F378926

General Info

Members Datasets Scaffolds Average Seq Length
273 143 273 253

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100045923|Ga0068857_1000459233
Length 306
Sequence MRAQFASWLFDERNSSCRVLTEAVRNFPQILSSKQRKLRFNLAIFAHLTLRFARFMAAIGRFQKGEEIFHAKVVDGEIFRLHGDVFGSPSFDKKPMKLKGVRTLTPVAPTKIIAVGLNYADHAREHNKPLPKEPLIWIKATTSLIADGARIEIPFPNHRTDFEAELCIVIGRRVRNVTPAAAARYIFGYTASQDISDRTIQNGESQWTRAKSFDTFTPLGPYVETKIDPHDLTIQLFQNGQLRQNSNTRELIFNCFNLVSFISTNMTLMPGDIILTGTPSGVGPIESGDRLEVRIQGLTPLVNTVK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
108 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 1.1
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 0.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10112510 3300003320 Bacteria 1595
2 Ga0065712_10137193 3300005290 Bacteria 1485
3 Ga0070658_10132432 3300005327 Bacteria 2078
4 Ga0070683_100182480 3300005329 Bacteria 1992
5 Ga0068869_100394888 3300005334 Bacteria 1136
6 Ga0070666_10052434 3300005335 Bacteria 2749
7 Ga0068868_100407889 3300005338 Bacteria 1174
8 Ga0070689_100004011 3300005340 Bacteria 9898
9 Ga0070689_100019664 3300005340 Bacteria 4995
10 Ga0070689_100378702 3300005340 Bacteria 1192
11 Ga0070688_100004346 3300005365 Bacteria 7370
12 Ga0070688_100173224 3300005365 Bacteria 1491
13 Ga0070714_100008016 3300005435 Bacteria 8233
14 Ga0070701_10189446 3300005438 Bacteria 1209
15 Ga0070694_100037116 3300005444 Bacteria 3231
16 Ga0070708_100179941 3300005445 Bacteria 1976
17 Ga0070685_10196645 3300005466 Bacteria 1308
18 Ga0070698_100169717 3300005471 Bacteria 2123
19 Ga0070679_100227962 3300005530 Bacteria 1823
20 Ga0070697_100197001 3300005536 Bacteria 1711
21 Ga0070686_100002002 3300005544 Bacteria 11301
22 Ga0070686_100192466 3300005544 Bacteria 1457
23 Ga0070686_100226643 3300005544 Bacteria 1353
24 Ga0070695_100104413 3300005545 Bacteria 1913
25 Ga0070693_100187268 3300005547 Bacteria 1336
26 Ga0070704_100024454 3300005549 Bacteria 3964
27 Ga0068855_100017562 3300005563 Bacteria 8603
28 Ga0068855_100029920 3300005563 Bacteria 6512
29 Ga0068857_100045923 3300005577 Bacteria 3876
30 Ga0068857_100581950 3300005577 Bacteria 1057
31 Ga0068856_100000089 3300005614 Bacteria 85631
32 Ga0068856_100087958 3300005614 Bacteria 3089
33 Ga0068859_100025727 3300005617 Bacteria 5902
34 Ga0068859_100055248 3300005617 Bacteria 3995
35 Ga0068859_100118585 3300005617 Bacteria 2712
36 Ga0068859_100542911 3300005617 Bacteria 1257
37 Ga0068859_100596957 3300005617 Bacteria 1197
38 Ga0068864_100124057 3300005618 Unclassified 2312
39 Ga0068863_100035208 3300005841 Bacteria 4769
40 Ga0068858_100649403 3300005842 Bacteria 1025
41 Ga0070715_10107263 3300006163 Bacteria 1312
42 Ga0097621_100044887 3300006237 Bacteria 3568
43 Ga0097621_100150656 3300006237 Bacteria 1994
44 Ga0097621_100192662 3300006237 Bacteria 1766
45 Ga0068871_100442405 3300006358 Bacteria 1164
46 Ga0075428_100003485 3300006844 Bacteria 17222
47 Ga0075428_100077876 3300006844 Bacteria 3619
48 Ga0075431_100046612 3300006847 Bacteria 4470
49 Ga0075431_100302136 3300006847 Bacteria 1617
50 Ga0075434_100187774 3300006871 Unclassified 2087
51 Ga0075429_100103294 3300006880 Bacteria 2489
52 Ga0075429_100366264 3300006880 Bacteria 1262
53 Ga0075429_100744625 3300006880 Bacteria 858
54 Ga0097620_100025727 3300006931 Bacteria 5902
55 Ga0097620_100055247 3300006931 Bacteria 3995
56 Ga0097620_100118584 3300006931 Bacteria 2712
57 Ga0097620_100542820 3300006931 Bacteria 1257
58 Ga0097620_100597054 3300006931 Bacteria 1197
59 Ga0099795_10111137 3300007788 Bacteria 1086
60 Ga0105240_10010896 3300009093 Bacteria 12737
61 Ga0105240_10044346 3300009093 Bacteria 5651
62 Ga0105240_10049746 3300009093 Bacteria 5288
63 Ga0105240_10068831 3300009093 Bacteria 4384
64 Ga0105240_10715193 3300009093 Unclassified 1092
65 Ga0111539_10020910 3300009094 Bacteria 8058
66 Ga0111539_10125391 3300009094 Bacteria 3009
67 Ga0111539_10238829 3300009094 Bacteria 2115
68 Ga0105242_10023233 3300009176 Bacteria 4888
69 Ga0105242_10224815 3300009176 Bacteria 1679
