F378965

General Info

Members Datasets Scaffolds Average Seq Length
273 177 546 171

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100292814|Ga0075431_1002928143
Length 205
Sequence MLMFLRQLASVAILPFTVTVVIPLWIARRNRIAFLRPLDAPEIALVLTGLVLLGGGFLLFAACLYLFWTRGRGTLAPWDPPRRFVAAGPYRFVRNPMISGVILLLAGEACLFRSWPLAEWAALFALINLIYIPLVEEPSLAARFGDTYAEYLDSVPRFVPRLRPWTPDGLLEQSDPEPLRRDLHDLTRWRSHAGQRLQRRRRSGE

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.73
Nodule 0
Rhizoplane 5.49
Rhizosphere 93.77
Stem 0
Stem Tuber 0
Unclassified 28.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100292814 3300006847 Unclassified 1646
2 Ga0065715_10182770 3300005293 Bacteria 1465
3 Ga0070690_100000162 3300005330 Bacteria 33855
4 Ga0070690_100193475 3300005330 Bacteria 1411
5 Ga0068869_100571579 3300005334 Unclassified 952
6 Ga0070666_10566993 3300005335 Unclassified 827
7 Ga0068868_101072996 3300005338 Bacteria 740
8 Ga0070669_100078026 3300005353 Bacteria 2461
9 Ga0070669_100262565 3300005353 Unclassified 1378
10 Ga0070674_100008731 3300005356 Bacteria 6043
11 Ga0070674_101158719 3300005356 Unclassified 685
12 Ga0070673_100551999 3300005364 Unclassified 1047
13 Ga0070673_101027278 3300005364 Bacteria 768
14 Ga0070673_101703626 3300005364 Unclassified 596
15 Ga0070667_100083097 3300005367 Unclassified 2743
16 Ga0070667_100216035 3300005367 Bacteria 1705
17 Ga0070667_100455336 3300005367 Unclassified 1169
18 Ga0070703_10043053 3300005406 Bacteria 1414
19 Ga0070701_10017607 3300005438 Bacteria 3342
20 Ga0070705_100415433 3300005440 Unclassified 1000
21 Ga0070694_100841856 3300005444 Unclassified 754
22 Ga0070708_100000112 3300005445 Bacteria 53740
23 Ga0070662_100287419 3300005457 Bacteria 1332
24 Ga0070681_10252415 3300005458 Bacteria 1676
25 Ga0070681_11316741 3300005458 Unclassified 645
26 Ga0068867_100002064 3300005459 Bacteria 14078
27 Ga0068867_100088589 3300005459 Unclassified 2345
28 Ga0070685_10227685 3300005466 Bacteria 1224
29 Ga0070706_100016253 3300005467 Bacteria 6875
30 Ga0070706_100383888 3300005467 Bacteria 1308
31 Ga0070706_100431748 3300005467 Bacteria 1226
32 Ga0070706_101079612 3300005467 Bacteria 739
33 Ga0070707_100013275 3300005468 Bacteria 7706
34 Ga0070707_100034466 3300005468 Bacteria 4827
35 Ga0070707_100260335 3300005468 Bacteria 1688
36 Ga0070707_100312731 3300005468 Bacteria 1527
37 Ga0070698_100003761 3300005471 Bacteria 16679
38 Ga0070698_100071674 3300005471 Bacteria 3474
39 Ga0070698_100365338 3300005471 Unclassified 1375
40 Ga0070699_100000967 3300005518 Bacteria 26762
41 Ga0070699_100461656 3300005518 Bacteria 1152
42 Ga0070697_100119782 3300005536 Bacteria 2201
43 Ga0070672_100178271 3300005543 Bacteria 1770
44 Ga0070696_100857319 3300005546 Unclassified 751
45 Ga0070665_100004282 3300005548 Bacteria 14999
46 Ga0070704_100028306 3300005549 Bacteria 3726
47 Ga0070664_100031995 3300005564 Unclassified 4400
48 Ga0070664_100220409 3300005564 Bacteria 1697
49 Ga0070664_100386713 3300005564 Bacteria 1278
50 Ga0068856_100047837 3300005614 Unclassified 4214
51 Ga0068852_100100466 3300005616 Unclassified 2610
52 Ga0068859_100010737 3300005617 Bacteria 9217
