F379013

General Info

Members Datasets Scaffolds Average Seq Length
273 182 267 129

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_11008281|Ga0105238_110082811
Length 134
Sequence VVPDDSTMPKTAIVTSDAPRPAASYSQAVRKGNILQVAGQGPADPATGEFVPGGVAEQTRQTLANVRAILRAAGADFSDVVMMRVYLTDAAHFPAMNEVYSTFVAEPFPARTTVFVGLAPGMLVEIDALAVLDD

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
3 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
4 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
5 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
177 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
178 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0.37
Isolates 2.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 4.4
Rhizosphere 89.74
Stem 0
Stem Tuber 0.37
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1030774 3300002076 Unclassified 770
2 Ga0065715_10289237 3300005293 Unclassified 1067
3 Ga0065715_10414783 3300005293 Bacteria 861
4 Ga0065707_10098053 3300005295 Bacteria 3117
5 Ga0070658_11174454 3300005327 Bacteria 667
6 Ga0070683_100342150 3300005329 Unclassified 1424
7 Ga0070690_100409042 3300005330 Bacteria 998
8 Ga0070677_10750055 3300005333 Bacteria 554
9 Ga0068869_100640070 3300005334 Unclassified 902
10 Ga0070680_100089937 3300005336 Bacteria 2541
11 Ga0068868_100443733 3300005338 Unclassified 1127
12 Ga0070689_100639971 3300005340 Unclassified 924
13 Ga0070687_100741259 3300005343 Unclassified 690
14 Ga0070692_10157856 3300005345 Bacteria 1297
15 Ga0070692_11372289 3300005345 Bacteria 509
16 Ga0070671_100241087 3300005355 Unclassified 1535
17 Ga0070667_101658031 3300005367 Bacteria 601
18 Ga0070703_10079120 3300005406 Unclassified 1116
19 Ga0070709_10047111 3300005434 Bacteria 2684
20 Ga0070714_100023519 3300005435 Bacteria 5064
21 Ga0070714_100024787 3300005435 Bacteria 4943
22 Ga0070713_100419350 3300005436 Bacteria 1253
23 Ga0070701_10394215 3300005438 Unclassified 876
24 Ga0070705_100937172 3300005440 Unclassified 699
25 Ga0070705_101320165 3300005440 Bacteria 599
26 Ga0070705_101790896 3300005440 Bacteria 521
27 Ga0070700_100359292 3300005441 Bacteria 1082
28 Ga0070694_100074547 3300005444 Bacteria 2346
29 Ga0070663_100825512 3300005455 Bacteria 796
30 Ga0070706_101417899 3300005467 Unclassified 636
31 Ga0070707_100063863 3300005468 Bacteria 3534
32 Ga0070679_100097051 3300005530 Bacteria 2935
33 Ga0070684_100748220 3300005535 Bacteria 912
34 Ga0068853_100187011 3300005539 Bacteria 1880
35 Ga0070672_100058971 3300005543 Unclassified 3019
36 Ga0070686_100339145 3300005544 Bacteria 1126
37 Ga0070686_100792854 3300005544 Unclassified 763
38 Ga0070696_101089096 3300005546 Unclassified 671
39 Ga0070696_101311263 3300005546 Unclassified 615
40 Ga0070665_100091904 3300005548 Bacteria 3040
41 Ga0068855_101273019 3300005563 Bacteria 762
42 Ga0068856_100489476 3300005614 Bacteria 1251
43 Ga0070702_100230806 3300005615 Bacteria 1243
44 Ga0070702_100500678 3300005615 Bacteria 892
45 Ga0070702_101602068 3300005615 Unclassified 539
46 Ga0068852_101757050 3300005616 Bacteria 643
47 Ga0068852_102769230 3300005616 Unclassified 509
48 Ga0068859_100194322 3300005617 Bacteria 2113
49 Ga0068859_100292648 3300005617 Bacteria 1721
50 Ga0068859_102335220 3300005617 Unclassified 590
51 Ga0068864_100201221 3300005618 Bacteria 1830
52 Ga0068864_100541117 3300005618 Bacteria 1124
53 Ga0068870_10270853 3300005840 Bacteria 1060
54 Ga0068863_100026860 3300005841 Bacteria 5491
55 Ga0068863_100246342 3300005841 Bacteria 1725
56 Ga0068858_100388374 3300005842 Bacteria 1340
57 Ga0068860_100045293 3300005843 Unclassified 4195
58 Ga0068862_101571251 3300005844 Bacteria 664
59 Ga0081539_10001813 3300005985 Bacteria 33764
60 Ga0075365_10841365 3300006038 Bacteria 647
61 Ga0070716_100105318 3300006173 Bacteria 1738
62 Ga0097621_100296171 3300006237 Bacteria 1428
63 Ga0068871_100149220 3300006358 Bacteria 1993
64 Ga0075430_100094075 3300006846 Bacteria 2505
65 Ga0075431_100109912 3300006847 Bacteria 2845
