F379013
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 182 | 267 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_11008281|Ga0105238_110082811 |
| Length | 134 |
| Sequence | VVPDDSTMPKTAIVTSDAPRPAASYSQAVRKGNILQVAGQGPADPATGEFVPGGVAEQTRQTLANVRAILRAAGADFSDVVMMRVYLTDAAHFPAMNEVYSTFVAEPFPARTTVFVGLAPGMLVEIDALAVLDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 3 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 4 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 5 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 117 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 118 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 119 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 122 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 124 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 127 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 128 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 132 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 133 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 134 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 135 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 136 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 141 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 142 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 144 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 176 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 177 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 178 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 179 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 180 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 181 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 182 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.44 |
| Metatranscriptomes | 0.37 |
| Isolates | 2.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.56 |
| Nodule | 0 |
| Rhizoplane | 4.4 |
| Rhizosphere | 89.74 |
| Stem | 0 |
| Stem Tuber | 0.37 |
| Unclassified | 2.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1030774 | 3300002076 | Unclassified | 770 |
| 2 | Ga0065715_10289237 | 3300005293 | Unclassified | 1067 |
| 3 | Ga0065715_10414783 | 3300005293 | Bacteria | 861 |
| 4 | Ga0065707_10098053 | 3300005295 | Bacteria | 3117 |
| 5 | Ga0070658_11174454 | 3300005327 | Bacteria | 667 |
| 6 | Ga0070683_100342150 | 3300005329 | Unclassified | 1424 |
| 7 | Ga0070690_100409042 | 3300005330 | Bacteria | 998 |
| 8 | Ga0070677_10750055 | 3300005333 | Bacteria | 554 |
| 9 | Ga0068869_100640070 | 3300005334 | Unclassified | 902 |
| 10 | Ga0070680_100089937 | 3300005336 | Bacteria | 2541 |
| 11 | Ga0068868_100443733 | 3300005338 | Unclassified | 1127 |
| 12 | Ga0070689_100639971 | 3300005340 | Unclassified | 924 |
| 13 | Ga0070687_100741259 | 3300005343 | Unclassified | 690 |
| 14 | Ga0070692_10157856 | 3300005345 | Bacteria | 1297 |
| 15 | Ga0070692_11372289 | 3300005345 | Bacteria | 509 |
| 16 | Ga0070671_100241087 | 3300005355 | Unclassified | 1535 |
| 17 | Ga0070667_101658031 | 3300005367 | Bacteria | 601 |
| 18 | Ga0070703_10079120 | 3300005406 | Unclassified | 1116 |
| 19 | Ga0070709_10047111 | 3300005434 | Bacteria | 2684 |
| 20 | Ga0070714_100023519 | 3300005435 | Bacteria | 5064 |
| 21 | Ga0070714_100024787 | 3300005435 | Bacteria | 4943 |
| 22 | Ga0070713_100419350 | 3300005436 | Bacteria | 1253 |
| 23 | Ga0070701_10394215 | 3300005438 | Unclassified | 876 |
| 24 | Ga0070705_100937172 | 3300005440 | Unclassified | 699 |
| 25 | Ga0070705_101320165 | 3300005440 | Bacteria | 599 |
| 26 | Ga0070705_101790896 | 3300005440 | Bacteria | 521 |
| 27 | Ga0070700_100359292 | 3300005441 | Bacteria | 1082 |
| 28 | Ga0070694_100074547 | 3300005444 | Bacteria | 2346 |
| 29 | Ga0070663_100825512 | 3300005455 | Bacteria | 796 |
| 30 | Ga0070706_101417899 | 3300005467 | Unclassified | 636 |
| 31 | Ga0070707_100063863 | 3300005468 | Bacteria | 3534 |
| 32 | Ga0070679_100097051 | 3300005530 | Bacteria | 2935 |
| 33 | Ga0070684_100748220 | 3300005535 | Bacteria | 912 |
| 34 | Ga0068853_100187011 | 3300005539 | Bacteria | 1880 |
| 35 | Ga0070672_100058971 | 3300005543 | Unclassified | 3019 |
| 36 | Ga0070686_100339145 | 3300005544 | Bacteria | 1126 |
| 37 | Ga0070686_100792854 | 3300005544 | Unclassified | 763 |
| 38 | Ga0070696_101089096 | 3300005546 | Unclassified | 671 |
| 39 | Ga0070696_101311263 | 3300005546 | Unclassified | 615 |
| 40 | Ga0070665_100091904 | 3300005548 | Bacteria | 3040 |
| 41 | Ga0068855_101273019 | 3300005563 | Bacteria | 762 |
| 42 | Ga0068856_100489476 | 3300005614 | Bacteria | 1251 |
| 43 | Ga0070702_100230806 | 3300005615 | Bacteria | 1243 |
| 44 | Ga0070702_100500678 | 3300005615 | Bacteria | 892 |
| 45 | Ga0070702_101602068 | 3300005615 | Unclassified | 539 |
| 46 | Ga0068852_101757050 | 3300005616 | Bacteria | 643 |
| 47 | Ga0068852_102769230 | 3300005616 | Unclassified | 509 |
