F378855

General Info

Members Datasets Scaffolds Average Seq Length
273 147 546 460

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100113293|Ga0070671_1001132931
Length 509
Sequence MATACRMRFVSSSKFALNRAPKLFLIFSSTVRKARRPEAALVALFLMAAVXXXCISAHRTPNLENIFAESRARTGKRPVIVIPGILGSELINSKTGEVVWPSAFRSSDDGLPMTPNLEGNHDDLVPGKIIETVRLARALPEVYVYRDLLEALRLYAGYREADWNNPGTDGDKDTFYVFAYDWRRDNVENARELFRRIERLKATLHRDDLKFNVIAHSMGGLIARYAAMYGNQDLPQGEAPLQPTWAGAQHISKIVMIGVPNEGSADAFATLIAGYSITEGLRRRVPLLNKLTAEDAVRSPAVFQLLPHPASVRFLDENLKPLPLDLYDVEVWKKYGWSPIYTQEFRRRYTNHKSESPSAEADLDVYLAAMLKRARRFQAALDAGSVANQPVALLAMGGDCEETLNSPVLYRDQKENRWVTLIRPREFRNSSGQKISKRQLTEAMYAPGDGRVTRKSLLGENVLTMEGHETVIHLPLTYAVFGCDLHGQLQRNKSLQDNALTAIVGEILK

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
123 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
129 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
130 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
133 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
134 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
135 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
136 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
137 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
138 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.47
Rhizosphere 98.53
Stem 0
Stem Tuber 0
Unclassified 17.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100113293 3300005355 Bacteria 2279
2 JGI24751J29686_10000008 3300002459 Bacteria 128004
3 JGI24751J29686_10000029 3300002459 Bacteria 93445
4 JGI25406J46586_10020762 3300003203 Bacteria 2649
5 Ga0065714_10002184 3300005288 Bacteria 284511
6 Ga0065704_10072899 3300005289 Bacteria 7843
7 Ga0065712_10000112 3300005290 Bacteria 340011
8 Ga0065712_10005297 3300005290 Unclassified 3706
9 Ga0065712_10133492 3300005290 Bacteria 1522
10 Ga0065715_10000699 3300005293 Bacteria 19407
11 Ga0065715_10089835 3300005293 Bacteria 8370
12 Ga0065715_10100202 3300005293 Bacteria 3300
13 Ga0065707_10001766 3300005295 Bacteria 5645
14 Ga0065707_10018535 3300005295 Bacteria 2334
15 Ga0065707_10112940 3300005295 Unclassified 2344
16 Ga0070690_100053402 3300005330 Bacteria 2585
17 Ga0070670_100013546 3300005331 Bacteria 6989
18 Ga0068869_100019050 3300005334 Unclassified 4682
19 Ga0068869_100141375 3300005334 Bacteria 1859
20 Ga0070666_10043530 3300005335 Bacteria 3007
21 Ga0070680_100007150 3300005336 Bacteria 8507
22 Ga0070682_100090406 3300005337 Bacteria 2002
23 Ga0070687_100003571 3300005343 Bacteria 6061
24 Ga0070687_100033431 3300005343 Bacteria 2539
25 Ga0070692_10008238 3300005345 Bacteria 4641
26 Ga0070692_10040140 3300005345 Unclassified 2392
27 Ga0070669_100093952 3300005353 Bacteria 2253
28 Ga0070671_100128278 3300005355 Unclassified 2135
29 Ga0070673_100010619 3300005364 Bacteria 6241
30 Ga0070659_100005433 3300005366 Bacteria 9151
31 Ga0070667_100075068 3300005367 Unclassified 2886
32 Ga0070703_10003494 3300005406 Bacteria 4477
33 Ga0070705_100007258 3300005440 Bacteria 5451
34 Ga0070705_100035724 3300005440 Bacteria 2788
35 Ga0070700_100000142 3300005441 Bacteria 42548
36 Ga0070700_100014981 3300005441 Bacteria 4385
37 Ga0070694_100035755 3300005444 Unclassified 3286