66 Ga0075429_100022104 3300006880 Bacteria 5516
67 Ga0075429_100274194 3300006880 Bacteria 1477
68 Ga0097620_100194321 3300006931 Bacteria 2113
69 Ga0097620_100292635 3300006931 Bacteria 1721
70 Ga0097620_102335415 3300006931 Unclassified 590
71 Ga0099794_10276644 3300007265 Unclassified 868
72 Ga0105251_10524165 3300009011 Bacteria 556
73 Ga0111539_10149806 3300009094 Unclassified 2731
74 Ga0111539_10407299 3300009094 Bacteria 1584
75 Ga0105245_10109057 3300009098 Bacteria 2572
76 Ga0105247_11470622 3300009101 Unclassified 554
77 Ga0114129_10077576 3300009147 Bacteria 4620
78 Ga0114129_13255950 3300009147 Unclassified 526
79 Ga0105242_10848752 3300009176 Bacteria 909
80 Ga0105242_10915430 3300009176 Bacteria 878
81 Ga0105248_10123218 3300009177 Bacteria 2924
82 Ga0105248_10206955 3300009177 Bacteria 2211
83 Ga0105248_10300946 3300009177 Bacteria 1806
84 Ga0105237_10764754 3300009545 Bacteria 973
85 Ga0105238_10016563 3300009551 Bacteria 7462
86 Ga0105238_10187993 3300009551 Bacteria 2042
87 Ga0105238_11008281 3300009551 Bacteria 853
88 Ga0105238_11896243 3300009551 Unclassified 629
89 Ga0105249_10035159 3300009553 Bacteria 4543
90 Ga0105249_10062709 3300009553 Bacteria 3413
91 Ga0105033_110093 3300009986 Bacteria 830
92 Ga0105239_10352000 3300010375 Unclassified 1663
93 Ga0105246_11006910 3300011119 Bacteria 755
94 Ga0157373_10083096 3300013100 Bacteria 2257
95 Ga0157374_10727759 3300013296 Bacteria 1006
96 Ga0157378_10047766 3300013297 Bacteria 3806
97 Ga0163162_10148507 3300013306 Bacteria 2461
98 Ga0163162_11020576 3300013306 Bacteria 936
99 Ga0163162_11549213 3300013306 Bacteria 755
100 Ga0157375_10836934 3300013308 Bacteria 1067
101 Ga0157375_12081754 3300013308 Unclassified 675
102 Ga0163163_10984802 3300014325 Bacteria 906
103 Ga0163163_10995369 3300014325 Bacteria 902
104 Ga0157380_10006696 3300014326 Bacteria 8138
105 Ga0157377_11086332 3300014745 Bacteria 612
106 Ga0157379_11253001 3300014968 Bacteria 715
107 Ga0157376_10280458 3300014969 Bacteria 1569
108 Ga0163161_10077996 3300017792 Bacteria 2434
109 Ga0163161_11247203 3300017792 Bacteria 644
110 Ga0197907_11432747 3300020069 Bacteria 930
111 Ga0207653_10059690 3300025885 Unclassified 1284
112 Ga0207682_10546454 3300025893 Bacteria 548
113 Ga0207699_10049031 3300025906 Bacteria 2484
114 Ga0207643_10313568 3300025908 Unclassified 978
115 Ga0207654_10707629 3300025911 Unclassified 724
116 Ga0207652_10103512 3300025921 Bacteria 2517
117 Ga0207681_10255694 3300025923 Unclassified 1369
118 Ga0207694_10009026 3300025924 Bacteria 7525
119 Ga0207694_10116571 3300025924 Bacteria 2128
120 Ga0207687_10593313 3300025927 Bacteria 933
121 Ga0207700_10151821 3300025928 Bacteria 1915
122 Ga0207700_11694334 3300025928 Bacteria 558
123 Ga0207664_10003598 3300025929 Bacteria 10368
124 Ga0207664_10230154 3300025929 Bacteria 1611
125 Ga0207686_10000020 3300025934 Bacteria 185045
126 Ga0207709_10000128 3300025935 Bacteria 111661
127 Ga0207665_10060957 3300025939 Bacteria 2556
128 Ga0207691_10102411 3300025940 Bacteria 2554
129 Ga0207691_10508547 3300025940 Unclassified 1023
130 Ga0207661_10094785 3300025944 Bacteria 2494
131 Ga0207712_10007349 3300025961 Bacteria 6955
132 Ga0207712_10414683 3300025961 Unclassified 1135
133 Ga0207658_10533199 3300025986 Bacteria 1049
134 Ga0207677_10046519 3300026023 Bacteria 2906
135 Ga0207677_10321712 3300026023 Bacteria 1286
136 Ga0207639_10203129 3300026041 Bacteria 1701
137 Ga0207702_10091792 3300026078 Bacteria 2660
138 Ga0207702_11870255 3300026078 Bacteria 592
139 Ga0207641_10140799 3300026088 Bacteria 2176
140 Ga0207641_10903345 3300026088 Unclassified 877
141 Ga0207648_10082377 3300026089 Bacteria 2806
142 Ga0207648_10314070 3300026089 Bacteria 1407
143 Ga0207648_10503883 3300026089 Unclassified 1108
144 Ga0207676_10824081 3300026095 Bacteria 906
145 Ga0207676_11460489 3300026095 Unclassified 680
146 Ga0207674_11422940 3300026116 Bacteria 663
147 Ga0207675_100676648 3300026118 Bacteria 1039