| 48 | Ga0068859_100194322 | 3300005617 | Bacteria | 2113 |
| 49 | Ga0068859_100292648 | 3300005617 | Bacteria | 1721 |
| 50 | Ga0068859_102335220 | 3300005617 | Unclassified | 590 |
| 51 | Ga0068864_100201221 | 3300005618 | Bacteria | 1830 |
| 52 | Ga0068864_100541117 | 3300005618 | Bacteria | 1124 |
| 53 | Ga0068870_10270853 | 3300005840 | Bacteria | 1060 |
| 54 | Ga0068863_100026860 | 3300005841 | Bacteria | 5491 |
| 55 | Ga0068863_100246342 | 3300005841 | Bacteria | 1725 |
| 56 | Ga0068858_100388374 | 3300005842 | Bacteria | 1340 |
| 57 | Ga0068860_100045293 | 3300005843 | Unclassified | 4195 |
| 58 | Ga0068862_101571251 | 3300005844 | Bacteria | 664 |
| 59 | Ga0081539_10001813 | 3300005985 | Bacteria | 33764 |
| 60 | Ga0075365_10841365 | 3300006038 | Bacteria | 647 |
| 61 | Ga0070716_100105318 | 3300006173 | Bacteria | 1738 |
| 62 | Ga0097621_100296171 | 3300006237 | Bacteria | 1428 |
| 63 | Ga0068871_100149220 | 3300006358 | Bacteria | 1993 |
| 64 | Ga0075430_100094075 | 3300006846 | Bacteria | 2505 |
| 65 | Ga0075431_100109912 | 3300006847 | Bacteria | 2845 |
| 66 | Ga0075429_100022104 | 3300006880 | Bacteria | 5516 |
| 67 | Ga0075429_100274194 | 3300006880 | Bacteria | 1477 |
| 68 | Ga0097620_100194321 | 3300006931 | Bacteria | 2113 |
| 69 | Ga0097620_100292635 | 3300006931 | Bacteria | 1721 |
| 70 | Ga0097620_102335415 | 3300006931 | Unclassified | 590 |
| 71 | Ga0099794_10276644 | 3300007265 | Unclassified | 868 |
| 72 | Ga0105251_10524165 | 3300009011 | Bacteria | 556 |
| 73 | Ga0111539_10149806 | 3300009094 | Unclassified | 2731 |
| 74 | Ga0111539_10407299 | 3300009094 | Bacteria | 1584 |
| 75 | Ga0105245_10109057 | 3300009098 | Bacteria | 2572 |
| 76 | Ga0105247_11470622 | 3300009101 | Unclassified | 554 |
| 77 | Ga0114129_10077576 | 3300009147 | Bacteria | 4620 |
| 78 | Ga0114129_13255950 | 3300009147 | Unclassified | 526 |
| 79 | Ga0105242_10848752 | 3300009176 | Bacteria | 909 |
| 80 | Ga0105242_10915430 | 3300009176 | Bacteria | 878 |
| 81 | Ga0105248_10123218 | 3300009177 | Bacteria | 2924 |
| 82 | Ga0105248_10206955 | 3300009177 | Bacteria | 2211 |
| 83 | Ga0105248_10300946 | 3300009177 | Bacteria | 1806 |
| 84 | Ga0105237_10764754 | 3300009545 | Bacteria | 973 |
| 85 | Ga0105238_10016563 | 3300009551 | Bacteria | 7462 |
| 86 | Ga0105238_10187993 | 3300009551 | Bacteria | 2042 |
| 87 | Ga0105238_11008281 | 3300009551 | Bacteria | 853 |
| 88 | Ga0105238_11896243 | 3300009551 | Unclassified | 629 |
| 89 | Ga0105249_10035159 | 3300009553 | Bacteria | 4543 |
| 90 | Ga0105249_10062709 | 3300009553 | Bacteria | 3413 |
| 91 | Ga0105033_110093 | 3300009986 | Bacteria | 830 |
| 92 | Ga0105239_10352000 | 3300010375 | Unclassified | 1663 |
| 93 | Ga0105246_11006910 | 3300011119 | Bacteria | 755 |
| 94 | Ga0157373_10083096 | 3300013100 | Bacteria | 2257 |
| 95 | Ga0157374_10727759 | 3300013296 | Bacteria | 1006 |
| 96 | Ga0157378_10047766 | 3300013297 | Bacteria | 3806 |
| 97 | Ga0163162_10148507 | 3300013306 | Bacteria | 2461 |
| 98 | Ga0163162_11020576 | 3300013306 | Bacteria | 936 |
| 99 | Ga0163162_11549213 | 3300013306 | Bacteria | 755 |
| 100 | Ga0157375_10836934 | 3300013308 | Bacteria | 1067 |
| 101 | Ga0157375_12081754 | 3300013308 | Unclassified | 675 |
| 102 | Ga0163163_10984802 | 3300014325 | Bacteria | 906 |
| 103 | Ga0163163_10995369 | 3300014325 | Bacteria | 902 |
| 104 | Ga0157380_10006696 | 3300014326 | Bacteria | 8138 |
| 105 | Ga0157377_11086332 | 3300014745 | Bacteria | 612 |
| 106 | Ga0157379_11253001 | 3300014968 | Bacteria | 715 |
| 107 | Ga0157376_10280458 | 3300014969 | Bacteria | 1569 |
| 108 | Ga0163161_10077996 | 3300017792 | Bacteria | 2434 |
| 109 | Ga0163161_11247203 | 3300017792 | Bacteria | 644 |
| 110 | Ga0197907_11432747 | 3300020069 | Bacteria | 930 |
| 111 | Ga0207653_10059690 | 3300025885 | Unclassified | 1284 |
| 112 | Ga0207682_10546454 | 3300025893 | Bacteria | 548 |
| 113 | Ga0207699_10049031 | 3300025906 | Bacteria | 2484 |
| 114 | Ga0207643_10313568 | 3300025908 | Unclassified | 978 |
| 115 | Ga0207654_10707629 | 3300025911 | Unclassified | 724 |
| 116 | Ga0207652_10103512 | 3300025921 | Bacteria | 2517 |
| 117 | Ga0207681_10255694 | 3300025923 | Unclassified | 1369 |
| 118 | Ga0207694_10009026 | 3300025924 | Bacteria | 7525 |
| 119 | Ga0207694_10116571 | 3300025924 | Bacteria | 2128 |
| 120 | Ga0207687_10593313 | 3300025927 | Bacteria | 933 |
| 121 | Ga0207700_10151821 | 3300025928 | Bacteria | 1915 |
| 122 | Ga0207700_11694334 | 3300025928 | Bacteria | 558 |
| 123 | Ga0207664_10003598 | 3300025929 | Bacteria | 10368 |
| 124 | Ga0207664_10230154 | 3300025929 | Bacteria | 1611 |
| 125 | Ga0207686_10000020 | 3300025934 | Bacteria | 185045 |
| 126 | Ga0207709_10000128 | 3300025935 | Bacteria | 111661 |
| 127 | Ga0207665_10060957 | 3300025939 | Bacteria | 2556 |
| 128 | Ga0207691_10102411 | 3300025940 | Bacteria | 2554 |
| 129 | Ga0207691_10508547 | 3300025940 | Unclassified | 1023 |
| 130 | Ga0207661_10094785 | 3300025944 | Bacteria | 2494 |