70 Ga0105242_10420888 3300009176 Bacteria 1252
71 Ga0105242_10604576 3300009176 Unclassified 1060
72 Ga0105248_10209538 3300009177 Bacteria 2196
73 Ga0105248_10968421 3300009177 Bacteria 961
74 Ga0105248_11254488 3300009177 Bacteria 838
75 Ga0105238_10007000 3300009551 Bacteria 11277
76 Ga0105238_10408466 3300009551 Unclassified 1351
77 Ga0105249_10040950 3300009553 Bacteria 4209
78 Ga0105249_10574310 3300009553 Bacteria 1180
79 Ga0105246_10516163 3300011119 Bacteria 1017
80 Ga0157371_10024466 3300013102 Bacteria 4409
81 Ga0157370_10020125 3300013104 Bacteria 6672
82 Ga0157370_10023195 3300013104 Bacteria 6166
83 Ga0157374_10113372 3300013296 Bacteria 2610
84 Ga0157374_10716350 3300013296 Bacteria 1014
85 Ga0157378_10555652 3300013297 Bacteria 1154
86 Ga0163162_10624761 3300013306 Bacteria 1202
87 Ga0157372_11345696 3300013307 Bacteria 824
88 Ga0157375_10000094 3300013308 Bacteria 88991
89 Ga0163163_10000146 3300014325 Bacteria 73162
90 Ga0163163_10055996 3300014325 Bacteria 3897
91 Ga0163163_10102988 3300014325 Bacteria 2879
92 Ga0163163_10648488 3300014325 Bacteria 1119
93 Ga0207680_10019787 3300025903 Unclassified 3608
94 Ga0207707_10238414 3300025912 Bacteria 1582
95 Ga0207695_10028905 3300025913 Bacteria 6136
96 Ga0207695_10033908 3300025913 Bacteria 5558
97 Ga0207695_10050236 3300025913 Bacteria 4388
98 Ga0207695_10058381 3300025913 Bacteria 4005
99 Ga0207695_10372672 3300025913 Bacteria 1314
100 Ga0207663_10003619 3300025916 Bacteria 7586
101 Ga0207646_10408008 3300025922 Bacteria 1227
102 Ga0207694_10004360 3300025924 Bacteria 11055
103 Ga0207694_10024168 3300025924 Bacteria 4614
104 Ga0207664_10002039 3300025929 Bacteria 13314
105 Ga0207686_10072641 3300025934 Bacteria 2218
106 Ga0207670_10006754 3300025936 Bacteria 6379
107 Ga0207670_10047636 3300025936 Bacteria 2856
108 Ga0207670_10293928 3300025936 Bacteria 1270
109 Ga0207711_10117655 3300025941 Bacteria 2370
110 Ga0207661_10145972 3300025944 Bacteria 2041
111 Ga0207667_10032781 3300025949 Bacteria 5593
112 Ga0207667_10076898 3300025949 Bacteria 3463
113 Ga0207667_10203344 3300025949 Bacteria 2031
114 Ga0207667_10238697 3300025949 Bacteria 1860
115 Ga0207712_10037762 3300025961 Unclassified 3297
116 Ga0207708_10440665 3300026075 Bacteria 1083
117 Ga0207702_10008282 3300026078 Bacteria 8786
118 Ga0207702_10064499 3300026078 Bacteria 3135
119 Ga0207641_10043717 3300026088 Bacteria 3764
120 Ga0207641_10114949 3300026088 Unclassified 2392
121 Ga0207641_10327713 3300026088 Unclassified 1454
122 Ga0207648_10497451 3300026089 Bacteria 1115
123 Ga0207676_10114551 3300026095 Bacteria 2262
124 Ga0207676_10210715 3300026095 Bacteria 1724
125 Ga0207674_10182022 3300026116 Bacteria 2053
126 Ga0207428_10344541 3300027907 Bacteria 1097
127 Ga0265337_1000306 3300028556 Bacteria 26055
128 Ga0265337_1000696 3300028556 Bacteria 17765
129 Ga0265337_1014587 3300028556 Bacteria 2601
130 Ga0265337_1019435 3300028556 Bacteria 2140
131 Ga0265337_1076145 3300028556 Bacteria 920
132 Ga0265319_1038037 3300028563 Bacteria 1637
133 Ga0265334_10005400 3300028573 Bacteria 5583
134 Ga0265334_10010075 3300028573 Bacteria 3992
135 Ga0265323_10033850 3300028653 Bacteria 1890
136 Ga0265323_10050728 3300028653 Bacteria 1474
137 Ga0265322_10016608 3300028654 Bacteria 2124
138 Ga0265336_10001474 3300028666 Bacteria 10688
139 Ga0265336_10012221 3300028666 Bacteria 2892
140 Ga0265336_10017494 3300028666 Bacteria 2334
141 Ga0265336_10022408 3300028666 Bacteria 2011
142 Ga0265338_10000316 3300028800 Bacteria 87532
143 Ga0265338_10000652 3300028800 Bacteria 59926
144 Ga0265338_10001539 3300028800 Bacteria 37247
145 Ga0265338_10001655 3300028800 Bacteria 35519
146 Ga0265338_10003126 3300028800 Bacteria 23657
147 Ga0265338_10004029 3300028800 Bacteria 20160
148 Ga0265338_10005963 3300028800 Bacteria 15672
149 Ga0265338_10006581 3300028800 Bacteria 14739
150 Ga0265338_10007186 3300028800 Bacteria 13926
151 Ga0265338_10008174 3300028800 Bacteria 12757
152 Ga0265338_10019562 3300028800 Bacteria 7175