53 Ga0068866_10062862 3300005718 Bacteria 1933
54 Ga0068861_100069519 3300005719 Bacteria 2724
55 Ga0068863_100346212 3300005841 Bacteria 1447
56 Ga0068858_100024165 3300005842 Bacteria 5663
57 Ga0068858_100131109 3300005842 Unclassified 2351
58 Ga0068858_100321198 3300005842 Bacteria 1480
59 Ga0068860_100204102 3300005843 Bacteria 1916
60 Ga0068862_100465140 3300005844 Unclassified 1194
61 Ga0068862_100709303 3300005844 Bacteria 975
62 Ga0070712_100323168 3300006175 Unclassified 1255
63 Ga0097621_100034907 3300006237 Unclassified 4015
64 Ga0097621_100809179 3300006237 Unclassified 869
65 Ga0068871_100020274 3300006358 Bacteria 5091
66 Ga0068871_100266493 3300006358 Unclassified 1495
67 Ga0068871_100452725 3300006358 Bacteria 1151
68 Ga0075428_100011278 3300006844 Bacteria 9942
69 Ga0075428_100734295 3300006844 Bacteria 1051
70 Ga0075430_100521424 3300006846 Bacteria 980
71 Ga0075431_100185529 3300006847 Unclassified 2133
72 Ga0075431_100329963 3300006847 Bacteria 1537
73 Ga0075431_100362649 3300006847 Bacteria 1455
74 Ga0075434_100018096 3300006871 Bacteria 6797
75 Ga0075434_100044975 3300006871 Bacteria 4379
76 Ga0075434_100257913 3300006871 Bacteria 1762
77 Ga0075434_100371284 3300006871 Bacteria 1451
78 Ga0075429_100283239 3300006880 Unclassified 1451
79 Ga0075429_100505296 3300006880 Bacteria 1059
80 Ga0068865_100049318 3300006881 Unclassified 2902
81 Ga0068865_101218739 3300006881 Unclassified 667
82 Ga0075436_100034932 3300006914 Unclassified 3468
83 Ga0097620_100010737 3300006931 Bacteria 9217
84 Ga0075435_100026049 3300007076 Bacteria 4559
85 Ga0075435_100079755 3300007076 Bacteria 2687
86 Ga0075435_100462282 3300007076 Unclassified 1095
87 Ga0075435_100479298 3300007076 Bacteria 1074
88 Ga0111539_10001690 3300009094 Bacteria 29436
89 Ga0105245_10484226 3300009098 Bacteria 1251
90 Ga0105247_10296755 3300009101 Unclassified 1120
91 Ga0114129_10000574 3300009147 Bacteria 45251
92 Ga0114129_10029467 3300009147 Bacteria 7775
93 Ga0114129_10158620 3300009147 Bacteria 3093
94 Ga0114129_10177337 3300009147 Bacteria 2902
95 Ga0114129_10245539 3300009147 Bacteria 2405
96 Ga0114129_11049185 3300009147 Bacteria 1023
97 Ga0105243_10036720 3300009148 Bacteria 3805
98 Ga0105243_10038634 3300009148 Bacteria 3718
99 Ga0105243_12079745 3300009148 Bacteria 603
100 Ga0105242_10022300 3300009176 Unclassified 4978
101 Ga0105242_10089753 3300009176 Bacteria 2584
102 Ga0105242_11392519 3300009176 Unclassified 728
103 Ga0105248_10088075 3300009177 Bacteria 3494
104 Ga0105248_10118167 3300009177 Unclassified 2990
105 Ga0105248_10742427 3300009177 Bacteria 1107
106 Ga0105249_10087803 3300009553 Bacteria 2903
107 Ga0105249_10631676 3300009553 Unclassified 1127
108 Ga0105239_10594724 3300010375 Bacteria 1262
109 Ga0157373_10099766 3300013100 Unclassified 2044
110 Ga0157374_10011948 3300013296 Bacteria 7537
111 Ga0157378_10022675 3300013297 Bacteria 5526
112 Ga0157378_10069651 3300013297 Bacteria 3156
113 Ga0163162_11163330 3300013306 Bacteria 875
114 Ga0163162_11274973 3300013306 Bacteria 835
115 Ga0157375_10022467 3300013308 Bacteria 5805