148 Ga0207683_10569334 3300026121 Unclassified 1048
149 Ga0207698_10110513 3300026142 Bacteria 2302
150 Ga0207698_10842059 3300026142 Bacteria 922
151 Ga0207428_10881296 3300027907 Unclassified 633
152 Ga0268266_10331478 3300028379 Bacteria 1426
153 Ga0268264_10019825 3300028381 Bacteria 5494
154 Ga0268264_11743811 3300028381 Unclassified 633
155 Ga0307515_10068312 3300028794 Bacteria 4884
156 Ga0307511_10000178 3300030521 Bacteria 62672
157 Ga0307512_10029546 3300030522 Bacteria 4785
158 Ga0307513_10049292 3300031456 Bacteria 4563
159 Ga0307415_100112022 3300032126 Bacteria 2027
160 Ga0307415_100396077 3300032126 Bacteria 1177
161 Ga0307507_10000005 3300033179 Bacteria 281494
162 Ga0307507_10017668 3300033179 Bacteria 8172
163 Ga0373940_0078745 3300035088 Unclassified 971
164 Ga0373952_0071640 3300035092 Bacteria 868
165 Ga0373941_0469792 3300035115 Bacteria 531
166 Ga0395898_0656549 3300037466 Unclassified 991
167 Ga0439449_0008101 3300042007 Bacteria 3993
168 Ga0466969_0006340 3300044656 Bacteria 6295
169 Ga0466969_0007415 3300044656 Bacteria 5824
170 Ga0466969_0030919 3300044656 Bacteria 2726
171 Ga0466969_0054104 3300044656 Bacteria 1967
172 Ga0466966_0005632 3300044684 Bacteria 8238
173 Ga0466966_0089130 3300044684 Bacteria 1916
174 Ga0466961_0004281 3300044693 Bacteria 8936
175 Ga0466961_0008108 3300044693 Bacteria 6688
176 Ga0466961_0049906 3300044693 Bacteria 2673
177 Ga0466961_0218030 3300044693 Bacteria 1176
178 Ga0466961_0580751 3300044693 Bacteria 674
179 Ga0466963_0014818 3300044694 Bacteria 4814
180 Ga0466963_0493277 3300044694 Bacteria 865
181 Ga0466971_0094342 3300044719 Bacteria 1371
182 Ga0466970_0288714 3300044765 Bacteria 923
183 Ga0466959_0005561 3300045049 Bacteria 8653
184 Ga0466959_0046298 3300045049 Bacteria 3201
185 Ga0466959_0238953 3300045049 Bacteria 1255
186 Ga0466959_0359408 3300045049 Bacteria 992
187 Ga0466959_0463956 3300045049 Bacteria 858
188 Ga0466958_0067162 3300045836 Bacteria 2190
189 Ga0466958_0594417 3300045836 Bacteria 720
190 Ga0466967_0756670 3300045976 Bacteria 964
191 Ga0495592_0656306 3300046454 Bacteria 635
192 Ga0495629_0100095 3300046459 Bacteria 2023
193 Ga0495622_0486329 3300046557 Bacteria 528
194 Ga0496101_1053789 3300048904 Bacteria 639
195 Ga0496102_0867249 3300048905 Unclassified 825
196 Ga0496105_1052018 3300048908 Unclassified 606
197 Ga0496108_0202006 3300048911 Bacteria 1725
198 Ga0496108_0408020 3300048911 Unclassified 1187
199 Ga0496110_0523998 3300048913 Unclassified 1078
200 Ga0496110_1106765 3300048913 Bacteria 700
201 Ga0496111_1244999 3300048914 Bacteria 526
202 Ga0496112_0863363 3300048915 Unclassified 828
203 Ga0496114_0017786 3300048917 Bacteria 5745
204 Ga0496114_0051859 3300048917 Bacteria 3417
205 Ga0496115_0051281 3300048918 Bacteria 3309
206 Ga0501031_0091446 3300049568 Bacteria 1985
207 Ga0501032_0009502 3300049569 Bacteria 7046
208 Ga0501032_0031839 3300049569 Bacteria 3615
209 Ga0501032_0248821 3300049569 Bacteria 1154
210 Ga0501033_0033592 3300049570 Bacteria 3851
211 Ga0501033_0049833 3300049570 Bacteria 3108
212 Ga0501033_0253052 3300049570 Bacteria 1248
213 Ga0501034_0024420 3300049571 Bacteria 6149
214 Ga0501034_0033534 3300049571 Bacteria 5208
215 Ga0501034_0049806 3300049571 Bacteria 4226
216 Ga0501036_0000454 3300049572 Bacteria 29263
217 Ga0501036_0009901 3300049572 Bacteria 7849
218 Ga0501036_1268010 3300049572 Bacteria 599
219 Ga0501037_0076363 3300049573 Bacteria 2432
220 Ga0501037_0194684 3300049573 Bacteria 1434
221 Ga0501037_0253245 3300049573 Unclassified 1232
222 Ga0501038_0011561 3300049574 Bacteria 8053
223 Ga0501038_0068407 3300049574 Bacteria 3018
224 Ga0501038_0237377 3300049574 Bacteria 1448
225 Ga0501039_0006345 3300049575 Bacteria 8982
226 Ga0501039_0671303 3300049575 Bacteria 811
227 Ga0501043_0005567 3300049579 Bacteria 10151
228 Ga0501043_0014702 3300049579 Bacteria 6127
229 Ga0501043_0016663 3300049579 Bacteria 5759
230 Ga0501043_0040679 3300049579 Bacteria 3653