38 Ga0070694_100060238 3300005444 Bacteria 2588
39 Ga0070708_100000455 3300005445 Bacteria 30656
40 Ga0070662_100054848 3300005457 Bacteria 2889
41 Ga0070662_100070942 3300005457 Unclassified 2567
42 Ga0070681_10000329 3300005458 Bacteria 38591
43 Ga0070681_10000410 3300005458 Bacteria 34833
44 Ga0070681_10013196 3300005458 Bacteria 8209
45 Ga0070681_10042100 3300005458 Bacteria 4577
46 Ga0068867_100028570 3300005459 Unclassified 4017
47 Ga0070685_10002636 3300005466 Bacteria 9193
48 Ga0070706_100001375 3300005467 Bacteria 25837
49 Ga0070706_100113127 3300005467 Bacteria 2527
50 Ga0070707_100006377 3300005468 Bacteria 10968
51 Ga0070707_100290361 3300005468 Bacteria 1589
52 Ga0070698_100004167 3300005471 Bacteria 15894
53 Ga0070698_100075427 3300005471 Bacteria 3376
54 Ga0070698_100077627 3300005471 Bacteria 3320
55 Ga0070699_100000488 3300005518 Bacteria 37711
56 Ga0070699_100007534 3300005518 Bacteria 9465
57 Ga0070699_100098351 3300005518 Bacteria 2564
58 Ga0070699_100124933 3300005518 Unclassified 2264
59 Ga0070679_100000439 3300005530 Bacteria 35386
60 Ga0070679_100005807 3300005530 Bacteria 11450
61 Ga0068853_100013329 3300005539 Bacteria 6712
62 Ga0068853_100161936 3300005539 Unclassified 2020
63 Ga0070695_100018561 3300005545 Bacteria 4225
64 Ga0070696_100054975 3300005546 Bacteria 2776
65 Ga0070693_100002498 3300005547 Bacteria 8476
66 Ga0070693_100020509 3300005547 Bacteria 3487
67 Ga0070693_100070101 3300005547 Bacteria 2062
68 Ga0070664_100006502 3300005564 Bacteria 9418
69 Ga0068857_100054268 3300005577 Bacteria 3555
70 Ga0068857_100168230 3300005577 Unclassified 1992
71 Ga0070702_100002989 3300005615 Bacteria 7472
72 Ga0070702_100033470 3300005615 Bacteria 2826
73 Ga0068859_100021701 3300005617 Bacteria 6443
74 Ga0068859_100059911 3300005617 Bacteria 3836
75 Ga0068859_100065446 3300005617 Unclassified 3669
76 Ga0068859_100089471 3300005617 Unclassified 3129
77 Ga0068859_100112047 3300005617 Unclassified 2791
78 Ga0068859_100121068 3300005617 Bacteria 2683
79 Ga0068859_100324884 3300005617 Bacteria 1632
80 Ga0068864_100006336 3300005618 Bacteria 9704
81 Ga0068864_100008006 3300005618 Bacteria 8717
82 Ga0068864_100023892 3300005618 Bacteria 5137
83 Ga0068866_10008541 3300005718 Unclassified 4321
84 Ga0068861_100041489 3300005719 Bacteria 3447
85 Ga0068861_100051452 3300005719 Bacteria 3127
86 Ga0068861_100055080 3300005719 Bacteria 3031
87 Ga0068870_10061773 3300005840 Bacteria 2015
88 Ga0068858_100015739 3300005842 Bacteria 7114
89 Ga0068858_100027593 3300005842 Bacteria 5274
90 Ga0068858_100038087 3300005842 Unclassified 4460
91 Ga0068860_100013969 3300005843 Bacteria 7874
92 Ga0068860_100015081 3300005843 Bacteria 7552
93 Ga0068860_100077092 3300005843 Bacteria 3169
94 Ga0068860_100271163 3300005843 Bacteria 1656
95 Ga0081539_10000804 3300005985 Bacteria 61071
96 Ga0081539_10003003 3300005985 Bacteria 22016
97 Ga0081539_10003328 3300005985 Bacteria 20020
98 Ga0097621_100003753 3300006237 Bacteria 10526
99 Ga0097621_100006572 3300006237 Bacteria 8257
100 Ga0097621_100007016 3300006237 Bacteria 8023
101 Ga0068871_100003374 3300006358 Bacteria 10976
102 Ga0068871_100003527 3300006358 Bacteria 10769