153 Ga0265338_10027237 3300028800 Bacteria 5738
154 Ga0265338_10041537 3300028800 Bacteria 4300
155 Ga0265338_10049686 3300028800 Bacteria 3798
156 Ga0265338_10060800 3300028800 Bacteria 3315
157 Ga0265328_10060368 3300031239 Bacteria 1392
158 Ga0265320_10000443 3300031240 Bacteria 32427
159 Ga0265320_10001509 3300031240 Bacteria 16953
160 Ga0265325_10010711 3300031241 Bacteria 5291
161 Ga0265325_10036200 3300031241 Bacteria 2617
162 Ga0265325_10037896 3300031241 Bacteria 2546
163 Ga0265329_10005790 3300031242 Bacteria 4963
164 Ga0265340_10011223 3300031247 Bacteria 4770
165 Ga0265339_10012066 3300031249 Bacteria 5295
166 Ga0265331_10028254 3300031250 Bacteria 2807
167 Ga0265327_10013976 3300031251 Bacteria 5288
168 Ga0265316_10010418 3300031344 Bacteria 8472
169 Ga0265316_10016526 3300031344 Bacteria 6395
170 Ga0265316_10075305 3300031344 Bacteria 2596
171 Ga0265316_10111844 3300031344 Bacteria 2068
172 Ga0265316_10243543 3300031344 Bacteria 1322
173 Ga0307408_100067062 3300031548 Bacteria 2638
174 Ga0265313_10047733 3300031595 Bacteria 2070
175 Ga0265314_10000034 3300031711 Bacteria 241556
176 Ga0265314_10009065 3300031711 Bacteria 8451
177 Ga0265314_10085746 3300031711 Bacteria 2064
178 Ga0265342_10056766 3300031712 Bacteria 2320
179 Ga0265342_10071103 3300031712 Bacteria 2028
180 Ga0307416_100233281 3300032002 Bacteria 1776
181 Ga0373926_0012370 3300035083 Bacteria 2884
182 Ga0373945_0036174 3300035116 Bacteria 1768
183 Ga0373954_0050513 3300035118 Bacteria 1951
184 Ga0373956_0015804 3300035119 Bacteria 3165
185 Ga0373955_0264516 3300035172 Bacteria 1033
186 Ga0373931_0007696 3300035691 Bacteria 5086
187 Ga0373935_0001668 3300035692 Bacteria 12411
188 Ga0373927_0001335 3300035695 Bacteria 18606
189 Ga0373927_0007902 3300035695 Bacteria 7188
190 Ga0373927_0022469 3300035695 Bacteria 4133
191 Ga0373947_0008336 3300035725 Bacteria 5969
192 Ga0373937_0001076 3300036401 Bacteria 23037
193 Ga0373925_0003238 3300037068 Bacteria 12714
194 Ga0373925_0004397 3300037068 Bacteria 10646
195 Ga0373925_0374397 3300037068 Bacteria 1159
196 Ga0373925_0492028 3300037068 Unclassified 1007
197 Ga0395900_0203142 3300037418 Bacteria 2004
198 Ga0395905_0023591 3300037471 Bacteria 5812
199 Ga0451798_0522234 3300041458 Bacteria 2113
200 Ga0451577_0001024 3300042876 Bacteria 40578
201 Ga0451577_0036640 3300042876 Bacteria 4415
202 Ga0451577_0052608 3300042876 Bacteria 3636
203 Ga0451577_0168821 3300042876 Bacteria 1971
204 Ga0451577_0424247 3300042876 Bacteria 1208
205 Ga0451577_0809049 3300042876 Unclassified 846
206 Ga0453683_0442931 3300044673 Unclassified 840
207 Ga0453684_0001435 3300044712 Bacteria 68004
208 Ga0453684_0002872 3300044712 Bacteria 40404
209 Ga0453684_0022095 3300044712 Bacteria 9461
210 Ga0453684_0127420 3300044712 Bacteria 3061
211 Ga0453684_0531067 3300044712 Bacteria 1298
212 Ga0453684_0948241 3300044712 Bacteria 918
213 Ga0451576_0014329 3300045051 Bacteria 8832
214 Ga0451576_0017944 3300045051 Bacteria 7768
215 Ga0451576_0048454 3300045051 Bacteria 4463
216 Ga0451576_0103993 3300045051 Bacteria 2954
217 Ga0451576_0124823 3300045051 Bacteria 2682
218 Ga0451576_0125786 3300045051 Unclassified 2671
219 Ga0451576_0162475 3300045051 Bacteria 2331
220 Ga0451576_0301985 3300045051 Bacteria 1675
221 Ga0451576_0902912 3300045051 Bacteria 927
222 Ga0495592_0000042 3300046454 Bacteria 123381
223 Ga0495641_0062773 3300046461 Unclassified 1675
224 Ga0495651_0119220 3300046462 Bacteria 1941
225 Ga0495662_0039250 3300046476 Bacteria 2287
226 Ga0495618_0008471 3300046514 Bacteria 6218
227 Ga0495618_0054808 3300046514 Bacteria 2524
228 Ga0495628_0000561 3300046516 Bacteria 34109
229 Ga0495628_0325867 3300046516 Bacteria 1133
230 Ga0495630_0000136 3300046517 Bacteria 57957
231 Ga0495630_0007108 3300046517 Bacteria 7974
232 Ga0495630_0009876 3300046517 Bacteria 6875
233 Ga0495630_0035801 3300046517 Bacteria 3710
234 Ga0495630_0045637 3300046517 Bacteria 3275
235 Ga0495630_0207486 3300046517 Unclassified 1495
236 Ga0495630_0259020 3300046517 Bacteria 1329