116 Ga0157375_10165624 3300013308 Unclassified 2355
117 Ga0157375_10861488 3300013308 Bacteria 1052
118 Ga0157379_10000276 3300014968 Bacteria 40502
119 Ga0157376_10014353 3300014969 Bacteria 5943
120 Ga0157376_10025104 3300014969 Bacteria 4690
121 Ga0163161_10002135 3300017792 Bacteria 14260
122 Ga0207642_10067801 3300025899 Unclassified 1686
123 Ga0207710_10333688 3300025900 Unclassified 770
124 Ga0207680_10003818 3300025903 Bacteria 7095
125 Ga0207684_10394585 3300025910 Bacteria 1190
126 Ga0207684_10860640 3300025910 Bacteria 764
127 Ga0207707_10972664 3300025912 Unclassified 698
128 Ga0207660_10072048 3300025917 Bacteria 2516
129 Ga0207646_10066081 3300025922 Bacteria 3228
130 Ga0207646_10204685 3300025922 Bacteria 1783
131 Ga0207646_11009327 3300025922 Unclassified 735
132 Ga0207681_10828687 3300025923 Unclassified 773
133 Ga0207706_10081710 3300025933 Bacteria 2840
134 Ga0207686_10129422 3300025934 Bacteria 1729
135 Ga0207709_10187885 3300025935 Unclassified 1465
136 Ga0207709_10448277 3300025935 Bacteria 997
137 Ga0207669_10846120 3300025937 Bacteria 761
138 Ga0207691_10144658 3300025940 Bacteria 2093
139 Ga0207711_10001697 3300025941 Bacteria 20277
140 Ga0207711_10042635 3300025941 Bacteria 3867
141 Ga0207711_10230177 3300025941 Unclassified 1697
142 Ga0207689_10768536 3300025942 Bacteria 813
143 Ga0207679_10294329 3300025945 Bacteria 1397
144 Ga0207651_11056028 3300025960 Bacteria 727
145 Ga0207658_10040353 3300025986 Unclassified 3374
146 Ga0207658_10240868 3300025986 Unclassified 1532
147 Ga0207677_10191065 3300026023 Bacteria 1620
148 Ga0207703_10011223 3300026035 Bacteria 6971
149 Ga0207703_10187448 3300026035 Unclassified 1830
150 Ga0207702_10991360 3300026078 Unclassified 833
151 Ga0207641_10132257 3300026088 Unclassified 2242
152 Ga0207648_10002005 3300026089 Bacteria 22222
153 Ga0207648_10121106 3300026089 Bacteria 2301
154 Ga0207676_10507574 3300026095 Bacteria 1146
155 Ga0207675_100098553 3300026118 Bacteria 2753
156 Ga0207675_100611320 3300026118 Bacteria 1094
157 Ga0207683_10532187 3300026121 Unclassified 1086
158 Ga0207698_10287109 3300026142 Unclassified 1525
159 Ga0207428_10000941 3300027907 Bacteria 32362
160 Ga0268266_10050204 3300028379 Bacteria 3579
161 Ga0268265_10731726 3300028380 Bacteria 959
162 Ga0268265_11575792 3300028380 Unclassified 661
163 Ga0268265_11955139 3300028380 Unclassified 593
164 Ga0268264_10061355 3300028381 Unclassified 3154
165 Ga0265318_10006873 3300028577 Bacteria 5194
166 Ga0265322_10089094 3300028654 Bacteria 876
167 Ga0265338_10009791 3300028800 Bacteria 11369
168 Ga0265320_10003343 3300031240 Bacteria 10815
169 Ga0265331_10339927 3300031250 Bacteria 672
170 Ga0265316_10106725 3300031344 Bacteria 2124
171 Ga0265313_10201203 3300031595 Bacteria 829
172 Ga0307416_100960613 3300032002 Bacteria 957
173 Ga0373947_0123942 3300035725 Bacteria 1644
174 Ga0395905_0550336 3300037471 Unclassified 1055
175 Ga0395905_1087289 3300037471 Unclassified 703
176 Ga0453684_0307886 3300044712 Bacteria 1799
177 Ga0495580_0643093 3300046472 Bacteria 698
178 Ga0495664_0080630 3300046477 Bacteria 1951
179 Ga0495618_0033780 3300046514 Unclassified 3208