| 131 | Ga0207712_10007349 | 3300025961 | Bacteria | 6955 |
| 132 | Ga0207712_10414683 | 3300025961 | Unclassified | 1135 |
| 133 | Ga0207658_10533199 | 3300025986 | Bacteria | 1049 |
| 134 | Ga0207677_10046519 | 3300026023 | Bacteria | 2906 |
| 135 | Ga0207677_10321712 | 3300026023 | Bacteria | 1286 |
| 136 | Ga0207639_10203129 | 3300026041 | Bacteria | 1701 |
| 137 | Ga0207702_10091792 | 3300026078 | Bacteria | 2660 |
| 138 | Ga0207702_11870255 | 3300026078 | Bacteria | 592 |
| 139 | Ga0207641_10140799 | 3300026088 | Bacteria | 2176 |
| 140 | Ga0207641_10903345 | 3300026088 | Unclassified | 877 |
| 141 | Ga0207648_10082377 | 3300026089 | Bacteria | 2806 |
| 142 | Ga0207648_10314070 | 3300026089 | Bacteria | 1407 |
| 143 | Ga0207648_10503883 | 3300026089 | Unclassified | 1108 |
| 144 | Ga0207676_10824081 | 3300026095 | Bacteria | 906 |
| 145 | Ga0207676_11460489 | 3300026095 | Unclassified | 680 |
| 146 | Ga0207674_11422940 | 3300026116 | Bacteria | 663 |
| 147 | Ga0207675_100676648 | 3300026118 | Bacteria | 1039 |
| 148 | Ga0207683_10569334 | 3300026121 | Unclassified | 1048 |
| 149 | Ga0207698_10110513 | 3300026142 | Bacteria | 2302 |
| 150 | Ga0207698_10842059 | 3300026142 | Bacteria | 922 |
| 151 | Ga0207428_10881296 | 3300027907 | Unclassified | 633 |
| 152 | Ga0268266_10331478 | 3300028379 | Bacteria | 1426 |
| 153 | Ga0268264_10019825 | 3300028381 | Bacteria | 5494 |
| 154 | Ga0268264_11743811 | 3300028381 | Unclassified | 633 |
| 155 | Ga0307515_10068312 | 3300028794 | Bacteria | 4884 |
| 156 | Ga0307511_10000178 | 3300030521 | Bacteria | 62672 |
| 157 | Ga0307512_10029546 | 3300030522 | Bacteria | 4785 |
| 158 | Ga0307513_10049292 | 3300031456 | Bacteria | 4563 |
| 159 | Ga0307415_100112022 | 3300032126 | Bacteria | 2027 |
| 160 | Ga0307415_100396077 | 3300032126 | Bacteria | 1177 |
| 161 | Ga0307507_10000005 | 3300033179 | Bacteria | 281494 |
| 162 | Ga0307507_10017668 | 3300033179 | Bacteria | 8172 |
| 163 | Ga0373940_0078745 | 3300035088 | Unclassified | 971 |
| 164 | Ga0373952_0071640 | 3300035092 | Bacteria | 868 |
| 165 | Ga0373941_0469792 | 3300035115 | Bacteria | 531 |
| 166 | Ga0395898_0656549 | 3300037466 | Unclassified | 991 |
| 167 | Ga0439449_0008101 | 3300042007 | Bacteria | 3993 |
| 168 | Ga0466969_0006340 | 3300044656 | Bacteria | 6295 |
| 169 | Ga0466969_0007415 | 3300044656 | Bacteria | 5824 |
| 170 | Ga0466969_0030919 | 3300044656 | Bacteria | 2726 |
| 171 | Ga0466969_0054104 | 3300044656 | Bacteria | 1967 |
| 172 | Ga0466966_0005632 | 3300044684 | Bacteria | 8238 |
| 173 | Ga0466966_0089130 | 3300044684 | Bacteria | 1916 |
| 174 | Ga0466961_0004281 | 3300044693 | Bacteria | 8936 |
| 175 | Ga0466961_0008108 | 3300044693 | Bacteria | 6688 |
| 176 | Ga0466961_0049906 | 3300044693 | Bacteria | 2673 |
| 177 | Ga0466961_0218030 | 3300044693 | Bacteria | 1176 |
| 178 | Ga0466961_0580751 | 3300044693 | Bacteria | 674 |
| 179 | Ga0466963_0014818 | 3300044694 | Bacteria | 4814 |
| 180 | Ga0466963_0493277 | 3300044694 | Bacteria | 865 |
| 181 | Ga0466971_0094342 | 3300044719 | Bacteria | 1371 |
| 182 | Ga0466970_0288714 | 3300044765 | Bacteria | 923 |
| 183 | Ga0466959_0005561 | 3300045049 | Bacteria | 8653 |
| 184 | Ga0466959_0046298 | 3300045049 | Bacteria | 3201 |
| 185 | Ga0466959_0238953 | 3300045049 | Bacteria | 1255 |
| 186 | Ga0466959_0359408 | 3300045049 | Bacteria | 992 |
| 187 | Ga0466959_0463956 | 3300045049 | Bacteria | 858 |
| 188 | Ga0466958_0067162 | 3300045836 | Bacteria | 2190 |
| 189 | Ga0466958_0594417 | 3300045836 | Bacteria | 720 |
| 190 | Ga0466967_0756670 | 3300045976 | Bacteria | 964 |
| 191 | Ga0495592_0656306 | 3300046454 | Bacteria | 635 |
| 192 | Ga0495629_0100095 | 3300046459 | Bacteria | 2023 |
| 193 | Ga0495622_0486329 | 3300046557 | Bacteria | 528 |
| 194 | Ga0496101_1053789 | 3300048904 | Bacteria | 639 |
| 195 | Ga0496102_0867249 | 3300048905 | Unclassified | 825 |
| 196 | Ga0496105_1052018 | 3300048908 | Unclassified | 606 |
| 197 | Ga0496108_0202006 | 3300048911 | Bacteria | 1725 |
| 198 | Ga0496108_0408020 | 3300048911 | Unclassified | 1187 |
| 199 | Ga0496110_0523998 | 3300048913 | Unclassified | 1078 |
| 200 | Ga0496110_1106765 | 3300048913 | Bacteria | 700 |
| 201 | Ga0496111_1244999 | 3300048914 | Bacteria | 526 |
| 202 | Ga0496112_0863363 | 3300048915 | Unclassified | 828 |
| 203 | Ga0496114_0017786 | 3300048917 | Bacteria | 5745 |
| 204 | Ga0496114_0051859 | 3300048917 | Bacteria | 3417 |
| 205 | Ga0496115_0051281 | 3300048918 | Bacteria | 3309 |
| 206 | Ga0501031_0091446 | 3300049568 | Bacteria | 1985 |
| 207 | Ga0501032_0009502 | 3300049569 | Bacteria | 7046 |
| 208 | Ga0501032_0031839 | 3300049569 | Bacteria | 3615 |
| 209 | Ga0501032_0248821 | 3300049569 | Bacteria | 1154 |
| 210 | Ga0501033_0033592 | 3300049570 | Bacteria | 3851 |
| 211 | Ga0501033_0049833 | 3300049570 | Bacteria | 3108 |
| 212 | Ga0501033_0253052 | 3300049570 | Bacteria | 1248 |