237 Ga0495630_0546611 3300046517 Bacteria 888
238 Ga0495666_0009747 3300046526 Bacteria 4800
239 Ga0495666_0051442 3300046526 Bacteria 1979
240 Ga0495640_0124598 3300046533 Bacteria 1672
241 Ga0495640_0163858 3300046533 Bacteria 1423
242 Ga0495640_0287861 3300046533 Bacteria 1022
243 Ga0495586_0000018 3300046535 Bacteria 112658
244 Ga0495586_0005304 3300046535 Bacteria 6898
245 Ga0495586_0009403 3300046535 Bacteria 5202
246 Ga0495586_0081379 3300046535 Bacteria 1779
247 Ga0495645_0031172 3300046543 Bacteria 3884
248 Ga0495622_0021003 3300046557 Bacteria 3041
249 Ga0495667_0052384 3300046559 Bacteria 2689
250 Ga0495635_0061876 3300046663 Bacteria 2570
251 Ga0495599_0003987 3300046678 Bacteria 8698
252 Ga0495599_0036656 3300046678 Bacteria 3081
253 Ga0495599_0057557 3300046678 Bacteria 2433
254 Ga0495658_0144754 3300046683 Bacteria 1456
255 Ga0495613_0000934 3300046689 Bacteria 22388
256 Ga0495624_0032609 3300046690 Bacteria 3377
257 Ga0495674_0008801 3300047319 Bacteria 9603
258 Ga0495676_0002387 3300047321 Bacteria 16673
259 Ga0495680_0001479 3300047322 Bacteria 25335
260 Ga0495675_0090113 3300047444 Bacteria 1925
261 Ga0496107_0012694 3300048910 Bacteria 5884
262 Ga0496115_0016224 3300048918 Bacteria 5668
263 Ga0501033_0101773 3300049570 Bacteria 2096
264 Ga0501033_0348125 3300049570 Unclassified 1038
265 Ga0501047_0177088 3300049581 Bacteria 2000
266 Ga0501035_0170070 3300049822 Bacteria 1883
267 Ga0501044_0588435 3300049823 Bacteria 1007
268 nmdc:mga09592_250090_c1 3300050508 Bacteria 1536
269 nmdc:mga06r32_694904_c1 3300050510 Bacteria 983
270 nmdc:mga08y16_102371_c1 3300050511 Bacteria 2981
271 nmdc:mga08y16_233772_c1 3300050511 Bacteria 1901
272 nmdc:mga08y16_582211_c1 3300050511 Bacteria 1130
273 Ga0500650_0022313 3300053098 Bacteria 2800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10112510 rootH2_101125102 251
2 3300005290 Ga0065712_10137193 Ga0065712_101371932 251
3 3300005327 Ga0070658_10132432 Ga0070658_101324322 251
4 3300005329 Ga0070683_100182480 Ga0070683_1001824802 251
5 3300005334 Ga0068869_100394888 Ga0068869_1003948882 251
6 3300005335 Ga0070666_10052434 Ga0070666_100524342 251
7 3300005338 Ga0068868_100407889 Ga0068868_1004078892 251
8 3300005340 Ga0070689_100004011 Ga0070689_1000040115 251
9 3300005340 Ga0070689_100019664 Ga0070689_1000196645 251
10 3300005340 Ga0070689_100378702 Ga0070689_1003787021 251
11 3300005365 Ga0070688_100004346 Ga0070688_1000043462 251
12 3300005365 Ga0070688_100173224 Ga0070688_1001732242 251
13 3300005435 Ga0070714_100008016 Ga0070714_1000080166 251
14 3300005438 Ga0070701_10189446 Ga0070701_101894462 251
15 3300005444 Ga0070694_100037116 Ga0070694_1000371162 251
16 3300005445 Ga0070708_100179941 Ga0070708_1001799412 251
17 3300005466 Ga0070685_10196645 Ga0070685_101966452 251
18 3300005471 Ga0070698_100169717 Ga0070698_1001697172 251
19 3300005530 Ga0070679_100227962 Ga0070679_1002279622 251
20 3300005536 Ga0070697_100197001 Ga0070697_1001970012 251
21 3300005544 Ga0070686_100002002 Ga0070686_1000020029 251
22 3300005544 Ga0070686_100192466 Ga0070686_1001924662 251
23 3300005544 Ga0070686_100226643 Ga0070686_1002266432 251
24 3300005545 Ga0070695_100104413 Ga0070695_1001044132 251
25 3300005547 Ga0070693_100187268 Ga0070693_1001872681 251
26 3300005549 Ga0070704_100024454 Ga0070704_1000244542 251
27 3300005563 Ga0068855_100017562 Ga0068855_1000175624 251
28 3300005563 Ga0068855_100029920 Ga0068855_1000299202 251
29 3300005577 Ga0068857_100045923 Ga0068857_1000459233 251
30 3300005577 Ga0068857_100581950 Ga0068857_1005819501 251
31 3300005614 Ga0068856_100000089 Ga0068856_10000008963 251
32 3300005614 Ga0068856_100087958 Ga0068856_1000879582 251
33 3300005617 Ga0068859_100025727 Ga0068859_1000257272 251
34 3300005617 Ga0068859_100055248 Ga0068859_1000552482 251
35 3300005617 Ga0068859_100118585 Ga0068859_1001185854 251
36 3300005617 Ga0068859_100542911 Ga0068859_1005429111 251
37 3300005617 Ga0068859_100596957 Ga0068859_1005969571 251