180 Ga0495618_0554862 3300046514 Bacteria 687
181 Ga0495628_0528634 3300046516 Bacteria 849
182 Ga0495630_0687521 3300046517 Bacteria 783
183 Ga0495666_0230099 3300046526 Bacteria 847
184 Ga0495586_0133721 3300046535 Bacteria 1389
185 Ga0495634_0068594 3300046642 Bacteria 2342
186 Ga0495635_0129294 3300046663 Unclassified 1722
187 Ga0495657_0415263 3300046675 Unclassified 791
188 Ga0495647_0118200 3300046681 Bacteria 1113
189 Ga0495658_0546436 3300046683 Bacteria 742
190 Ga0495613_0151441 3300046689 Bacteria 1654
191 Ga0495674_0358794 3300047319 Bacteria 1182
192 Ga0495680_0763988 3300047322 Bacteria 634
193 Ga0496100_0531875 3300048903 Bacteria 908
194 Ga0496101_1103211 3300048904 Unclassified 623
195 Ga0496102_0509003 3300048905 Bacteria 1126
196 Ga0496105_0902367 3300048908 Unclassified 666
197 Ga0496106_0016708 3300048909 Bacteria 5429
198 Ga0496106_1459102 3300048909 Bacteria 527
199 Ga0496107_0027273 3300048910 Unclassified 4055
200 Ga0496108_0380368 3300048911 Unclassified 1233
201 Ga0496109_0118054 3300048912 Unclassified 2470
202 Ga0496109_0466576 3300048912 Unclassified 1192
203 Ga0496110_0127144 3300048913 Unclassified 2300
204 Ga0496111_0017113 3300048914 Bacteria 5006
205 Ga0496112_0186776 3300048915 Bacteria 2036
206 Ga0496113_0061268 3300048916 Unclassified 2839
207 Ga0496114_0050548 3300048917 Unclassified 3460
208 Ga0501031_0133886 3300049568 Bacteria 1619
209 Ga0501031_0300567 3300049568 Bacteria 1040
210 Ga0501031_0310859 3300049568 Bacteria 1021
211 Ga0501033_0453750 3300049570 Bacteria 890
212 Ga0501036_0057696 3300049572 Bacteria 3289
213 Ga0501038_0365057 3300049574 Bacteria 1122
214 Ga0501039_0107070 3300049575 Bacteria 2184
215 Ga0501040_0007311 3300049576 Bacteria 7157
216 Ga0501041_0040276 3300049577 Unclassified 2836
217 Ga0501041_0043856 3300049577 Bacteria 2719
218 Ga0501041_0050985 3300049577 Bacteria 2522
219 Ga0501042_0034514 3300049578 Bacteria 3588
220 Ga0501042_0280525 3300049578 Bacteria 1203
221 Ga0501046_0120618 3300049580 Bacteria 1995
222 Ga0501048_0859986 3300049582 Bacteria 652
223 Ga0501068_0134782 3300049584 Unclassified 1546
224 Ga0501069_0638906 3300049585 Bacteria 640
225 Ga0501071_0062023 3300049587 Bacteria 2708
226 Ga0501072_0067359 3300049588 Bacteria 2825
227 Ga0501074_0187878 3300049590 Bacteria 1473
228 Ga0501075_0332276 3300049591 Bacteria 1158
229 Ga0501076_0017413 3300049592 Bacteria 5461
230 Ga0501076_0038322 3300049592 Unclassified 3763
231 Ga0501076_0066329 3300049592 Bacteria 2881
232 Ga0501079_0061408 3300049741 Bacteria 2899
233 Ga0501079_0099952 3300049741 Unclassified 2249
234 Ga0501081_0090176 3300049743 Unclassified 2155
235 Ga0501081_0188231 3300049743 Bacteria 1494
236 Ga0501083_0634208 3300049744 Bacteria 695
237 Ga0501045_0037492 3300049824 Bacteria 3524
238 nmdc:mga0k408_367929_c1 3300050493 Unclassified 857
239 nmdc:mga04h51_12413_c2 3300050495 Bacteria 1867
240 nmdc:mga05p37_120958_c1 3300050507 Bacteria 3216
241 nmdc:mga05p37_137321_c1 3300050507 Bacteria 2997
242 nmdc:mga05p37_13987_c1 3300050507 Bacteria 9624
243 nmdc:mga05p37_569_c2 3300050507 Bacteria 24307