231 Ga0501046_0158167 3300049580 Bacteria 1706
232 Ga0501047_0006265 3300049581 Bacteria 11183
233 Ga0501047_0019389 3300049581 Bacteria 6524
234 Ga0501047_0198057 3300049581 Bacteria 1870
235 Ga0501047_0359826 3300049581 Bacteria 1291
236 Ga0501048_0003843 3300049582 Bacteria 11452
237 Ga0501068_0254088 3300049584 Bacteria 1121
238 Ga0501070_0009300 3300049586 Bacteria 8311
239 Ga0501070_0017410 3300049586 Bacteria 6033
240 Ga0501071_1335106 3300049587 Bacteria 554
241 Ga0501073_0046979 3300049589 Bacteria 3035
242 Ga0501073_0223695 3300049589 Bacteria 1300
243 Ga0501073_0277265 3300049589 Unclassified 1157
244 Ga0501074_0435755 3300049590 Bacteria 929
245 Ga0501076_0151000 3300049592 Bacteria 1890
246 Ga0501080_0000134 3300049742 Bacteria 52384
247 Ga0501083_0061597 3300049744 Bacteria 2505
248 Ga0501035_0001310 3300049822 Bacteria 25716
249 Ga0501035_0139717 3300049822 Bacteria 2106
250 Ga0501035_0562961 3300049822 Unclassified 932
251 Ga0501044_0003209 3300049823 Bacteria 18427
252 Ga0501044_0060775 3300049823 Bacteria 3867
253 Ga0501044_0087054 3300049823 Bacteria 3155
254 Ga0501044_0427260 3300049823 Bacteria 1234
255 Ga0501045_0012509 3300049824 Bacteria 5978
256 Ga0501045_1073920 3300049824 Bacteria 589
257 nmdc:mga05p37_1236752_c1 3300050507 Bacteria 768
258 nmdc:mga09592_68898_c1 3300050508 Bacteria 3001
259 nmdc:mga06r32_1305137_c1 3300050510 Bacteria 670
260 nmdc:mga08y16_77681_c1 3300050511 Unclassified 3462
261 Ga0500559_0070931 3300053136 Bacteria 1568
262 Ga0500568_0000105 3300053139 Bacteria 78066
263 Ga0500573_0506523 3300053140 Bacteria 544
264 Ga0500577_0009082 3300053142 Bacteria 2869
265 Ga0500622_0291223 3300053156 Bacteria 700
266 Ga0500637_0388431 3300053178 Bacteria 729
267 Ga0466962_0084592 3300061719 Bacteria 1518

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044693 Ga0466961_0580751 Ga0466961_0580751_307_642 111
2 3300046454 Ga0495592_0656306 Ga0495592_0656306_265_600 111
3 3300045049 Ga0466959_0463956 Ga0466959_0463956_235_591 117
4 3300045836 Ga0466958_0594417 Ga0466958_0594417_291_647 117
5 3300049586 Ga0501070_0017410 Ga0501070_0017410_5125_5517 118
6 3300049742 Ga0501080_0000134 Ga0501080_0000134_28974_29366 118
7 3300053139 Ga0500568_0000105 Ga0500568_0000105_25356_25727 118
8 iso_pu_bacteria 2751185734 2753076194 122
9 iso_pu_bacteria 2866552031 2866557141 122
10 iso_pu_bacteria 2870721527 2870726178 122
11 iso_pu_bacteria 2899370129 2899375417 122
12 iso_pu_bacteria 8056207758 8056210662 122
13 3300048904 Ga0496101_1053789 Ga0496101_1053789_166_558 123
14 3300048917 Ga0496114_0017786 Ga0496114_0017786_2238_2630 123
15 3300048917 Ga0496114_0051859 Ga0496114_0051859_2751_3125 123
16 3300048918 Ga0496115_0051281 Ga0496115_0051281_1186_1578 123
17 3300049571 Ga0501034_0049806 Ga0501034_0049806_884_1291 123
18 3300049573 Ga0501037_0194684 Ga0501037_0194684_146_553 123
19 3300049579 Ga0501043_0005567 Ga0501043_0005567_7629_8036 123
20 3300049580 Ga0501046_0158167 Ga0501046_0158167_825_1232 123
21 3300049581 Ga0501047_0006265 Ga0501047_0006265_1362_1769 123
22 3300049586 Ga0501070_0009300 Ga0501070_0009300_186_593 123
23 3300049589 Ga0501073_0223695 Ga0501073_0223695_86_493 123
24 3300049744 Ga0501083_0061597 Ga0501083_0061597_636_1043 123
25 3300005330 Ga0070690_100409042 Ga0070690_1004090422 124
26 3300005345 Ga0070692_11372289 Ga0070692_113722891 124
27 3300005535 Ga0070684_100748220 Ga0070684_1007482202 124
28 3300005544 Ga0070686_100339145 Ga0070686_1003391452 124
29 3300005842 Ga0068858_100388374 Ga0068858_1003883742 124
30 3300005844 Ga0068862_101571251 Ga0068862_1015712512 124
31 3300009098 Ga0105245_10109057 Ga0105245_101090572 124
32 3300009176 Ga0105242_10848752 Ga0105242_108487522 124
33 3300009545 Ga0105237_10764754 Ga0105237_107647542 124
34 3300011119 Ga0105246_11006910 Ga0105246_110069101 124
35 3300014968 Ga0157379_11253001 Ga0157379_112530012 124
36 3300017792 Ga0163161_11247203 Ga0163161_112472031 124