38 3300005618 Ga0068864_100124057 Ga0068864_1001240572 251
39 3300005841 Ga0068863_100035208 Ga0068863_1000352082 251
40 3300005842 Ga0068858_100649403 Ga0068858_1006494032 251
41 3300006163 Ga0070715_10107263 Ga0070715_101072632 251
42 3300006237 Ga0097621_100044887 Ga0097621_1000448873 251
43 3300006237 Ga0097621_100150656 Ga0097621_1001506563 251
44 3300006237 Ga0097621_100192662 Ga0097621_1001926622 251
45 3300006358 Ga0068871_100442405 Ga0068871_1004424052 251
46 3300006844 Ga0075428_100003485 Ga0075428_1000034857 251
47 3300006844 Ga0075428_100077876 Ga0075428_1000778762 251
48 3300006847 Ga0075431_100046612 Ga0075431_1000466122 251
49 3300006847 Ga0075431_100302136 Ga0075431_1003021362 251
50 3300006871 Ga0075434_100187774 Ga0075434_1001877742 251
51 3300006880 Ga0075429_100103294 Ga0075429_1001032942 251
52 3300006880 Ga0075429_100366264 Ga0075429_1003662641 251
53 3300006880 Ga0075429_100744625 Ga0075429_1007446251 251
54 3300006931 Ga0097620_100025727 Ga0097620_1000257272 251
55 3300006931 Ga0097620_100055247 Ga0097620_1000552472 251
56 3300006931 Ga0097620_100118584 Ga0097620_1001185844 251
57 3300006931 Ga0097620_100542820 Ga0097620_1005428202 251
58 3300006931 Ga0097620_100597054 Ga0097620_1005970541 251
59 3300007788 Ga0099795_10111137 Ga0099795_101111371 251
60 3300009093 Ga0105240_10010896 Ga0105240_100108967 251
61 3300009093 Ga0105240_10044346 Ga0105240_100443463 251
62 3300009093 Ga0105240_10049746 Ga0105240_100497463 251
63 3300009093 Ga0105240_10068831 Ga0105240_100688313 251
64 3300009093 Ga0105240_10715193 Ga0105240_107151932 251
65 3300009094 Ga0111539_10020910 Ga0111539_100209102 251
66 3300009094 Ga0111539_10125391 Ga0111539_101253913 251
67 3300009094 Ga0111539_10238829 Ga0111539_102388291 251
68 3300009176 Ga0105242_10023233 Ga0105242_100232332 251
69 3300009176 Ga0105242_10224815 Ga0105242_102248152 251
70 3300009176 Ga0105242_10420888 Ga0105242_104208882 251
71 3300009176 Ga0105242_10604576 Ga0105242_106045761 251
72 3300009177 Ga0105248_10209538 Ga0105248_102095382 251
73 3300009177 Ga0105248_10968421 Ga0105248_109684211 251
74 3300009177 Ga0105248_11254488 Ga0105248_112544881 251
75 3300009551 Ga0105238_10007000 Ga0105238_100070008 251
76 3300009551 Ga0105238_10408466 Ga0105238_104084661 251
77 3300009553 Ga0105249_10040950 Ga0105249_100409502 251
78 3300009553 Ga0105249_10574310 Ga0105249_105743101 251
79 3300011119 Ga0105246_10516163 Ga0105246_105161631 251
80 3300013102 Ga0157371_10024466 Ga0157371_100244664 251
81 3300013104 Ga0157370_10020125 Ga0157370_100201256 251
82 3300013104 Ga0157370_10023195 Ga0157370_100231953 251
83 3300013296 Ga0157374_10113372 Ga0157374_101133723 251
84 3300013296 Ga0157374_10716350 Ga0157374_107163502 251
85 3300013297 Ga0157378_10555652 Ga0157378_105556521 251
86 3300013306 Ga0163162_10624761 Ga0163162_106247612 251
87 3300013307 Ga0157372_11345696 Ga0157372_113456961 251
88 3300013308 Ga0157375_10000094 Ga0157375_1000009416 251
89 3300014325 Ga0163163_10000146 Ga0163163_1000014615 251
90 3300014325 Ga0163163_10055996 Ga0163163_100559963 251
91 3300014325 Ga0163163_10102988 Ga0163163_101029882 251
92 3300014325 Ga0163163_10648488 Ga0163163_106484881 251
93 3300025903 Ga0207680_10019787 Ga0207680_100197872 251
94 3300025912 Ga0207707_10238414 Ga0207707_102384142 251
95 3300025913 Ga0207695_10028905 Ga0207695_100289054 251
96 3300025913 Ga0207695_10033908 Ga0207695_100339083 251
97 3300025913 Ga0207695_10050236 Ga0207695_100502362 251
98 3300025913 Ga0207695_10058381 Ga0207695_100583812 251
99 3300025913 Ga0207695_10372672 Ga0207695_103726722 251
100 3300025916 Ga0207663_10003619 Ga0207663_100036195 251
101 3300025922 Ga0207646_10408008 Ga0207646_104080081 251
102 3300025924 Ga0207694_10004360 Ga0207694_100043603 251
103 3300025924 Ga0207694_10024168 Ga0207694_100241685 251
104 3300025929 Ga0207664_10002039 Ga0207664_100020397 251
105 3300025934 Ga0207686_10072641 Ga0207686_100726412 251
106 3300025936 Ga0207670_10006754 Ga0207670_100067544 251
107 3300025936 Ga0207670_10047636 Ga0207670_100476362 251