244 nmdc:mga09592_260568_c1 3300050508 Bacteria 1503
245 nmdc:mga0qj67_189220_c1 3300050509 Bacteria 1673
246 nmdc:mga06r32_185994_c1 3300050510 Unclassified 2064
247 nmdc:mga06r32_263201_c1 3300050510 Bacteria 1712
248 nmdc:mga06r32_265059_c1 3300050510 Unclassified 1705
249 nmdc:mga06r32_278586_c1 3300050510 Bacteria 1659
250 nmdc:mga06r32_392990_c1 3300050510 Bacteria 1369
251 nmdc:mga06r32_6124_c1 3300050510 Bacteria 10804
252 nmdc:mga08y16_5897_c1 3300050511 Bacteria 12841
253 nmdc:mga0n895_1018489_c1 3300050512 Bacteria 809
254 nmdc:mga0n895_33242_c1 3300050512 Bacteria 4956
255 nmdc:mga0n895_386247_c1 3300050512 Bacteria 1416
256 nmdc:mga0n895_568430_c1 3300050512 Bacteria 1139
257 nmdc:mga0rr50_195954_c1 3300050513 Bacteria 1658
258 nmdc:mga0rr50_291456_c1 3300050513 Bacteria 1364
259 nmdc:mga0rr50_34265_c1 3300050513 Bacteria 3635
260 nmdc:mga08x19_311264_c1 3300050514 Bacteria 1095
261 nmdc:mga0a205_118050_c1 3300050515 Bacteria 2551
262 nmdc:mga0a205_409128_c1 3300050515 Bacteria 1220
263 nmdc:mga0a205_41817_c1 3300050515 Bacteria 4415
264 nmdc:mga0a205_85175_c1 3300050515 Bacteria 3053
265 Ga0495601_0061530 3300053077 Bacteria 2383
266 Ga0495595_0010278 3300053084 Unclassified 3888
267 Ga0501084_0012361 3300054114 Bacteria 7073
268 Ga0590071_000004 3300059421 Bacteria 63957
269 Ga0590074_001990 3300059423 Bacteria 3342
270 Ga0590075_000294 3300059424 Bacteria 14088
271 Ga0590077_000015 3300059426 Bacteria 38773
272 Ga0501082_0104279 3300060353 Bacteria 2453
273 Ga0530510_0548947 3300061734 Bacteria 877
274 Ga0075431_100292814
275 Ga0065715_10182770
276 Ga0070690_100000162
277 Ga0070690_100193475
278 Ga0068869_100571579
279 Ga0070666_10566993
280 Ga0068868_101072996
281 Ga0070669_100078026
282 Ga0070669_100262565
283 Ga0070674_100008731
284 Ga0070674_101158719
285 Ga0070673_100551999
286 Ga0070673_101027278
287 Ga0070673_101703626
288 Ga0070667_100083097
289 Ga0070667_100216035
290 Ga0070667_100455336
291 Ga0070703_10043053
292 Ga0070701_10017607
293 Ga0070705_100415433
294 Ga0070694_100841856
295 Ga0070708_100000112
296 Ga0070662_100287419
297 Ga0070681_10252415
298 Ga0070681_11316741
299 Ga0068867_100002064
300 Ga0068867_100088589
301 Ga0070685_10227685
302 Ga0070706_100016253
303 Ga0070706_100383888
304 Ga0070706_100431748
305 Ga0070706_101079612
306 Ga0070707_100013275
307 Ga0070707_100034466
308 Ga0070707_100260335
309 Ga0070707_100312731
310 Ga0070698_100003761
311 Ga0070698_100071674
312 Ga0070698_100365338
313 Ga0070699_100000967
314 Ga0070699_100461656
315 Ga0070697_100119782
316 Ga0070672_100178271
317 Ga0070696_100857319
318 Ga0070665_100004282
319 Ga0070704_100028306
320 Ga0070664_100031995
321 Ga0070664_100220409
322 Ga0070664_100386713
323 Ga0068856_100047837
324 Ga0068852_100100466
325 Ga0068859_100010737
326 Ga0068866_10062862
327 Ga0068861_100069519
328 Ga0068863_100346212
329 Ga0068858_100024165
330 Ga0068858_100131109
331 Ga0068858_100321198
332 Ga0068860_100204102
333 Ga0068862_100465140
334 Ga0068862_100709303
335 Ga0070712_100323168
336 Ga0097621_100034907
337 Ga0097621_100809179
338 Ga0068871_100020274
339 Ga0068871_100266493