| 213 | Ga0501034_0024420 | 3300049571 | Bacteria | 6149 |
| 214 | Ga0501034_0033534 | 3300049571 | Bacteria | 5208 |
| 215 | Ga0501034_0049806 | 3300049571 | Bacteria | 4226 |
| 216 | Ga0501036_0000454 | 3300049572 | Bacteria | 29263 |
| 217 | Ga0501036_0009901 | 3300049572 | Bacteria | 7849 |
| 218 | Ga0501036_1268010 | 3300049572 | Bacteria | 599 |
| 219 | Ga0501037_0076363 | 3300049573 | Bacteria | 2432 |
| 220 | Ga0501037_0194684 | 3300049573 | Bacteria | 1434 |
| 221 | Ga0501037_0253245 | 3300049573 | Unclassified | 1232 |
| 222 | Ga0501038_0011561 | 3300049574 | Bacteria | 8053 |
| 223 | Ga0501038_0068407 | 3300049574 | Bacteria | 3018 |
| 224 | Ga0501038_0237377 | 3300049574 | Bacteria | 1448 |
| 225 | Ga0501039_0006345 | 3300049575 | Bacteria | 8982 |
| 226 | Ga0501039_0671303 | 3300049575 | Bacteria | 811 |
| 227 | Ga0501043_0005567 | 3300049579 | Bacteria | 10151 |
| 228 | Ga0501043_0014702 | 3300049579 | Bacteria | 6127 |
| 229 | Ga0501043_0016663 | 3300049579 | Bacteria | 5759 |
| 230 | Ga0501043_0040679 | 3300049579 | Bacteria | 3653 |
| 231 | Ga0501046_0158167 | 3300049580 | Bacteria | 1706 |
| 232 | Ga0501047_0006265 | 3300049581 | Bacteria | 11183 |
| 233 | Ga0501047_0019389 | 3300049581 | Bacteria | 6524 |
| 234 | Ga0501047_0198057 | 3300049581 | Bacteria | 1870 |
| 235 | Ga0501047_0359826 | 3300049581 | Bacteria | 1291 |
| 236 | Ga0501048_0003843 | 3300049582 | Bacteria | 11452 |
| 237 | Ga0501068_0254088 | 3300049584 | Bacteria | 1121 |
| 238 | Ga0501070_0009300 | 3300049586 | Bacteria | 8311 |
| 239 | Ga0501070_0017410 | 3300049586 | Bacteria | 6033 |
| 240 | Ga0501071_1335106 | 3300049587 | Bacteria | 554 |
| 241 | Ga0501073_0046979 | 3300049589 | Bacteria | 3035 |
| 242 | Ga0501073_0223695 | 3300049589 | Bacteria | 1300 |
| 243 | Ga0501073_0277265 | 3300049589 | Unclassified | 1157 |
| 244 | Ga0501074_0435755 | 3300049590 | Bacteria | 929 |
| 245 | Ga0501076_0151000 | 3300049592 | Bacteria | 1890 |
| 246 | Ga0501080_0000134 | 3300049742 | Bacteria | 52384 |
| 247 | Ga0501083_0061597 | 3300049744 | Bacteria | 2505 |
| 248 | Ga0501035_0001310 | 3300049822 | Bacteria | 25716 |
| 249 | Ga0501035_0139717 | 3300049822 | Bacteria | 2106 |
| 250 | Ga0501035_0562961 | 3300049822 | Unclassified | 932 |
| 251 | Ga0501044_0003209 | 3300049823 | Bacteria | 18427 |
| 252 | Ga0501044_0060775 | 3300049823 | Bacteria | 3867 |
| 253 | Ga0501044_0087054 | 3300049823 | Bacteria | 3155 |
| 254 | Ga0501044_0427260 | 3300049823 | Bacteria | 1234 |
| 255 | Ga0501045_0012509 | 3300049824 | Bacteria | 5978 |
| 256 | Ga0501045_1073920 | 3300049824 | Bacteria | 589 |
| 257 | nmdc:mga05p37_1236752_c1 | 3300050507 | Bacteria | 768 |
| 258 | nmdc:mga09592_68898_c1 | 3300050508 | Bacteria | 3001 |
| 259 | nmdc:mga06r32_1305137_c1 | 3300050510 | Bacteria | 670 |
| 260 | nmdc:mga08y16_77681_c1 | 3300050511 | Unclassified | 3462 |
| 261 | Ga0500559_0070931 | 3300053136 | Bacteria | 1568 |
| 262 | Ga0500568_0000105 | 3300053139 | Bacteria | 78066 |
| 263 | Ga0500573_0506523 | 3300053140 | Bacteria | 544 |
| 264 | Ga0500577_0009082 | 3300053142 | Bacteria | 2869 |
| 265 | Ga0500622_0291223 | 3300053156 | Bacteria | 700 |
| 266 | Ga0500637_0388431 | 3300053178 | Bacteria | 729 |
| 267 | Ga0466962_0084592 | 3300061719 | Bacteria | 1518 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044693 | Ga0466961_0580751 | Ga0466961_0580751_307_642 | 111 |
| 2 | 3300046454 | Ga0495592_0656306 | Ga0495592_0656306_265_600 | 111 |
| 3 | 3300045049 | Ga0466959_0463956 | Ga0466959_0463956_235_591 | 117 |
| 4 | 3300045836 | Ga0466958_0594417 | Ga0466958_0594417_291_647 | 117 |
| 5 | 3300049586 | Ga0501070_0017410 | Ga0501070_0017410_5125_5517 | 118 |
| 6 | 3300049742 | Ga0501080_0000134 | Ga0501080_0000134_28974_29366 | 118 |
| 7 | 3300053139 | Ga0500568_0000105 | Ga0500568_0000105_25356_25727 | 118 |
| 8 | iso_pu_bacteria | 2751185734 | 2753076194 | 122 |
| 9 | iso_pu_bacteria | 2866552031 | 2866557141 | 122 |
| 10 | iso_pu_bacteria | 2870721527 | 2870726178 | 122 |
| 11 | iso_pu_bacteria | 2899370129 | 2899375417 | 122 |
| 12 | iso_pu_bacteria | 8056207758 | 8056210662 | 122 |
| 13 | 3300048904 | Ga0496101_1053789 | Ga0496101_1053789_166_558 | 123 |
| 14 | 3300048917 | Ga0496114_0017786 | Ga0496114_0017786_2238_2630 | 123 |
| 15 | 3300048917 | Ga0496114_0051859 | Ga0496114_0051859_2751_3125 | 123 |
| 16 | 3300048918 | Ga0496115_0051281 | Ga0496115_0051281_1186_1578 | 123 |
| 17 | 3300049571 | Ga0501034_0049806 | Ga0501034_0049806_884_1291 | 123 |
| 18 | 3300049573 | Ga0501037_0194684 | Ga0501037_0194684_146_553 | 123 |
| 19 | 3300049579 | Ga0501043_0005567 | Ga0501043_0005567_7629_8036 | 123 |
| 20 | 3300049580 | Ga0501046_0158167 | Ga0501046_0158167_825_1232 | 123 |
| 21 | 3300049581 | Ga0501047_0006265 | Ga0501047_0006265_1362_1769 | 123 |
| 22 | 3300049586 | Ga0501070_0009300 | Ga0501070_0009300_186_593 | 123 |
| 23 | 3300049589 | Ga0501073_0223695 | Ga0501073_0223695_86_493 | 123 |