103 Ga0075433_10116150 3300006852 Unclassified 2374
104 Ga0075433_10130846 3300006852 Bacteria 2229
105 Ga0075429_100018486 3300006880 Bacteria 6038
106 Ga0097620_100021705 3300006931 Bacteria 6443
107 Ga0097620_100059911 3300006931 Bacteria 3836
108 Ga0097620_100065439 3300006931 Unclassified 3669
109 Ga0097620_100089470 3300006931 Unclassified 3129
110 Ga0097620_100112049 3300006931 Unclassified 2791
111 Ga0097620_100121061 3300006931 Bacteria 2683
112 Ga0097620_100324871 3300006931 Bacteria 1632
113 Ga0111539_10042286 3300009094 Bacteria 5474
114 Ga0111539_10123259 3300009094 Bacteria 3037
115 Ga0105245_10007191 3300009098 Bacteria 9753
116 Ga0105247_10009771 3300009101 Bacteria 5815
117 Ga0105247_10070917 3300009101 Bacteria 2178
118 Ga0114129_10000855 3300009147 Bacteria 39483
119 Ga0114129_10049615 3300009147 Bacteria 5897
120 Ga0114129_10101721 3300009147 Unclassified 3975
121 Ga0114129_10263131 3300009147 Bacteria 2310
122 Ga0114129_10332447 3300009147 Bacteria 2017
123 Ga0114129_10536025 3300009147 Unclassified 1524
124 Ga0105243_10001558 3300009148 Bacteria 20035
125 Ga0105243_10206195 3300009148 Unclassified 1728
126 Ga0105241_10198152 3300009174 Bacteria 1675
127 Ga0105248_10013277 3300009177 Bacteria 9067
128 Ga0105248_10015478 3300009177 Bacteria 8409
129 Ga0105248_10023563 3300009177 Bacteria 6839
130 Ga0105248_10142558 3300009177 Bacteria 2703
131 Ga0105248_10249160 3300009177 Bacteria 1999
132 Ga0105237_10011146 3300009545 Bacteria 9531
133 Ga0105238_10011121 3300009551 Bacteria 9049
134 Ga0105239_10307922 3300010375 Bacteria 1785
135 Ga0105246_10039162 3300011119 Unclassified 3191
136 Ga0105246_10050110 3300011119 Bacteria 2863
137 Ga0157373_10035584 3300013100 Unclassified 3574
138 Ga0157374_10098925 3300013296 Unclassified 2793
139 Ga0157378_10004141 3300013297 Bacteria 12804
140 Ga0157378_10123811 3300013297 Unclassified 2386
141 Ga0163162_10000610 3300013306 Bacteria 33195
142 Ga0163162_10014515 3300013306 Bacteria 7697
143 Ga0163162_10065919 3300013306 Bacteria 3670
144 Ga0163162_10101726 3300013306 Bacteria 2966
145 Ga0157372_10016556 3300013307 Bacteria 7912
146 Ga0157372_10033817 3300013307 Bacteria 5617
147 Ga0157372_10286659 3300013307 Bacteria 1915
148 Ga0157375_10024102 3300013308 Bacteria 5627
149 Ga0157375_10060060 3300013308 Bacteria 3768
150 Ga0157375_10103501 3300013308 Bacteria 2934
151 Ga0163163_10001194 3300014325 Bacteria 22003
152 Ga0163163_10002150 3300014325 Bacteria 16656
153 Ga0163163_10015622 3300014325 Bacteria 7025
154 Ga0157380_10008212 3300014326 Bacteria 7439
155 Ga0157380_10042033 3300014326 Unclassified 3571
156 Ga0157380_10065037 3300014326 Unclassified 2929
157 Ga0157377_10002603 3300014745 Bacteria 8014
158 Ga0157376_10007789 3300014969 Bacteria 7676
159 Ga0163161_10002021 3300017792 Bacteria 14673
160 Ga0163161_10093021 3300017792 Bacteria 2233
161 Ga0207697_10003820 3300025315 Bacteria 7351
162 Ga0207653_10000839 3300025885 Bacteria 10253
163 Ga0207642_10016559 3300025899 Unclassified 2780
164 Ga0207710_10000434 3300025900 Bacteria 27407
165 Ga0207688_10042363 3300025901 Bacteria 2535
166 Ga0207680_10054209 3300025903 Bacteria 2411