340 Ga0068871_100452725
341 Ga0075428_100011278
342 Ga0075428_100734295
343 Ga0075430_100521424
344 Ga0075431_100185529
345 Ga0075431_100329963
346 Ga0075431_100362649
347 Ga0075434_100018096
348 Ga0075434_100044975
349 Ga0075434_100257913
350 Ga0075434_100371284
351 Ga0075429_100283239
352 Ga0075429_100505296
353 Ga0068865_100049318
354 Ga0068865_101218739
355 Ga0075436_100034932
356 Ga0097620_100010737
357 Ga0075435_100026049
358 Ga0075435_100079755
359 Ga0075435_100462282
360 Ga0075435_100479298
361 Ga0111539_10001690
362 Ga0105245_10484226
363 Ga0105247_10296755
364 Ga0114129_10000574
365 Ga0114129_10029467
366 Ga0114129_10158620
367 Ga0114129_10177337
368 Ga0114129_10245539
369 Ga0114129_11049185
370 Ga0105243_10036720
371 Ga0105243_10038634
372 Ga0105243_12079745
373 Ga0105242_10022300
374 Ga0105242_10089753
375 Ga0105242_11392519
376 Ga0105248_10088075
377 Ga0105248_10118167
378 Ga0105248_10742427
379 Ga0105249_10087803
380 Ga0105249_10631676
381 Ga0105239_10594724
382 Ga0157373_10099766
383 Ga0157374_10011948
384 Ga0157378_10022675
385 Ga0157378_10069651
386 Ga0163162_11163330
387 Ga0163162_11274973
388 Ga0157375_10022467
389 Ga0157375_10165624
390 Ga0157375_10861488
391 Ga0157379_10000276
392 Ga0157376_10014353
393 Ga0157376_10025104
394 Ga0163161_10002135
395 Ga0207642_10067801
396 Ga0207710_10333688
397 Ga0207680_10003818
398 Ga0207684_10394585
399 Ga0207684_10860640
400 Ga0207707_10972664
401 Ga0207660_10072048
402 Ga0207646_10066081
403 Ga0207646_10204685
404 Ga0207646_11009327
405 Ga0207681_10828687
406 Ga0207706_10081710
407 Ga0207686_10129422
408 Ga0207709_10187885
409 Ga0207709_10448277
410 Ga0207669_10846120
411 Ga0207691_10144658
412 Ga0207711_10001697
413 Ga0207711_10042635
414 Ga0207711_10230177
415 Ga0207689_10768536
416 Ga0207679_10294329
417 Ga0207651_11056028
418 Ga0207658_10040353
419 Ga0207658_10240868
420 Ga0207677_10191065
421 Ga0207703_10011223
422 Ga0207703_10187448
423 Ga0207702_10991360
424 Ga0207641_10132257
425 Ga0207648_10002005
426 Ga0207648_10121106
427 Ga0207676_10507574
428 Ga0207675_100098553
429 Ga0207675_100611320
430 Ga0207683_10532187
431 Ga0207698_10287109
432 Ga0207428_10000941
433 Ga0268266_10050204
434 Ga0268265_10731726
435 Ga0268265_11575792
436 Ga0268265_11955139
437 Ga0268264_10061355
438 Ga0265318_10006873
439 Ga0265322_10089094
440 Ga0265338_10009791
441 Ga0265320_10003343
442 Ga0265331_10339927
443 Ga0265316_10106725
444 Ga0265313_10201203
445 Ga0307416_100960613
446 Ga0373947_0123942
447 Ga0395905_0550336
448 Ga0395905_1087289
449 Ga0453684_0307886
450 Ga0495580_0643093
451 Ga0495664_0080630
452 Ga0495618_0033780
453 Ga0495618_0554862
454 Ga0495628_0528634
455 Ga0495630_0687521
456 Ga0495666_0230099
457 Ga0495586_0133721
458 Ga0495634_0068594
459 Ga0495635_0129294
460 Ga0495657_0415263
461 Ga0495647_0118200
462 Ga0495658_0546436
463 Ga0495613_0151441
464 Ga0495674_0358794
465 Ga0495680_0763988
466 Ga0496100_0531875
467 Ga0496101_1103211
468 Ga0496102_0509003
469 Ga0496105_0902367
470 Ga0496106_0016708
471 Ga0496106_1459102
472 Ga0496107_0027273
473 Ga0496108_0380368
474 Ga0496109_0118054
475 Ga0496109_0466576