108 3300025936 Ga0207670_10293928 Ga0207670_102939281 251
109 3300025941 Ga0207711_10117655 Ga0207711_101176552 251
110 3300025944 Ga0207661_10145972 Ga0207661_101459722 251
111 3300025949 Ga0207667_10032781 Ga0207667_100327814 251
112 3300025949 Ga0207667_10076898 Ga0207667_100768983 251
113 3300025949 Ga0207667_10203344 Ga0207667_102033442 251
114 3300025949 Ga0207667_10238697 Ga0207667_102386973 251
115 3300025961 Ga0207712_10037762 Ga0207712_100377623 251
116 3300026075 Ga0207708_10440665 Ga0207708_104406652 251
117 3300026078 Ga0207702_10008282 Ga0207702_1000828211 251
118 3300026078 Ga0207702_10064499 Ga0207702_100644993 251
119 3300026088 Ga0207641_10043717 Ga0207641_100437172 251
120 3300026088 Ga0207641_10114949 Ga0207641_101149492 251
121 3300026088 Ga0207641_10327713 Ga0207641_103277132 251
122 3300026089 Ga0207648_10497451 Ga0207648_104974511 251
123 3300026095 Ga0207676_10114551 Ga0207676_101145512 251
124 3300026095 Ga0207676_10210715 Ga0207676_102107152 251
125 3300026116 Ga0207674_10182022 Ga0207674_101820221 251
126 3300027907 Ga0207428_10344541 Ga0207428_103445412 251
127 3300028556 Ga0265337_1000306 Ga0265337_100030619 251
128 3300028556 Ga0265337_1000696 Ga0265337_10006963 251
129 3300028556 Ga0265337_1014587 Ga0265337_10145873 251
130 3300028556 Ga0265337_1019435 Ga0265337_10194352 251
131 3300028556 Ga0265337_1076145 Ga0265337_10761451 251
132 3300028563 Ga0265319_1038037 Ga0265319_10380372 251
133 3300028573 Ga0265334_10005400 Ga0265334_100054006 251
134 3300028573 Ga0265334_10010075 Ga0265334_100100752 251
135 3300028653 Ga0265323_10033850 Ga0265323_100338504 251
136 3300028653 Ga0265323_10050728 Ga0265323_100507282 251
137 3300028654 Ga0265322_10016608 Ga0265322_100166083 251
138 3300028666 Ga0265336_10001474 Ga0265336_100014745 251
139 3300028666 Ga0265336_10012221 Ga0265336_100122212 251
140 3300028666 Ga0265336_10017494 Ga0265336_100174942 251
141 3300028666 Ga0265336_10022408 Ga0265336_100224081 251
142 3300028800 Ga0265338_10000316 Ga0265338_100003167 251
143 3300028800 Ga0265338_10000652 Ga0265338_100006528 251
144 3300028800 Ga0265338_10001539 Ga0265338_100015396 251
145 3300028800 Ga0265338_10001655 Ga0265338_1000165524 251
146 3300028800 Ga0265338_10003126 Ga0265338_1000312620 251
147 3300028800 Ga0265338_10004029 Ga0265338_1000402912 251
148 3300028800 Ga0265338_10005963 Ga0265338_100059633 251
149 3300028800 Ga0265338_10006581 Ga0265338_1000658113 251
150 3300028800 Ga0265338_10007186 Ga0265338_100071861 251
151 3300028800 Ga0265338_10008174 Ga0265338_1000817410 251
152 3300028800 Ga0265338_10019562 Ga0265338_100195622 251
153 3300028800 Ga0265338_10027237 Ga0265338_100272372 251
154 3300028800 Ga0265338_10041537 Ga0265338_100415375 251
155 3300028800 Ga0265338_10049686 Ga0265338_100496863 251
156 3300028800 Ga0265338_10060800 Ga0265338_100608002 251
157 3300031239 Ga0265328_10060368 Ga0265328_100603682 251
158 3300031240 Ga0265320_10000443 Ga0265320_100004439 251
159 3300031240 Ga0265320_10001509 Ga0265320_100015096 251
160 3300031241 Ga0265325_10010711 Ga0265325_100107112 251
161 3300031241 Ga0265325_10036200 Ga0265325_100362002 251
162 3300031241 Ga0265325_10037896 Ga0265325_100378963 251
163 3300031242 Ga0265329_10005790 Ga0265329_100057902 251
164 3300031247 Ga0265340_10011223 Ga0265340_100112237 251
165 3300031249 Ga0265339_10012066 Ga0265339_100120663 251
166 3300031250 Ga0265331_10028254 Ga0265331_100282543 251
167 3300031251 Ga0265327_10013976 Ga0265327_100139764 251
168 3300031344 Ga0265316_10010418 Ga0265316_100104183 251
169 3300031344 Ga0265316_10016526 Ga0265316_100165261 251
170 3300031344 Ga0265316_10075305 Ga0265316_100753053 251
171 3300031344 Ga0265316_10111844 Ga0265316_101118442 251
172 3300031344 Ga0265316_10243543 Ga0265316_102435432 251
173 3300031548 Ga0307408_100067062 Ga0307408_1000670624 251
174 3300031595 Ga0265313_10047733 Ga0265313_100477332 251
175 3300031711 Ga0265314_10000034 Ga0265314_10000034158 251
176 3300031711 Ga0265314_10009065 Ga0265314_100090654 251