| 24 | 3300049744 | Ga0501083_0061597 | Ga0501083_0061597_636_1043 | 123 |
| 25 | 3300005330 | Ga0070690_100409042 | Ga0070690_1004090422 | 124 |
| 26 | 3300005345 | Ga0070692_11372289 | Ga0070692_113722891 | 124 |
| 27 | 3300005535 | Ga0070684_100748220 | Ga0070684_1007482202 | 124 |
| 28 | 3300005544 | Ga0070686_100339145 | Ga0070686_1003391452 | 124 |
| 29 | 3300005842 | Ga0068858_100388374 | Ga0068858_1003883742 | 124 |
| 30 | 3300005844 | Ga0068862_101571251 | Ga0068862_1015712512 | 124 |
| 31 | 3300009098 | Ga0105245_10109057 | Ga0105245_101090572 | 124 |
| 32 | 3300009176 | Ga0105242_10848752 | Ga0105242_108487522 | 124 |
| 33 | 3300009545 | Ga0105237_10764754 | Ga0105237_107647542 | 124 |
| 34 | 3300011119 | Ga0105246_11006910 | Ga0105246_110069101 | 124 |
| 35 | 3300014968 | Ga0157379_11253001 | Ga0157379_112530012 | 124 |
| 36 | 3300017792 | Ga0163161_11247203 | Ga0163161_112472031 | 124 |
| 37 | 3300025927 | Ga0207687_10593313 | Ga0207687_105933132 | 124 |
| 38 | 3300026023 | Ga0207677_10321712 | Ga0207677_103217122 | 124 |
| 39 | 3300026118 | Ga0207675_100676648 | Ga0207675_1006766482 | 124 |
| 40 | 3300044693 | Ga0466961_0008108 | Ga0466961_0008108_1263_1652 | 124 |
| 41 | 3300048911 | Ga0496108_0202006 | Ga0496108_0202006_589_972 | 124 |
| 42 | 3300048913 | Ga0496110_1106765 | Ga0496110_1106765_96_479 | 124 |
| 43 | 3300048914 | Ga0496111_1244999 | Ga0496111_1244999_109_492 | 124 |
| 44 | 3300049581 | Ga0501047_0359826 | Ga0501047_0359826_424_816 | 124 |
| 45 | iso_pu_bacteria | 2558860280 | 2559430529 | 124 |
| 46 | 3300005440 | Ga0070705_101320165 | Ga0070705_1013201652 | 125 |
| 47 | 3300005539 | Ga0068853_100187011 | Ga0068853_1001870112 | 125 |
| 48 | 3300005563 | Ga0068855_101273019 | Ga0068855_1012730192 | 125 |
| 49 | 3300009551 | Ga0105238_10187993 | Ga0105238_101879933 | 125 |
| 50 | 3300013296 | Ga0157374_10727759 | Ga0157374_107277592 | 125 |
| 51 | 3300014969 | Ga0157376_10280458 | Ga0157376_102804583 | 125 |
| 52 | 3300025924 | Ga0207694_10116571 | Ga0207694_101165713 | 125 |
| 53 | 3300026041 | Ga0207639_10203129 | Ga0207639_102031293 | 125 |
| 54 | 3300026078 | Ga0207702_10091792 | Ga0207702_100917922 | 125 |
| 55 | 3300026142 | Ga0207698_10110513 | Ga0207698_101105132 | 125 |
| 56 | 3300030521 | Ga0307511_10000178 | Ga0307511_1000017831 | 125 |
| 57 | 3300044656 | Ga0466969_0007415 | Ga0466969_0007415_921_1298 | 125 |
| 58 | 3300044656 | Ga0466969_0030919 | Ga0466969_0030919_991_1368 | 125 |
| 59 | 3300044684 | Ga0466966_0005632 | Ga0466966_0005632_1269_1646 | 125 |
| 60 | 3300044693 | Ga0466961_0004281 | Ga0466961_0004281_7130_7507 | 125 |
| 61 | 3300044694 | Ga0466963_0493277 | Ga0466963_0493277_54_431 | 125 |
| 62 | 3300044765 | Ga0466970_0288714 | Ga0466970_0288714_79_456 | 125 |
| 63 | 3300045049 | Ga0466959_0005561 | Ga0466959_0005561_89_466 | 125 |
| 64 | 3300049570 | Ga0501033_0253052 | Ga0501033_0253052_252_635 | 125 |
| 65 | 3300049571 | Ga0501034_0033534 | Ga0501034_0033534_390_773 | 125 |
| 66 | 3300049573 | Ga0501037_0253245 | Ga0501037_0253245_160_543 | 125 |
| 67 | 3300049581 | Ga0501047_0198057 | Ga0501047_0198057_1231_1614 | 125 |
| 68 | 3300049589 | Ga0501073_0277265 | Ga0501073_0277265_295_678 | 125 |
| 69 | 3300049822 | Ga0501035_0562961 | Ga0501035_0562961_125_508 | 125 |
| 70 | 3300005327 | Ga0070658_11174454 | Ga0070658_111744542 | 126 |
| 71 | 3300005367 | Ga0070667_101658031 | Ga0070667_1016580312 | 126 |
| 72 | 3300005434 | Ga0070709_10047111 | Ga0070709_100471111 | 126 |
| 73 | 3300005435 | Ga0070714_100023519 | Ga0070714_1000235194 | 126 |
| 74 | 3300005436 | Ga0070713_100419350 | Ga0070713_1004193502 | 126 |
| 75 | 3300005530 | Ga0070679_100097051 | Ga0070679_1000970513 | 126 |
| 76 | 3300006173 | Ga0070716_100105318 | Ga0070716_1001053182 | 126 |
| 77 | 3300006880 | Ga0075429_100274194 | Ga0075429_1002741943 | 126 |
| 78 | 3300009986 | Ga0105033_110093 | Ga0105033_1100931 | 126 |
| 79 | 3300014325 | Ga0163163_10995369 | Ga0163163_109953692 | 126 |
| 80 | 3300025906 | Ga0207699_10049031 | Ga0207699_100490313 | 126 |
| 81 | 3300025921 | Ga0207652_10103512 | Ga0207652_101035121 | 126 |
| 82 | 3300025928 | Ga0207700_10151821 | Ga0207700_101518213 | 126 |
| 83 | 3300025929 | Ga0207664_10003598 | Ga0207664_100035988 | 126 |
| 84 | 3300025939 | Ga0207665_10060957 | Ga0207665_100609572 | 126 |
| 85 | 3300025986 | Ga0207658_10533199 | Ga0207658_105331992 | 126 |
| 86 | 3300028794 | Ga0307515_10068312 | Ga0307515_100683125 | 126 |
| 87 | 3300030522 | Ga0307512_10029546 | Ga0307512_100295466 | 126 |
| 88 | 3300031456 | Ga0307513_10049292 | Ga0307513_100492923 | 126 |
| 89 | 3300032126 | Ga0307415_100396077 | Ga0307415_1003960772 | 126 |
| 90 | 3300042007 | Ga0439449_0008101 | Ga0439449_0008101_139_522 | 126 |
| 91 | 3300053136 | Ga0500559_0070931 | Ga0500559_0070931_579_974 | 126 |
| 92 | 3300053142 | Ga0500577_0009082 | Ga0500577_0009082_546_926 | 126 |
| 93 | 3300053156 | Ga0500622_0291223 | Ga0500622_0291223_25_405 | 126 |