37 3300025927 Ga0207687_10593313 Ga0207687_105933132 124
38 3300026023 Ga0207677_10321712 Ga0207677_103217122 124
39 3300026118 Ga0207675_100676648 Ga0207675_1006766482 124
40 3300044693 Ga0466961_0008108 Ga0466961_0008108_1263_1652 124
41 3300048911 Ga0496108_0202006 Ga0496108_0202006_589_972 124
42 3300048913 Ga0496110_1106765 Ga0496110_1106765_96_479 124
43 3300048914 Ga0496111_1244999 Ga0496111_1244999_109_492 124
44 3300049581 Ga0501047_0359826 Ga0501047_0359826_424_816 124
45 iso_pu_bacteria 2558860280 2559430529 124
46 3300005440 Ga0070705_101320165 Ga0070705_1013201652 125
47 3300005539 Ga0068853_100187011 Ga0068853_1001870112 125
48 3300005563 Ga0068855_101273019 Ga0068855_1012730192 125
49 3300009551 Ga0105238_10187993 Ga0105238_101879933 125
50 3300013296 Ga0157374_10727759 Ga0157374_107277592 125
51 3300014969 Ga0157376_10280458 Ga0157376_102804583 125
52 3300025924 Ga0207694_10116571 Ga0207694_101165713 125
53 3300026041 Ga0207639_10203129 Ga0207639_102031293 125
54 3300026078 Ga0207702_10091792 Ga0207702_100917922 125
55 3300026142 Ga0207698_10110513 Ga0207698_101105132 125
56 3300030521 Ga0307511_10000178 Ga0307511_1000017831 125
57 3300044656 Ga0466969_0007415 Ga0466969_0007415_921_1298 125
58 3300044656 Ga0466969_0030919 Ga0466969_0030919_991_1368 125
59 3300044684 Ga0466966_0005632 Ga0466966_0005632_1269_1646 125
60 3300044693 Ga0466961_0004281 Ga0466961_0004281_7130_7507 125
61 3300044694 Ga0466963_0493277 Ga0466963_0493277_54_431 125
62 3300044765 Ga0466970_0288714 Ga0466970_0288714_79_456 125
63 3300045049 Ga0466959_0005561 Ga0466959_0005561_89_466 125
64 3300049570 Ga0501033_0253052 Ga0501033_0253052_252_635 125
65 3300049571 Ga0501034_0033534 Ga0501034_0033534_390_773 125
66 3300049573 Ga0501037_0253245 Ga0501037_0253245_160_543 125
67 3300049581 Ga0501047_0198057 Ga0501047_0198057_1231_1614 125
68 3300049589 Ga0501073_0277265 Ga0501073_0277265_295_678 125
69 3300049822 Ga0501035_0562961 Ga0501035_0562961_125_508 125
70 3300005327 Ga0070658_11174454 Ga0070658_111744542 126
71 3300005367 Ga0070667_101658031 Ga0070667_1016580312 126
72 3300005434 Ga0070709_10047111 Ga0070709_100471111 126
73 3300005435 Ga0070714_100023519 Ga0070714_1000235194 126
74 3300005436 Ga0070713_100419350 Ga0070713_1004193502 126
75 3300005530 Ga0070679_100097051 Ga0070679_1000970513 126
76 3300006173 Ga0070716_100105318 Ga0070716_1001053182 126
77 3300006880 Ga0075429_100274194 Ga0075429_1002741943 126
78 3300009986 Ga0105033_110093 Ga0105033_1100931 126
79 3300014325 Ga0163163_10995369 Ga0163163_109953692 126
80 3300025906 Ga0207699_10049031 Ga0207699_100490313 126
81 3300025921 Ga0207652_10103512 Ga0207652_101035121 126
82 3300025928 Ga0207700_10151821 Ga0207700_101518213 126
83 3300025929 Ga0207664_10003598 Ga0207664_100035988 126
84 3300025939 Ga0207665_10060957 Ga0207665_100609572 126
85 3300025986 Ga0207658_10533199 Ga0207658_105331992 126
86 3300028794 Ga0307515_10068312 Ga0307515_100683125 126
87 3300030522 Ga0307512_10029546 Ga0307512_100295466 126
88 3300031456 Ga0307513_10049292 Ga0307513_100492923 126
89 3300032126 Ga0307415_100396077 Ga0307415_1003960772 126
90 3300042007 Ga0439449_0008101 Ga0439449_0008101_139_522 126
91 3300053136 Ga0500559_0070931 Ga0500559_0070931_579_974 126
92 3300053142 Ga0500577_0009082 Ga0500577_0009082_546_926 126
93 3300053156 Ga0500622_0291223 Ga0500622_0291223_25_405 126
94 3300005329 Ga0070683_100342150 Ga0070683_1003421503 127
95 3300005336 Ga0070680_100089937 Ga0070680_1000899372 127
96 3300005340 Ga0070689_100639971 Ga0070689_1006399711 127
97 3300005343 Ga0070687_100741259 Ga0070687_1007412592 127
98 3300005345 Ga0070692_10157856 Ga0070692_101578562 127
99 3300005435 Ga0070714_100024787 Ga0070714_1000247874 127
100 3300005440 Ga0070705_100937172 Ga0070705_1009371722 127
101 3300005441 Ga0070700_100359292 Ga0070700_1003592922 127
102 3300005444 Ga0070694_100074547 Ga0070694_1000745472 127
103 3300005455 Ga0070663_100825512 Ga0070663_1008255122 127