167 Ga0207647_10007968 3300025904 Bacteria 7615
168 Ga0207643_10004151 3300025908 Bacteria 7807
169 Ga0207643_10074389 3300025908 Bacteria 1959
170 Ga0207684_10010128 3300025910 Bacteria 8304
171 Ga0207654_10044781 3300025911 Unclassified 2515
172 Ga0207707_10000037 3300025912 Bacteria 144937
173 Ga0207707_10013638 3300025912 Bacteria 7088
174 Ga0207707_10038184 3300025912 Unclassified 4196
175 Ga0207671_10006033 3300025914 Bacteria 10940
176 Ga0207660_10005135 3300025917 Bacteria 8514
177 Ga0207660_10023769 3300025917 Bacteria 4141
178 Ga0207662_10041795 3300025918 Bacteria 2700
179 Ga0207662_10053508 3300025918 Unclassified 2405
180 Ga0207649_10079074 3300025920 Bacteria 2123
181 Ga0207652_10000417 3300025921 Bacteria 44140
182 Ga0207652_10016765 3300025921 Bacteria 5986
183 Ga0207646_10245937 3300025922 Bacteria 1616
184 Ga0207681_10047799 3300025923 Bacteria 2885
185 Ga0207694_10024051 3300025924 Bacteria 4626
186 Ga0207650_10000087 3300025925 Bacteria 123505
187 Ga0207650_10046133 3300025925 Bacteria 3208
188 Ga0207650_10113839 3300025925 Unclassified 2098
189 Ga0207706_10061256 3300025933 Bacteria 3314
190 Ga0207706_10148847 3300025933 Unclassified 2060
191 Ga0207709_10068518 3300025935 Unclassified 2243
192 Ga0207704_10262235 3300025938 Bacteria 1304
193 Ga0207691_10003802 3300025940 Bacteria 14651
194 Ga0207711_10003723 3300025941 Bacteria 13145
195 Ga0207689_10012124 3300025942 Bacteria 7379
196 Ga0207651_10150875 3300025960 Unclassified 1809
197 Ga0207712_10001024 3300025961 Bacteria 19832
198 Ga0207712_10020942 3300025961 Unclassified 4289
199 Ga0207712_10048173 3300025961 Bacteria 2963
200 Ga0207658_10052414 3300025986 Unclassified 3011
201 Ga0207677_10003159 3300026023 Bacteria 8693
202 Ga0207703_10068574 3300026035 Bacteria 2922
203 Ga0207703_10102958 3300026035 Bacteria 2423
204 Ga0207708_10000407 3300026075 Bacteria 33931
205 Ga0207708_10019768 3300026075 Bacteria 5079
206 Ga0207708_10021160 3300026075 Bacteria 4906
207 Ga0207708_10026628 3300026075 Bacteria 4379
208 Ga0207708_10094015 3300026075 Unclassified 2314
209 Ga0207708_10223356 3300026075 Unclassified 1510
210 Ga0207641_10081541 3300026088 Bacteria 2809
211 Ga0207648_10006064 3300026089 Bacteria 12050
212 Ga0207648_10024774 3300026089 Bacteria 5353
213 Ga0207676_10006654 3300026095 Bacteria 8169
214 Ga0207676_10037929 3300026095 Unclassified 3676
215 Ga0207676_10137878 3300026095 Bacteria 2084
216 Ga0207676_10214669 3300026095 Bacteria 1709
217 Ga0207674_10000037 3300026116 Bacteria 134125
218 Ga0207674_10012909 3300026116 Bacteria 9317
219 Ga0207675_100005408 3300026118 Bacteria 12234
220 Ga0207675_100025112 3300026118 Bacteria 5546
221 Ga0207675_100108505 3300026118 Bacteria 2618
222 Ga0207675_100138205 3300026118 Bacteria 2313
223 Ga0207675_100163526 3300026118 Bacteria 2124
224 Ga0268264_10005242 3300028381 Bacteria 10971
225 Ga0268264_10037203 3300028381 Bacteria 4012
226 Ga0268264_10039517 3300028381 Unclassified 3898
227 Ga0268264_10125333 3300028381 Unclassified 2269
228 Ga0307408_100175823 3300031548 Bacteria 1713
229 Ga0307412_10152220 3300031911 Bacteria 1708
230 Ga0307416_100129421 3300032002 Bacteria 2269