| 94 | 3300005329 | Ga0070683_100342150 | Ga0070683_1003421503 | 127 |
| 95 | 3300005336 | Ga0070680_100089937 | Ga0070680_1000899372 | 127 |
| 96 | 3300005340 | Ga0070689_100639971 | Ga0070689_1006399711 | 127 |
| 97 | 3300005343 | Ga0070687_100741259 | Ga0070687_1007412592 | 127 |
| 98 | 3300005345 | Ga0070692_10157856 | Ga0070692_101578562 | 127 |
| 99 | 3300005435 | Ga0070714_100024787 | Ga0070714_1000247874 | 127 |
| 100 | 3300005440 | Ga0070705_100937172 | Ga0070705_1009371722 | 127 |
| 101 | 3300005441 | Ga0070700_100359292 | Ga0070700_1003592922 | 127 |
| 102 | 3300005444 | Ga0070694_100074547 | Ga0070694_1000745472 | 127 |
| 103 | 3300005455 | Ga0070663_100825512 | Ga0070663_1008255122 | 127 |
| 104 | 3300005543 | Ga0070672_100058971 | Ga0070672_1000589712 | 127 |
| 105 | 3300005544 | Ga0070686_100792854 | Ga0070686_1007928541 | 127 |
| 106 | 3300005546 | Ga0070696_101089096 | Ga0070696_1010890961 | 127 |
| 107 | 3300005548 | Ga0070665_100091904 | Ga0070665_1000919043 | 127 |
| 108 | 3300005614 | Ga0068856_100489476 | Ga0068856_1004894762 | 127 |
| 109 | 3300005615 | Ga0070702_100500678 | Ga0070702_1005006782 | 127 |
| 110 | 3300005616 | Ga0068852_102769230 | Ga0068852_1027692301 | 127 |
| 111 | 3300005617 | Ga0068859_100194322 | Ga0068859_1001943222 | 127 |
| 112 | 3300005618 | Ga0068864_100201221 | Ga0068864_1002012212 | 127 |
| 113 | 3300005841 | Ga0068863_100026860 | Ga0068863_1000268605 | 127 |
| 114 | 3300005843 | Ga0068860_100045293 | Ga0068860_1000452932 | 127 |
| 115 | 3300006038 | Ga0075365_10841365 | Ga0075365_108413652 | 127 |
| 116 | 3300006931 | Ga0097620_100194321 | Ga0097620_1001943212 | 127 |
| 117 | 3300009094 | Ga0111539_10149806 | Ga0111539_101498062 | 127 |
| 118 | 3300009094 | Ga0111539_10407299 | Ga0111539_104072992 | 127 |
| 119 | 3300009101 | Ga0105247_11470622 | Ga0105247_114706221 | 127 |
| 120 | 3300009147 | Ga0114129_13255950 | Ga0114129_132559501 | 127 |
| 121 | 3300009176 | Ga0105242_10915430 | Ga0105242_109154301 | 127 |
| 122 | 3300009177 | Ga0105248_10206955 | Ga0105248_102069552 | 127 |
| 123 | 3300009177 | Ga0105248_10300946 | Ga0105248_103009462 | 127 |
| 124 | 3300009551 | Ga0105238_11896243 | Ga0105238_118962431 | 127 |
| 125 | 3300009553 | Ga0105249_10062709 | Ga0105249_100627092 | 127 |
| 126 | 3300010375 | Ga0105239_10352000 | Ga0105239_103520003 | 127 |
| 127 | 3300013297 | Ga0157378_10047766 | Ga0157378_100477662 | 127 |
| 128 | 3300013306 | Ga0163162_10148507 | Ga0163162_101485072 | 127 |
| 129 | 3300013306 | Ga0163162_11020576 | Ga0163162_110205762 | 127 |
| 130 | 3300013306 | Ga0163162_11549213 | Ga0163162_115492131 | 127 |
| 131 | 3300013308 | Ga0157375_10836934 | Ga0157375_108369342 | 127 |
| 132 | 3300014325 | Ga0163163_10984802 | Ga0163163_109848022 | 127 |
| 133 | 3300014326 | Ga0157380_10006696 | Ga0157380_100066967 | 127 |
| 134 | 3300014745 | Ga0157377_11086332 | Ga0157377_110863322 | 127 |
| 135 | 3300020069 | Ga0197907_11432747 | Ga0197907_114327471 | 127 |
| 136 | 3300025923 | Ga0207681_10255694 | Ga0207681_102556942 | 127 |
| 137 | 3300025928 | Ga0207700_11694334 | Ga0207700_116943342 | 127 |
| 138 | 3300025929 | Ga0207664_10230154 | Ga0207664_102301542 | 127 |
| 139 | 3300025940 | Ga0207691_10102411 | Ga0207691_101024113 | 127 |
| 140 | 3300025944 | Ga0207661_10094785 | Ga0207661_100947852 | 127 |
| 141 | 3300025961 | Ga0207712_10414683 | Ga0207712_104146832 | 127 |
| 142 | 3300026078 | Ga0207702_11870255 | Ga0207702_118702552 | 127 |
| 143 | 3300026088 | Ga0207641_10140799 | Ga0207641_101407992 | 127 |
| 144 | 3300026089 | Ga0207648_10503883 | Ga0207648_105038831 | 127 |
| 145 | 3300026095 | Ga0207676_10824081 | Ga0207676_108240812 | 127 |
| 146 | 3300027907 | Ga0207428_10881296 | Ga0207428_108812961 | 127 |
| 147 | 3300028379 | Ga0268266_10331478 | Ga0268266_103314782 | 127 |
| 148 | 3300028381 | Ga0268264_10019825 | Ga0268264_100198252 | 127 |
| 149 | 3300032126 | Ga0307415_100112022 | Ga0307415_1001120222 | 127 |
| 150 | 3300033179 | Ga0307507_10000005 | Ga0307507_10000005208 | 127 |
| 151 | 3300033179 | Ga0307507_10017668 | Ga0307507_100176686 | 127 |
| 152 | 3300037466 | Ga0395898_0656549 | Ga0395898_0656549_429_812 | 127 |
| 153 | 3300044656 | Ga0466969_0006340 | Ga0466969_0006340_1242_1625 | 127 |
| 154 | 3300044656 | Ga0466969_0054104 | Ga0466969_0054104_599_982 | 127 |
| 155 | 3300044684 | Ga0466966_0089130 | Ga0466966_0089130_645_1028 | 127 |
| 156 | 3300044693 | Ga0466961_0049906 | Ga0466961_0049906_541_924 | 127 |
| 157 | 3300044693 | Ga0466961_0218030 | Ga0466961_0218030_142_525 | 127 |
| 158 | 3300044694 | Ga0466963_0014818 | Ga0466963_0014818_861_1244 | 127 |
| 159 | 3300044719 | Ga0466971_0094342 | Ga0466971_0094342_56_439 | 127 |
| 160 | 3300045049 | Ga0466959_0046298 | Ga0466959_0046298_1790_2173 | 127 |
| 161 | 3300045049 | Ga0466959_0238953 | Ga0466959_0238953_208_591 | 127 |
| 162 | 3300045049 | Ga0466959_0359408 | Ga0466959_0359408_438_821 | 127 |