104 3300005543 Ga0070672_100058971 Ga0070672_1000589712 127
105 3300005544 Ga0070686_100792854 Ga0070686_1007928541 127
106 3300005546 Ga0070696_101089096 Ga0070696_1010890961 127
107 3300005548 Ga0070665_100091904 Ga0070665_1000919043 127
108 3300005614 Ga0068856_100489476 Ga0068856_1004894762 127
109 3300005615 Ga0070702_100500678 Ga0070702_1005006782 127
110 3300005616 Ga0068852_102769230 Ga0068852_1027692301 127
111 3300005617 Ga0068859_100194322 Ga0068859_1001943222 127
112 3300005618 Ga0068864_100201221 Ga0068864_1002012212 127
113 3300005841 Ga0068863_100026860 Ga0068863_1000268605 127
114 3300005843 Ga0068860_100045293 Ga0068860_1000452932 127
115 3300006038 Ga0075365_10841365 Ga0075365_108413652 127
116 3300006931 Ga0097620_100194321 Ga0097620_1001943212 127
117 3300009094 Ga0111539_10149806 Ga0111539_101498062 127
118 3300009094 Ga0111539_10407299 Ga0111539_104072992 127
119 3300009101 Ga0105247_11470622 Ga0105247_114706221 127
120 3300009147 Ga0114129_13255950 Ga0114129_132559501 127
121 3300009176 Ga0105242_10915430 Ga0105242_109154301 127
122 3300009177 Ga0105248_10206955 Ga0105248_102069552 127
123 3300009177 Ga0105248_10300946 Ga0105248_103009462 127
124 3300009551 Ga0105238_11896243 Ga0105238_118962431 127
125 3300009553 Ga0105249_10062709 Ga0105249_100627092 127
126 3300010375 Ga0105239_10352000 Ga0105239_103520003 127
127 3300013297 Ga0157378_10047766 Ga0157378_100477662 127
128 3300013306 Ga0163162_10148507 Ga0163162_101485072 127
129 3300013306 Ga0163162_11020576 Ga0163162_110205762 127
130 3300013306 Ga0163162_11549213 Ga0163162_115492131 127
131 3300013308 Ga0157375_10836934 Ga0157375_108369342 127
132 3300014325 Ga0163163_10984802 Ga0163163_109848022 127
133 3300014326 Ga0157380_10006696 Ga0157380_100066967 127
134 3300014745 Ga0157377_11086332 Ga0157377_110863322 127
135 3300020069 Ga0197907_11432747 Ga0197907_114327471 127
136 3300025923 Ga0207681_10255694 Ga0207681_102556942 127
137 3300025928 Ga0207700_11694334 Ga0207700_116943342 127
138 3300025929 Ga0207664_10230154 Ga0207664_102301542 127
139 3300025940 Ga0207691_10102411 Ga0207691_101024113 127
140 3300025944 Ga0207661_10094785 Ga0207661_100947852 127
141 3300025961 Ga0207712_10414683 Ga0207712_104146832 127
142 3300026078 Ga0207702_11870255 Ga0207702_118702552 127
143 3300026088 Ga0207641_10140799 Ga0207641_101407992 127
144 3300026089 Ga0207648_10503883 Ga0207648_105038831 127
145 3300026095 Ga0207676_10824081 Ga0207676_108240812 127
146 3300027907 Ga0207428_10881296 Ga0207428_108812961 127
147 3300028379 Ga0268266_10331478 Ga0268266_103314782 127
148 3300028381 Ga0268264_10019825 Ga0268264_100198252 127
149 3300032126 Ga0307415_100112022 Ga0307415_1001120222 127
150 3300033179 Ga0307507_10000005 Ga0307507_10000005208 127
151 3300033179 Ga0307507_10017668 Ga0307507_100176686 127
152 3300037466 Ga0395898_0656549 Ga0395898_0656549_429_812 127
153 3300044656 Ga0466969_0006340 Ga0466969_0006340_1242_1625 127
154 3300044656 Ga0466969_0054104 Ga0466969_0054104_599_982 127
155 3300044684 Ga0466966_0089130 Ga0466966_0089130_645_1028 127
156 3300044693 Ga0466961_0049906 Ga0466961_0049906_541_924 127
157 3300044693 Ga0466961_0218030 Ga0466961_0218030_142_525 127
158 3300044694 Ga0466963_0014818 Ga0466963_0014818_861_1244 127
159 3300044719 Ga0466971_0094342 Ga0466971_0094342_56_439 127
160 3300045049 Ga0466959_0046298 Ga0466959_0046298_1790_2173 127
161 3300045049 Ga0466959_0238953 Ga0466959_0238953_208_591 127
162 3300045049 Ga0466959_0359408 Ga0466959_0359408_438_821 127
163 3300045836 Ga0466958_0067162 Ga0466958_0067162_675_1058 127
164 3300045976 Ga0466967_0756670 Ga0466967_0756670_391_774 127
165 3300046459 Ga0495629_0100095 Ga0495629_0100095_1148_1531 127
166 3300046557 Ga0495622_0486329 Ga0495622_0486329_42_425 127
167 3300048905 Ga0496102_0867249 Ga0496102_0867249_280_666 127
168 3300048908 Ga0496105_1052018 Ga0496105_1052018_67_450 127
169 3300048911 Ga0496108_0408020 Ga0496108_0408020_142_528 127