476 Ga0496110_0127144
477 Ga0496111_0017113
478 Ga0496112_0186776
479 Ga0496113_0061268
480 Ga0496114_0050548
481 Ga0501031_0133886
482 Ga0501031_0300567
483 Ga0501031_0310859
484 Ga0501033_0453750
485 Ga0501036_0057696
486 Ga0501038_0365057
487 Ga0501039_0107070
488 Ga0501040_0007311
489 Ga0501041_0040276
490 Ga0501041_0043856
491 Ga0501041_0050985
492 Ga0501042_0034514
493 Ga0501042_0280525
494 Ga0501046_0120618
495 Ga0501048_0859986
496 Ga0501068_0134782
497 Ga0501069_0638906
498 Ga0501071_0062023
499 Ga0501072_0067359
500 Ga0501074_0187878
501 Ga0501075_0332276
502 Ga0501076_0017413
503 Ga0501076_0038322
504 Ga0501076_0066329
505 Ga0501079_0061408
506 Ga0501079_0099952
507 Ga0501081_0090176
508 Ga0501081_0188231
509 Ga0501083_0634208
510 Ga0501045_0037492
511 nmdc:mga0k408_367929_c1
512 nmdc:mga04h51_12413_c2
513 nmdc:mga05p37_120958_c1
514 nmdc:mga05p37_137321_c1
515 nmdc:mga05p37_13987_c1
516 nmdc:mga05p37_569_c2
517 nmdc:mga09592_260568_c1
518 nmdc:mga0qj67_189220_c1
519 nmdc:mga06r32_185994_c1
520 nmdc:mga06r32_263201_c1
521 nmdc:mga06r32_265059_c1
522 nmdc:mga06r32_278586_c1
523 nmdc:mga06r32_392990_c1
524 nmdc:mga06r32_6124_c1
525 nmdc:mga08y16_5897_c1
526 nmdc:mga0n895_1018489_c1
527 nmdc:mga0n895_33242_c1
528 nmdc:mga0n895_386247_c1
529 nmdc:mga0n895_568430_c1
530 nmdc:mga0rr50_195954_c1
531 nmdc:mga0rr50_291456_c1
532 nmdc:mga0rr50_34265_c1
533 nmdc:mga08x19_311264_c1
534 nmdc:mga0a205_118050_c1
535 nmdc:mga0a205_409128_c1
536 nmdc:mga0a205_41817_c1
537 nmdc:mga0a205_85175_c1
538 Ga0495601_0061530
539 Ga0495595_0010278
540 Ga0501084_0012361
541 Ga0590071_000004
542 Ga0590074_001990
543 Ga0590075_000294
544 Ga0590077_000015
545 Ga0501082_0104279
546 Ga0530510_0548947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

43

147

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.6364 48 165
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.6021 14 163
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.587 13 164
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.5463 29 139
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.524 13 164
ID Description Score Start End Superfamily
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7739 31 163 1.20.120.1630
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7538 31 163 1.20.120.1630
af_P32584_46_239_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6605 18 163 1.20.120.1630
af_F8W397_103_231_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6585 20 130 1.20.120.550
af_I1KK99_84_262_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6519 19 162 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A7X9JDA8-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.87 10 165 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A7C4W1I3-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.8682 1 168 GO:0012505
GO:0016020
AF-A0A352EBC0-F1-model_v4 deleted 0.8647 2 163
AF-A0A3A4QVH8-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.8596 4 170 GO:0008168
GO:0012505
GO:0016020
GO:0032259
AF-A0A1F9CYF5-F1-model_v4 RemK protein 0.8593 5 171 GO:0012505
GO:0016020
GO:0016740

Map