177 3300031711 Ga0265314_10085746 Ga0265314_100857463 251
178 3300031712 Ga0265342_10056766 Ga0265342_100567663 251
179 3300031712 Ga0265342_10071103 Ga0265342_100711033 251
180 3300032002 Ga0307416_100233281 Ga0307416_1002332812 251
181 3300035083 Ga0373926_0012370 Ga0373926_0012370_1414_2169 251
182 3300035116 Ga0373945_0036174 Ga0373945_0036174_252_1007 251
183 3300035118 Ga0373954_0050513 Ga0373954_0050513_814_1569 251
184 3300035119 Ga0373956_0015804 Ga0373956_0015804_1159_1914 251
185 3300035172 Ga0373955_0264516 Ga0373955_0264516_122_877 251
186 3300035691 Ga0373931_0007696 Ga0373931_0007696_1483_2238 251
187 3300035692 Ga0373935_0001668 Ga0373935_0001668_10336_11091 251
188 3300035695 Ga0373927_0001335 Ga0373927_0001335_9272_10027 251
189 3300035695 Ga0373927_0007902 Ga0373927_0007902_6076_6831 251
190 3300035695 Ga0373927_0022469 Ga0373927_0022469_3165_3920 251
191 3300035725 Ga0373947_0008336 Ga0373947_0008336_398_1153 251
192 3300036401 Ga0373937_0001076 Ga0373937_0001076_2451_3206 251
193 3300037068 Ga0373925_0003238 Ga0373925_0003238_2838_3593 251
194 3300037068 Ga0373925_0004397 Ga0373925_0004397_5956_6711 251
195 3300037068 Ga0373925_0374397 Ga0373925_0374397_88_843 251
196 3300037068 Ga0373925_0492028 Ga0373925_0492028_224_979 251
197 3300037418 Ga0395900_0203142 Ga0395900_0203142_793_1548 251
198 3300037471 Ga0395905_0023591 Ga0395905_0023591_3241_3996 251
199 3300041458 Ga0451798_0522234 Ga0451798_0522234_244_999 251
200 3300042876 Ga0451577_0001024 Ga0451577_0001024_35704_36459 251
201 3300042876 Ga0451577_0036640 Ga0451577_0036640_1419_2174 251
202 3300042876 Ga0451577_0052608 Ga0451577_0052608_523_1278 251
203 3300042876 Ga0451577_0168821 Ga0451577_0168821_149_919 251
204 3300042876 Ga0451577_0424247 Ga0451577_0424247_231_986 251
205 3300042876 Ga0451577_0809049 Ga0451577_0809049_43_798 251
206 3300044673 Ga0453683_0442931 Ga0453683_0442931_66_821 251
207 3300044712 Ga0453684_0001435 Ga0453684_0001435_55817_56587 251
208 3300044712 Ga0453684_0002872 Ga0453684_0002872_12593_13348 251
209 3300044712 Ga0453684_0022095 Ga0453684_0022095_4101_4856 251
210 3300044712 Ga0453684_0127420 Ga0453684_0127420_1316_2071 251
211 3300044712 Ga0453684_0531067 Ga0453684_0531067_478_1233 251
212 3300044712 Ga0453684_0948241 Ga0453684_0948241_55_810 251
213 3300045051 Ga0451576_0014329 Ga0451576_0014329_7241_7996 251
214 3300045051 Ga0451576_0017944 Ga0451576_0017944_2782_3537 251
215 3300045051 Ga0451576_0048454 Ga0451576_0048454_731_1564 251
216 3300045051 Ga0451576_0103993 Ga0451576_0103993_1895_2650 251
217 3300045051 Ga0451576_0124823 Ga0451576_0124823_347_1102 251
218 3300045051 Ga0451576_0125786 Ga0451576_0125786_277_1032 251
219 3300045051 Ga0451576_0162475 Ga0451576_0162475_1299_2054 251
220 3300045051 Ga0451576_0301985 Ga0451576_0301985_740_1495 251
221 3300045051 Ga0451576_0902912 Ga0451576_0902912_105_860 251
222 3300046454 Ga0495592_0000042 Ga0495592_0000042_108019_108774 251
223 3300046461 Ga0495641_0062773 Ga0495641_0062773_58_813 251
224 3300046462 Ga0495651_0119220 Ga0495651_0119220_350_1105 251
225 3300046476 Ga0495662_0039250 Ga0495662_0039250_617_1372 251
226 3300046514 Ga0495618_0008471 Ga0495618_0008471_2074_2829 251
227 3300046514 Ga0495618_0054808 Ga0495618_0054808_818_1573 251
228 3300046516 Ga0495628_0000561 Ga0495628_0000561_31204_31959 251
229 3300046516 Ga0495628_0325867 Ga0495628_0325867_97_852 251
230 3300046517 Ga0495630_0000136 Ga0495630_0000136_34866_35621 251
231 3300046517 Ga0495630_0007108 Ga0495630_0007108_4126_4881 251
232 3300046517 Ga0495630_0009876 Ga0495630_0009876_2777_3532 251
233 3300046517 Ga0495630_0035801 Ga0495630_0035801_806_1561 251
234 3300046517 Ga0495630_0045637 Ga0495630_0045637_1217_1972 251
235 3300046517 Ga0495630_0207486 Ga0495630_0207486_166_921 251
236 3300046517 Ga0495630_0259020 Ga0495630_0259020_439_1194 251
237 3300046517 Ga0495630_0546611 Ga0495630_0546611_47_802 251
238 3300046526 Ga0495666_0009747 Ga0495666_0009747_1233_1988 251