170 3300048913 Ga0496110_0523998 Ga0496110_0523998_553_939 127
171 3300049568 Ga0501031_0091446 Ga0501031_0091446_1454_1858 127
172 3300049569 Ga0501032_0009502 Ga0501032_0009502_704_1108 127
173 3300049569 Ga0501032_0031839 Ga0501032_0031839_621_1025 127
174 3300049569 Ga0501032_0248821 Ga0501032_0248821_197_580 127
175 3300049570 Ga0501033_0033592 Ga0501033_0033592_1051_1455 127
176 3300049570 Ga0501033_0049833 Ga0501033_0049833_559_963 127
177 3300049571 Ga0501034_0024420 Ga0501034_0024420_1820_2203 127
178 3300049572 Ga0501036_0000454 Ga0501036_0000454_21117_21500 127
179 3300049572 Ga0501036_0009901 Ga0501036_0009901_2713_3117 127
180 3300049572 Ga0501036_1268010 Ga0501036_1268010_147_551 127
181 3300049573 Ga0501037_0076363 Ga0501037_0076363_1805_2188 127
182 3300049574 Ga0501038_0011561 Ga0501038_0011561_344_727 127
183 3300049574 Ga0501038_0068407 Ga0501038_0068407_1334_1738 127
184 3300049574 Ga0501038_0237377 Ga0501038_0237377_666_1070 127
185 3300049575 Ga0501039_0006345 Ga0501039_0006345_1181_1585 127
186 3300049575 Ga0501039_0671303 Ga0501039_0671303_288_671 127
187 3300049579 Ga0501043_0014702 Ga0501043_0014702_2133_2537 127
188 3300049579 Ga0501043_0016663 Ga0501043_0016663_3314_3718 127
189 3300049579 Ga0501043_0040679 Ga0501043_0040679_1337_1720 127
190 3300049581 Ga0501047_0019389 Ga0501047_0019389_42_425 127
191 3300049582 Ga0501048_0003843 Ga0501048_0003843_5314_5697 127
192 3300049584 Ga0501068_0254088 Ga0501068_0254088_652_1056 127
193 3300049587 Ga0501071_1335106 Ga0501071_1335106_57_461 127
194 3300049589 Ga0501073_0046979 Ga0501073_0046979_152_535 127
195 3300049590 Ga0501074_0435755 Ga0501074_0435755_241_624 127
196 3300049592 Ga0501076_0151000 Ga0501076_0151000_1267_1650 127
197 3300049822 Ga0501035_0001310 Ga0501035_0001310_21196_21600 127
198 3300049822 Ga0501035_0139717 Ga0501035_0139717_109_513 127
199 3300049823 Ga0501044_0003209 Ga0501044_0003209_4117_4521 127
200 3300049823 Ga0501044_0060775 Ga0501044_0060775_2582_2986 127
201 3300049823 Ga0501044_0087054 Ga0501044_0087054_2469_2852 127
202 3300049823 Ga0501044_0427260 Ga0501044_0427260_481_864 127
203 3300049824 Ga0501045_0012509 Ga0501045_0012509_4714_5118 127
204 3300049824 Ga0501045_1073920 Ga0501045_1073920_98_481 127
205 3300050511 nmdc:mga08y16_77681_c1 nmdc:mga08y16_77681_c1_1220_1603 127
206 3300053140 Ga0500573_0506523 Ga0500573_0506523_79_474 127
207 3300053178 Ga0500637_0388431 Ga0500637_0388431_185_580 127
208 3300061719 Ga0466962_0084592 Ga0466962_0084592_975_1358 127
209 3300006846 Ga0075430_100094075 Ga0075430_1000940753 128
210 3300006847 Ga0075431_100109912 Ga0075431_1001099121 128
211 3300006880 Ga0075429_100022104 Ga0075429_1000221045 128
212 3300009147 Ga0114129_10077576 Ga0114129_100775763 128
213 3300050507 nmdc:mga05p37_1236752_c1 nmdc:mga05p37_1236752_c1_210_596 128
214 3300050508 nmdc:mga09592_68898_c1 nmdc:mga09592_68898_c1_2266_2652 128
215 3300050510 nmdc:mga06r32_1305137_c1 nmdc:mga06r32_1305137_c1_200_586 128
216 3300028381 Ga0268264_11743811 Ga0268264_117438111 129
217 3300005468 Ga0070707_100063863 Ga0070707_1000638634 130
218 3300009551 Ga0105238_11008281 Ga0105238_110082811 130
219 3300002076 JGI24749J21850_1030774 JGI24749J21850_10307741 131
220 3300005293 Ga0065715_10289237 Ga0065715_102892371 131
221 3300005293 Ga0065715_10414783 Ga0065715_104147832 131
222 3300005295 Ga0065707_10098053 Ga0065707_100980531 131
223 3300005333 Ga0070677_10750055 Ga0070677_107500551 131
224 3300005334 Ga0068869_100640070 Ga0068869_1006400702 131
225 3300005338 Ga0068868_100443733 Ga0068868_1004437331 131
226 3300005355 Ga0070671_100241087 Ga0070671_1002410871 131
227 3300005406 Ga0070703_10079120 Ga0070703_100791202 131
228 3300005438 Ga0070701_10394215 Ga0070701_103942152 131
229 3300005440 Ga0070705_101790896 Ga0070705_1017908961 131
230 3300005467 Ga0070706_101417899 Ga0070706_1014178991 131
231 3300005546 Ga0070696_101311263 Ga0070696_1013112631 131