| 163 | 3300045836 | Ga0466958_0067162 | Ga0466958_0067162_675_1058 | 127 |
| 164 | 3300045976 | Ga0466967_0756670 | Ga0466967_0756670_391_774 | 127 |
| 165 | 3300046459 | Ga0495629_0100095 | Ga0495629_0100095_1148_1531 | 127 |
| 166 | 3300046557 | Ga0495622_0486329 | Ga0495622_0486329_42_425 | 127 |
| 167 | 3300048905 | Ga0496102_0867249 | Ga0496102_0867249_280_666 | 127 |
| 168 | 3300048908 | Ga0496105_1052018 | Ga0496105_1052018_67_450 | 127 |
| 169 | 3300048911 | Ga0496108_0408020 | Ga0496108_0408020_142_528 | 127 |
| 170 | 3300048913 | Ga0496110_0523998 | Ga0496110_0523998_553_939 | 127 |
| 171 | 3300049568 | Ga0501031_0091446 | Ga0501031_0091446_1454_1858 | 127 |
| 172 | 3300049569 | Ga0501032_0009502 | Ga0501032_0009502_704_1108 | 127 |
| 173 | 3300049569 | Ga0501032_0031839 | Ga0501032_0031839_621_1025 | 127 |
| 174 | 3300049569 | Ga0501032_0248821 | Ga0501032_0248821_197_580 | 127 |
| 175 | 3300049570 | Ga0501033_0033592 | Ga0501033_0033592_1051_1455 | 127 |
| 176 | 3300049570 | Ga0501033_0049833 | Ga0501033_0049833_559_963 | 127 |
| 177 | 3300049571 | Ga0501034_0024420 | Ga0501034_0024420_1820_2203 | 127 |
| 178 | 3300049572 | Ga0501036_0000454 | Ga0501036_0000454_21117_21500 | 127 |
| 179 | 3300049572 | Ga0501036_0009901 | Ga0501036_0009901_2713_3117 | 127 |
| 180 | 3300049572 | Ga0501036_1268010 | Ga0501036_1268010_147_551 | 127 |
| 181 | 3300049573 | Ga0501037_0076363 | Ga0501037_0076363_1805_2188 | 127 |
| 182 | 3300049574 | Ga0501038_0011561 | Ga0501038_0011561_344_727 | 127 |
| 183 | 3300049574 | Ga0501038_0068407 | Ga0501038_0068407_1334_1738 | 127 |
| 184 | 3300049574 | Ga0501038_0237377 | Ga0501038_0237377_666_1070 | 127 |
| 185 | 3300049575 | Ga0501039_0006345 | Ga0501039_0006345_1181_1585 | 127 |
| 186 | 3300049575 | Ga0501039_0671303 | Ga0501039_0671303_288_671 | 127 |
| 187 | 3300049579 | Ga0501043_0014702 | Ga0501043_0014702_2133_2537 | 127 |
| 188 | 3300049579 | Ga0501043_0016663 | Ga0501043_0016663_3314_3718 | 127 |
| 189 | 3300049579 | Ga0501043_0040679 | Ga0501043_0040679_1337_1720 | 127 |
| 190 | 3300049581 | Ga0501047_0019389 | Ga0501047_0019389_42_425 | 127 |
| 191 | 3300049582 | Ga0501048_0003843 | Ga0501048_0003843_5314_5697 | 127 |
| 192 | 3300049584 | Ga0501068_0254088 | Ga0501068_0254088_652_1056 | 127 |
| 193 | 3300049587 | Ga0501071_1335106 | Ga0501071_1335106_57_461 | 127 |
| 194 | 3300049589 | Ga0501073_0046979 | Ga0501073_0046979_152_535 | 127 |
| 195 | 3300049590 | Ga0501074_0435755 | Ga0501074_0435755_241_624 | 127 |
| 196 | 3300049592 | Ga0501076_0151000 | Ga0501076_0151000_1267_1650 | 127 |
| 197 | 3300049822 | Ga0501035_0001310 | Ga0501035_0001310_21196_21600 | 127 |
| 198 | 3300049822 | Ga0501035_0139717 | Ga0501035_0139717_109_513 | 127 |
| 199 | 3300049823 | Ga0501044_0003209 | Ga0501044_0003209_4117_4521 | 127 |
| 200 | 3300049823 | Ga0501044_0060775 | Ga0501044_0060775_2582_2986 | 127 |
| 201 | 3300049823 | Ga0501044_0087054 | Ga0501044_0087054_2469_2852 | 127 |
| 202 | 3300049823 | Ga0501044_0427260 | Ga0501044_0427260_481_864 | 127 |
| 203 | 3300049824 | Ga0501045_0012509 | Ga0501045_0012509_4714_5118 | 127 |
| 204 | 3300049824 | Ga0501045_1073920 | Ga0501045_1073920_98_481 | 127 |
| 205 | 3300050511 | nmdc:mga08y16_77681_c1 | nmdc:mga08y16_77681_c1_1220_1603 | 127 |
| 206 | 3300053140 | Ga0500573_0506523 | Ga0500573_0506523_79_474 | 127 |
| 207 | 3300053178 | Ga0500637_0388431 | Ga0500637_0388431_185_580 | 127 |
| 208 | 3300061719 | Ga0466962_0084592 | Ga0466962_0084592_975_1358 | 127 |
| 209 | 3300006846 | Ga0075430_100094075 | Ga0075430_1000940753 | 128 |
| 210 | 3300006847 | Ga0075431_100109912 | Ga0075431_1001099121 | 128 |
| 211 | 3300006880 | Ga0075429_100022104 | Ga0075429_1000221045 | 128 |
| 212 | 3300009147 | Ga0114129_10077576 | Ga0114129_100775763 | 128 |
| 213 | 3300050507 | nmdc:mga05p37_1236752_c1 | nmdc:mga05p37_1236752_c1_210_596 | 128 |
| 214 | 3300050508 | nmdc:mga09592_68898_c1 | nmdc:mga09592_68898_c1_2266_2652 | 128 |
| 215 | 3300050510 | nmdc:mga06r32_1305137_c1 | nmdc:mga06r32_1305137_c1_200_586 | 128 |
| 216 | 3300028381 | Ga0268264_11743811 | Ga0268264_117438111 | 129 |
| 217 | 3300005468 | Ga0070707_100063863 | Ga0070707_1000638634 | 130 |
| 218 | 3300009551 | Ga0105238_11008281 | Ga0105238_110082811 | 130 |
| 219 | 3300002076 | JGI24749J21850_1030774 | JGI24749J21850_10307741 | 131 |
| 220 | 3300005293 | Ga0065715_10289237 | Ga0065715_102892371 | 131 |
| 221 | 3300005293 | Ga0065715_10414783 | Ga0065715_104147832 | 131 |
| 222 | 3300005295 | Ga0065707_10098053 | Ga0065707_100980531 | 131 |
| 223 | 3300005333 | Ga0070677_10750055 | Ga0070677_107500551 | 131 |
| 224 | 3300005334 | Ga0068869_100640070 | Ga0068869_1006400702 | 131 |
| 225 | 3300005338 | Ga0068868_100443733 | Ga0068868_1004437331 | 131 |
| 226 | 3300005355 | Ga0070671_100241087 | Ga0070671_1002410871 | 131 |
| 227 | 3300005406 | Ga0070703_10079120 | Ga0070703_100791202 | 131 |
| 228 | 3300005438 | Ga0070701_10394215 | Ga0070701_103942152 | 131 |