239 3300046526 Ga0495666_0051442 Ga0495666_0051442_1123_1878 251
240 3300046533 Ga0495640_0124598 Ga0495640_0124598_419_1174 251
241 3300046533 Ga0495640_0163858 Ga0495640_0163858_478_1233 251
242 3300046533 Ga0495640_0287861 Ga0495640_0287861_241_996 251
243 3300046535 Ga0495586_0000018 Ga0495586_0000018_89505_90260 251
244 3300046535 Ga0495586_0005304 Ga0495586_0005304_6022_6777 251
245 3300046535 Ga0495586_0009403 Ga0495586_0009403_2413_3168 251
246 3300046535 Ga0495586_0081379 Ga0495586_0081379_356_1111 251
247 3300046543 Ga0495645_0031172 Ga0495645_0031172_138_893 251
248 3300046557 Ga0495622_0021003 Ga0495622_0021003_34_789 251
249 3300046559 Ga0495667_0052384 Ga0495667_0052384_1346_2101 251
250 3300046663 Ga0495635_0061876 Ga0495635_0061876_1686_2441 251
251 3300046678 Ga0495599_0003987 Ga0495599_0003987_7700_8455 251
252 3300046678 Ga0495599_0036656 Ga0495599_0036656_2147_2902 251
253 3300046678 Ga0495599_0057557 Ga0495599_0057557_973_1728 251
254 3300046683 Ga0495658_0144754 Ga0495658_0144754_206_961 251
255 3300046689 Ga0495613_0000934 Ga0495613_0000934_13042_13797 251
256 3300046690 Ga0495624_0032609 Ga0495624_0032609_1239_1994 251
257 3300047319 Ga0495674_0008801 Ga0495674_0008801_1022_1777 251
258 3300047321 Ga0495676_0002387 Ga0495676_0002387_12787_13542 251
259 3300047322 Ga0495680_0001479 Ga0495680_0001479_10322_11077 251
260 3300047444 Ga0495675_0090113 Ga0495675_0090113_81_836 251
261 3300048910 Ga0496107_0012694 Ga0496107_0012694_1260_2015 251
262 3300048918 Ga0496115_0016224 Ga0496115_0016224_3487_4242 251
263 3300049570 Ga0501033_0101773 Ga0501033_0101773_82_837 251
264 3300049570 Ga0501033_0348125 Ga0501033_0348125_148_903 251
265 3300049581 Ga0501047_0177088 Ga0501047_0177088_553_1308 251
266 3300049822 Ga0501035_0170070 Ga0501035_0170070_613_1368 251
267 3300049823 Ga0501044_0588435 Ga0501044_0588435_202_957 251
268 3300050508 nmdc:mga09592_250090_c1 nmdc:mga09592_250090_c1_628_1383 251
269 3300050510 nmdc:mga06r32_694904_c1 nmdc:mga06r32_694904_c1_108_863 251
270 3300050511 nmdc:mga08y16_102371_c1 nmdc:mga08y16_102371_c1_762_1517 251
271 3300050511 nmdc:mga08y16_233772_c1 nmdc:mga08y16_233772_c1_392_1147 251
272 3300050511 nmdc:mga08y16_582211_c1 nmdc:mga08y16_582211_c1_292_1047 251
273 3300053098 Ga0500650_0022313 Ga0500650_0022313_260_1015 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

111

306

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9123 56 251
6fog-assembly4.cif.gz_D x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. 0.9093 56 251
3s52-assembly2.cif.gz_C crystal structure of a putative fumarylacetoacetate hydrolase family protein from yersinia pestis co92 0.8984 52 251
4pfz-assembly1.cif.gz_A x-ray crystal structure of 5-carboxymethyl-2-hydroxymuconate delta-isomerase from mycobacterium smegmatis 0.895 3 250
4dbh-assembly1.cif.gz_B crystal structure of cg1458 with inhibitor 0.8873 1 250
ID Description Score Start End Superfamily
af_A0A0R4IWE1_56_289_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.918 38 251 3.90.850.10
af_Q10B63_1_221_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9117 54 251 3.90.850.10
af_Q96GK7_51_314_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.91 39 251 3.90.850.10
af_P34673_5_211_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9099 54 247 3.90.850.10
af_A0A1D8PI10_75_291_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9079 56 251 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A2D6LG98-F1-model_v4 deleted 0.935 3 251
AF-A0A3M8C015-F1-model_v4 FAA hydrolase family protein 0.9341 4 251 GO:0018773
GO:0046872
AF-A0A3B9KWB1-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9338 3 250 GO:0018773
GO:0046872
AF-A0A7C3XX73-F1-model_v4 FAA hydrolase family protein 0.9327 3 250 GO:0018773
GO:0046872
AF-A0A1G6XBX0-F1-model_v4 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (Catechol pathway) 0.9319 3 251 GO:0018773
GO:0046872

Feature Viewer

pLDDT pTM Quality
83.91 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map