232 3300005615 Ga0070702_100230806 Ga0070702_1002308061 131
233 3300005615 Ga0070702_101602068 Ga0070702_1016020681 131
234 3300005616 Ga0068852_101757050 Ga0068852_1017570501 131
235 3300005617 Ga0068859_100292648 Ga0068859_1002926481 131
236 3300005617 Ga0068859_102335220 Ga0068859_1023352201 131
237 3300005618 Ga0068864_100541117 Ga0068864_1005411171 131
238 3300005840 Ga0068870_10270853 Ga0068870_102708532 131
239 3300005841 Ga0068863_100246342 Ga0068863_1002463421 131
240 3300005985 Ga0081539_10001813 Ga0081539_1000181321 131
241 3300006237 Ga0097621_100296171 Ga0097621_1002961713 131
242 3300006358 Ga0068871_100149220 Ga0068871_1001492201 131
243 3300006931 Ga0097620_100292635 Ga0097620_1002926351 131
244 3300006931 Ga0097620_102335415 Ga0097620_1023354151 131
245 3300007265 Ga0099794_10276644 Ga0099794_102766442 131
246 3300009011 Ga0105251_10524165 Ga0105251_105241651 131
247 3300009177 Ga0105248_10123218 Ga0105248_101232182 131
248 3300009551 Ga0105238_10016563 Ga0105238_100165634 131
249 3300009553 Ga0105249_10035159 Ga0105249_100351593 131
250 3300013100 Ga0157373_10083096 Ga0157373_100830962 131
251 3300013308 Ga0157375_12081754 Ga0157375_120817541 131
252 3300017792 Ga0163161_10077996 Ga0163161_100779962 131
253 3300025885 Ga0207653_10059690 Ga0207653_100596902 131
254 3300025893 Ga0207682_10546454 Ga0207682_105464541 131
255 3300025908 Ga0207643_10313568 Ga0207643_103135682 131
256 3300025911 Ga0207654_10707629 Ga0207654_107076291 131
257 3300025924 Ga0207694_10009026 Ga0207694_100090263 131
258 3300025934 Ga0207686_10000020 Ga0207686_1000002099 131
259 3300025935 Ga0207709_10000128 Ga0207709_1000012845 131
260 3300025940 Ga0207691_10508547 Ga0207691_105085472 131
261 3300025961 Ga0207712_10007349 Ga0207712_100073494 131
262 3300026023 Ga0207677_10046519 Ga0207677_100465193 131
263 3300026088 Ga0207641_10903345 Ga0207641_109033452 131
264 3300026089 Ga0207648_10082377 Ga0207648_100823772 131
265 3300026089 Ga0207648_10314070 Ga0207648_103140701 131
266 3300026095 Ga0207676_11460489 Ga0207676_114604892 131
267 3300026116 Ga0207674_11422940 Ga0207674_114229401 131
268 3300026121 Ga0207683_10569334 Ga0207683_105693343 131
269 3300026142 Ga0207698_10842059 Ga0207698_108420592 131
270 3300035088 Ga0373940_0078745 Ga0373940_0078745_288_683 131
271 3300035092 Ga0373952_0071640 Ga0373952_0071640_456_851 131
272 3300035115 Ga0373941_0469792 Ga0373941_0469792_122_517 131
273 3300048915 Ga0496112_0863363 Ga0496112_0863363_269_664 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

15

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xrg-assembly1.cif.gz_A conserved hypothetical protein from clostridium thermocellum cth-2968 0.9832 5 128
2csl-assembly1.cif.gz_B crystal structure of ttha0137 from thermus thermophilus hb8 0.9804 7 130
3l7q-assembly2.cif.gz_E crystal structure of aldr from streptococcus mutans 0.9791 7 130
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9778 5 130
3mqw-assembly2.cif.gz_F crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag 0.9767 6 129
ID Description Score Start End Superfamily
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9778 5 130 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9775 5 130 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9717 5 129 3.30.1330.40
2dyyG00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9704 7 130 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9703 22 129 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A1W9P7R1-F1-model_v4 Reactive intermediate/imine deaminase 0.9937 19 129 GO:0005829
GO:0019239
AF-A0A321LJU5-F1-model_v4 Reactive intermediate/imine deaminase 0.9915 5 129 GO:0005829
GO:0019239
AF-E0NRC8-F1-model_v4 Putative endoribonuclease L-PSP 0.9899 5 128 GO:0005829
GO:0019239
AF-A0A8B1Z8Y9-F1-model_v4 deleted 0.9898 7 129
AF-A0A650CY14-F1-model_v4 Deaminase 0.9886 5 129 GO:0005829
GO:0019239

Feature Viewer

pLDDT pTM Quality
94.66 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map