| 229 | 3300005440 | Ga0070705_101790896 | Ga0070705_1017908961 | 131 |
| 230 | 3300005467 | Ga0070706_101417899 | Ga0070706_1014178991 | 131 |
| 231 | 3300005546 | Ga0070696_101311263 | Ga0070696_1013112631 | 131 |
| 232 | 3300005615 | Ga0070702_100230806 | Ga0070702_1002308061 | 131 |
| 233 | 3300005615 | Ga0070702_101602068 | Ga0070702_1016020681 | 131 |
| 234 | 3300005616 | Ga0068852_101757050 | Ga0068852_1017570501 | 131 |
| 235 | 3300005617 | Ga0068859_100292648 | Ga0068859_1002926481 | 131 |
| 236 | 3300005617 | Ga0068859_102335220 | Ga0068859_1023352201 | 131 |
| 237 | 3300005618 | Ga0068864_100541117 | Ga0068864_1005411171 | 131 |
| 238 | 3300005840 | Ga0068870_10270853 | Ga0068870_102708532 | 131 |
| 239 | 3300005841 | Ga0068863_100246342 | Ga0068863_1002463421 | 131 |
| 240 | 3300005985 | Ga0081539_10001813 | Ga0081539_1000181321 | 131 |
| 241 | 3300006237 | Ga0097621_100296171 | Ga0097621_1002961713 | 131 |
| 242 | 3300006358 | Ga0068871_100149220 | Ga0068871_1001492201 | 131 |
| 243 | 3300006931 | Ga0097620_100292635 | Ga0097620_1002926351 | 131 |
| 244 | 3300006931 | Ga0097620_102335415 | Ga0097620_1023354151 | 131 |
| 245 | 3300007265 | Ga0099794_10276644 | Ga0099794_102766442 | 131 |
| 246 | 3300009011 | Ga0105251_10524165 | Ga0105251_105241651 | 131 |
| 247 | 3300009177 | Ga0105248_10123218 | Ga0105248_101232182 | 131 |
| 248 | 3300009551 | Ga0105238_10016563 | Ga0105238_100165634 | 131 |
| 249 | 3300009553 | Ga0105249_10035159 | Ga0105249_100351593 | 131 |
| 250 | 3300013100 | Ga0157373_10083096 | Ga0157373_100830962 | 131 |
| 251 | 3300013308 | Ga0157375_12081754 | Ga0157375_120817541 | 131 |
| 252 | 3300017792 | Ga0163161_10077996 | Ga0163161_100779962 | 131 |
| 253 | 3300025885 | Ga0207653_10059690 | Ga0207653_100596902 | 131 |
| 254 | 3300025893 | Ga0207682_10546454 | Ga0207682_105464541 | 131 |
| 255 | 3300025908 | Ga0207643_10313568 | Ga0207643_103135682 | 131 |
| 256 | 3300025911 | Ga0207654_10707629 | Ga0207654_107076291 | 131 |
| 257 | 3300025924 | Ga0207694_10009026 | Ga0207694_100090263 | 131 |
| 258 | 3300025934 | Ga0207686_10000020 | Ga0207686_1000002099 | 131 |
| 259 | 3300025935 | Ga0207709_10000128 | Ga0207709_1000012845 | 131 |
| 260 | 3300025940 | Ga0207691_10508547 | Ga0207691_105085472 | 131 |
| 261 | 3300025961 | Ga0207712_10007349 | Ga0207712_100073494 | 131 |
| 262 | 3300026023 | Ga0207677_10046519 | Ga0207677_100465193 | 131 |
| 263 | 3300026088 | Ga0207641_10903345 | Ga0207641_109033452 | 131 |
| 264 | 3300026089 | Ga0207648_10082377 | Ga0207648_100823772 | 131 |
| 265 | 3300026089 | Ga0207648_10314070 | Ga0207648_103140701 | 131 |
| 266 | 3300026095 | Ga0207676_11460489 | Ga0207676_114604892 | 131 |
| 267 | 3300026116 | Ga0207674_11422940 | Ga0207674_114229401 | 131 |
| 268 | 3300026121 | Ga0207683_10569334 | Ga0207683_105693343 | 131 |
| 269 | 3300026142 | Ga0207698_10842059 | Ga0207698_108420592 | 131 |
| 270 | 3300035088 | Ga0373940_0078745 | Ga0373940_0078745_288_683 | 131 |
| 271 | 3300035092 | Ga0373952_0071640 | Ga0373952_0071640_456_851 | 131 |
| 272 | 3300035115 | Ga0373941_0469792 | Ga0373941_0469792_122_517 | 131 |
| 273 | 3300048915 | Ga0496112_0863363 | Ga0496112_0863363_269_664 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xrg-assembly1.cif.gz_A | conserved hypothetical protein from clostridium thermocellum cth-2968 | 0.9832 | 5 | 128 |
| 2csl-assembly1.cif.gz_B | crystal structure of ttha0137 from thermus thermophilus hb8 | 0.9804 | 7 | 130 |
| 3l7q-assembly2.cif.gz_E | crystal structure of aldr from streptococcus mutans | 0.9791 | 7 | 130 |
| 1jd1-assembly1.cif.gz_F | crystal structure of yeo7_yeast | 0.9778 | 5 | 130 |
| 3mqw-assembly2.cif.gz_F | crystal structure of a putative endoribonuclease l-psp from entamoeba histolytica with higher solvent content and an ordered n-terminal tag | 0.9767 | 6 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1jd1F00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9778 | 5 | 130 | 3.30.1330.40 |
| af_Q86KR5_2_129_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9775 | 5 | 130 | 3.30.1330.40 |
| 3m1xA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9717 | 5 | 129 | 3.30.1330.40 |
| 2dyyG00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9704 | 7 | 130 | 3.30.1330.40 |
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.9703 | 22 | 129 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1W9P7R1-F1-model_v4 | Reactive intermediate/imine deaminase | 0.9937 | 19 | 129 |
GO:0005829
GO:0019239 |
| AF-A0A321LJU5-F1-model_v4 | Reactive intermediate/imine deaminase | 0.9915 | 5 | 129 |
GO:0005829
GO:0019239 |
| AF-E0NRC8-F1-model_v4 | Putative endoribonuclease L-PSP | 0.9899 | 5 | 128 |
GO:0005829
GO:0019239 |
| AF-A0A8B1Z8Y9-F1-model_v4 | deleted | 0.9898 | 7 | 129 |
|
| AF-A0A650CY14-F1-model_v4 | Deaminase | 0.9886 | 5 | 129 |
GO:0005829
GO:0019239 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar