992 192
272 3300048905 Ga0496102_0000683 Ga0496102_0000683_14912_15493 192
273 3300048906 Ga0496103_0007865 Ga0496103_0007865_2626_3207 192

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

23

69

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ui6-assembly1.cif.gz_B crystal structure of gamma-butyrolactone receptor (arpa-like protein) 0.8074 6 111
4x1e-assembly1.cif.gz_B crystal structure of unliganded e. coli transcriptional regulator rutr, w167a mutant 0.7953 13 137
7amt-assembly1.cif.gz_A structure of luxr with dna (activation) 0.7917 3 157
5h58-assembly1.cif.gz_B structural and dynamics studies of the tetr family protein, cprb from streptomyces coelicolor in complex with its biological operator sequence 0.7847 8 110
3geu-assembly1.cif.gz_B crystal structure of icar from staphylococcus aureus, a member of the tetracycline repressor protein family 0.7811 6 145
ID Description Score Start End Superfamily
1pb6B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9581 6 59 1.10.10.60
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9528 10 59 1.10.10.60
4xk4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.945 10 59 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.944 13 59 1.10.10.60
3locA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9433 10 59 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A7X5ZSW9-F1-model_v4 AcrR family transcriptional regulator 0.9629 1 107 GO:0000976
GO:0003700
AF-T1A6S9-F1-model_v4 TetR family transcriptional regulator 0.9465 1 150 GO:0000976
GO:0003700
AF-A0A7X5ZSW9-F1-model_v4 AcrR family transcriptional regulator 0.9456 1 107 GO:0000976
GO:0003700
AF-D2NPL9-F1-model_v4 Transcriptional regulator 0.939 2 72 GO:0000976
GO:0003700
AF-A0A7K2YLE7-F1-model_v4 TetR family transcriptional regulator 0.9048 1 162 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
89.06 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map