231 Ga0307416_100184567 3300032002 Bacteria 1959
232 Ga0307414_10002672 3300032004 Bacteria 9370
233 Ga0307415_100012136 3300032126 Bacteria 4970
234 Ga0373951_0002719 3300035091 Bacteria 4427
235 Ga0395898_0149319 3300037466 Bacteria 2237
236 Ga0395898_0279337 3300037466 Unclassified 1593
237 Ga0242420_001685 3300038996 Bacteria 3011
238 Ga0439455_0000942 3300042012 Bacteria 4539
239 Ga0496103_0029414 3300048906 Bacteria 3339
240 Ga0496104_0027232 3300048907 Bacteria 5290
241 Ga0496106_0035210 3300048909 Bacteria 3744
242 Ga0496112_0067905 3300048915 Bacteria 3520
243 Ga0501297_001480 3300049520 Bacteria 2163
244 Ga0501298_001911 3300049521 Bacteria 3105
245 Ga0501299_001680 3300049522 Bacteria 2918
246 Ga0501038_0000313 3300049574 Bacteria 41503
247 Ga0501217_001994 3300049661 Bacteria 3939
248 Ga0501223_009190 3300049663 Bacteria 2006
249 Ga0501227_016890 3300049665 Bacteria 1643
250 Ga0501235_014833 3300049669 Bacteria 1717
251 Ga0501249_018195 3300049679 Bacteria 1518
252 Ga0501253_001962 3300049683 Bacteria 2228
253 Ga0501221_010668 3300049704 Bacteria 1637
254 Ga0501225_0001032 3300049705 Bacteria 8733
255 Ga0501225_0026060 3300049705 Bacteria 1609
256 Ga0501226_002963 3300049853 Bacteria 2037
257 nmdc:mga05p37_177334_c2 3300050507 Unclassified 2169
258 nmdc:mga05p37_271724_c1 3300050507 Bacteria 2025
259 nmdc:mga05p37_4221_c1 3300050507 Bacteria 16786
260 nmdc:mga06r32_58928_c1 3300050510 Unclassified 3691
261 nmdc:mga08y16_100704_c1 3300050511 Bacteria 3008
262 nmdc:mga08y16_194711_c1 3300050511 Bacteria 2102
263 nmdc:mga08y16_48658_c1 3300050511 Bacteria 4437
264 nmdc:mga0n895_106664_c1 3300050512 Bacteria 2814
265 nmdc:mga0n895_16595_c1 3300050512 Bacteria 6762
266 nmdc:mga0n895_94458_c1 3300050512 Bacteria 2994
267 nmdc:mga0rr50_24420_c1 3300050513 Bacteria 4186
268 nmdc:mga0a205_110009_c1 3300050515 Bacteria 2654
269 nmdc:mga0a205_122525_c1 3300050515 Unclassified 2500
270 nmdc:mga0a205_64954_c1 3300050515 Bacteria 3525
271 nmdc:mga0a205_75568_c1 3300050515 Bacteria 3255
272 nmdc:mga0a205_79133_c1 3300050515 Bacteria 3176
273 Ga0530510_0015667 3300061734 Bacteria 5356
274 Ga0070671_100113293
275 JGI24751J29686_10000008
276 JGI24751J29686_10000029
277 JGI25406J46586_10020762
278 Ga0065714_10002184
279 Ga0065704_10072899
280 Ga0065712_10000112
281 Ga0065712_10005297
282 Ga0065712_10133492
283 Ga0065715_10000699
284 Ga0065715_10089835
285 Ga0065715_10100202
286 Ga0065707_10001766
287 Ga0065707_10018535
288 Ga0065707_10112940
289 Ga0070690_100053402
290 Ga0070670_100013546
291 Ga0068869_100019050
292 Ga0068869_100141375
293 Ga0070666_10043530
294 Ga0070680_100007150
295 Ga0070682_100090406
296 Ga0070687_100003571
297 Ga0070687_100033431
298 Ga0070692_10008238
299 Ga0070692_10040140
300 Ga0070669_100093952
301 Ga0070671_100128278
302 Ga0070673_100010619
303 Ga0070659_100005433
304 Ga0070667_100075068
305 Ga0070703_10003494
306 Ga0070705_100007258
307 Ga0070705_100035724
308 Ga0070700_100000142
309 Ga0070700_100014981
310 Ga0070694_100035755
311 Ga0070694_100060238
312 Ga0070708_100000455
313 Ga0070662_100054848
314 Ga0070662_100070942
315 Ga0070681_10000329
316 Ga0070681_10000410
317 Ga0070681_10013196
318 Ga0070681_10042100
319 Ga0068867_100028570
320 Ga0070685_10002636
321 Ga0070706_100001375
322 Ga0070706_100113127
323 Ga0070707_100006377
324 Ga0070707_100290361
325 Ga0070698_100004167
326 Ga0070698_100075427
327 Ga0070698_100077627
328 Ga0070699_100000488
329 Ga0070699_100007534
330 Ga0070699_100098351
331 Ga0070699_100124933
332 Ga0070679_100000439
333 Ga0070679_100005807
334 Ga0068853_100013329
335 Ga0068853_100161936
336 Ga0070695_100018561
337 Ga0070696_100054975
338 Ga0070693_100002498
339 Ga0070693_100020509
340 Ga0070693_100070101
341 Ga0070664_100006502
342 Ga0068857_100054268
343 Ga0068857_100168230
344 Ga0070702_100002989
345 Ga0070702_100033470
346 Ga0068859_100021701
347 Ga0068859_100059911
348 Ga0068859_100065446
349 Ga0068859_100089471
350 Ga0068859_100112047
351 Ga0068859_100121068
352 Ga0068859_100324884
353 Ga0068864_100006336
354 Ga0068864_100008006
355 Ga0068864_100023892
356 Ga0068866_10008541
357 Ga0068861_100041489
358 Ga0068861_100051452
359 Ga0068861_100055080
360 Ga0068870_10061773
361 Ga0068858_100015739
362 Ga0068858_100027593
363 Ga0068858_100038087
364 Ga0068860_100013969
365 Ga0068860_100015081
366 Ga0068860_100077092
367 Ga0068860_100271163
368 Ga0081539_10000804
369 Ga0081539_10003003
370 Ga0081539_10003328
371 Ga0097621_100003753
372 Ga0097621_100006572
373 Ga0097621_100007016
374 Ga0068871_100003374
375 Ga0068871_100003527
376 Ga0075433_10116150
377 Ga0075433_10130846
378 Ga0075429_100018486
379 Ga0097620_100021705
380 Ga0097620_100059911
381 Ga0097620_100065439
382 Ga0097620_100089470
383 Ga0097620_100112049
384 Ga0097620_100121061
385 Ga0097620_100324871
386 Ga0111539_10042286
387 Ga0111539_10123259
388 Ga0105245_10007191
389 Ga0105247_10009771
390 Ga0105247_10070917
391 Ga0114129_10000855
392 Ga0114129_10049615
393 Ga0114129_10101721
394 Ga0114129_10263131
395 Ga0114129_10332447
396 Ga0114129_10536025
397 Ga0105243_10001558
398 Ga0105243_10206195
399 Ga0105241_10198152
400 Ga0105248_10013277
401 Ga0105248_10015478
402 Ga0105248_10023563
403 Ga0105248_10142558
404 Ga0105248_10249160
405 Ga0105237_10011146
406 Ga0105238_10011121
407 Ga0105239_10307922
408 Ga0105246_10039162
409 Ga0105246_10050110
410 Ga0157373_10035584
411 Ga0157374_10098925
412 Ga0157378_10004141
413 Ga0157378_10123811
414 Ga0163162_10000610
415 Ga0163162_10014515
416 Ga0163162_10065919
417 Ga0163162_10101726
418 Ga0157372_10016556
419 Ga0157372_10033817
420 Ga0157372_10286659
421 Ga0157375_10024102
422 Ga0157375_10060060
423 Ga0157375_10103501
424 Ga0163163_10001194
425 Ga0163163_10002150
426 Ga0163163_10015622
427 Ga0157380_10008212
428 Ga0157380_10042033
429 Ga0157380_10065037
430 Ga0157377_10002603
431 Ga0157376_10007789
432 Ga0163161_10002021
433 Ga0163161_10093021
434 Ga0207697_10003820
435 Ga0207653_10000839
436 Ga0207642_10016559
437 Ga0207710_10000434
438 Ga0207688_10042363
439 Ga0207680_10054209
440 Ga0207647_10007968
441 Ga0207643_10004151
442 Ga0207643_10074389
443 Ga0207684_10010128
444 Ga0207654_10044781
445 Ga0207707_10000037
446 Ga0207707_10013638
447 Ga0207707_10038184
448 Ga0207671_10006033
449 Ga0207660_10005135
450 Ga0207660_10023769
451 Ga0207662_10041795
452 Ga0207662_10053508
453 Ga0207649_10079074
454 Ga0207652_10000417
455 Ga0207652_10016765
456 Ga0207646_10245937
457 Ga0207681_10047799
458 Ga0207694_10024051
459 Ga0207650_10000087
460 Ga0207650_10046133
461 Ga0207650_10113839
462 Ga0207706_10061256
463 Ga0207706_10148847
464 Ga0207709_10068518
465 Ga0207704_10262235
466 Ga0207691_10003802
467 Ga0207711_10003723
468 Ga0207689_10012124
469 Ga0207651_10150875
470 Ga0207712_10001024
471 Ga0207712_10020942
472 Ga0207712_10048173
473 Ga0207658_10052414
474 Ga0207677_10003159
475 Ga0207703_10068574
476 Ga0207703_10102958
477 Ga0207708_10000407
478 Ga0207708_10019768
479 Ga0207708_10021160
480 Ga0207708_10026628
481 Ga0207708_10094015
482 Ga0207708_10223356
483 Ga0207641_10081541
484 Ga0207648_10006064
485 Ga0207648_10024774
486 Ga0207676_10006654
487 Ga0207676_10037929
488 Ga0207676_10137878
489 Ga0207676_10214669
490 Ga0207674_10000037
491 Ga0207674_10012909
492 Ga0207675_100005408
493 Ga0207675_100025112
494 Ga0207675_100108505
495 Ga0207675_100138205
496 Ga0207675_100163526
497 Ga0268264_10005242
498 Ga0268264_10037203
499 Ga0268264_10039517
500 Ga0268264_10125333
501 Ga0307408_100175823
502 Ga0307412_10152220
503 Ga0307416_100129421
504 Ga0307416_100184567
505 Ga0307414_10002672
506 Ga0307415_100012136
507 Ga0373951_0002719
508 Ga0395898_0149319
509 Ga0395898_0279337
510 Ga0242420_001685
511 Ga0439455_0000942
512 Ga0496103_0029414
513 Ga0496104_0027232
514 Ga0496106_0035210
515 Ga0496112_0067905
516 Ga0501297_001480
517 Ga0501298_001911
518 Ga0501299_001680
519 Ga0501038_0000313
520 Ga0501217_001994
521 Ga0501223_009190
522 Ga0501227_016890
523 Ga0501235_014833
524 Ga0501249_018195
525 Ga0501253_001962
526 Ga0501221_010668
527 Ga0501225_0001032
528 Ga0501225_0026060
529 Ga0501226_002963
530 nmdc:mga05p37_177334_c2
531 nmdc:mga05p37_271724_c1
532 nmdc:mga05p37_4221_c1
533 nmdc:mga06r32_58928_c1
534 nmdc:mga08y16_100704_c1
535 nmdc:mga08y16_194711_c1
536 nmdc:mga08y16_48658_c1
537 nmdc:mga0n895_106664_c1
538 nmdc:mga0n895_16595_c1
539 nmdc:mga0n895_94458_c1
540 nmdc:mga0rr50_24420_c1
541 nmdc:mga0a205_110009_c1
542 nmdc:mga0a205_122525_c1
543 nmdc:mga0a205_64954_c1
544 nmdc:mga0a205_75568_c1
545 nmdc:mga0a205_79133_c1
546 Ga0530510_0015667

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02450

LCAT

Lecithin:cholesterol acyltransferase

164

370

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ftw-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase n110c/l145h at 2.3 angstrom resolution 0.7656 106 177
4fhz-assembly1.cif.gz_A-2 crystal structure of a carboxyl esterase at 2.0 angstrom resolution 0.7615 106 178
6isr-assembly2.cif.gz_B structure of lipase mutant with cys-his-asp catalytic triad 0.7314 105 226
5syn-assembly4.cif.gz_D cocrystal structure of the human acyl protein thioesterase 2 with an isoform-selective inhibitor, ml349 0.7197 106 178
4k5q-assembly1.cif.gz_A crystal structure of calb mutant dglm from candida antarctica 0.6895 105 226
ID Description Score Start End Superfamily
af_Q54XE3_9_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8439 93 191 3.40.50.1820
af_Q4E2D5_170_349_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7821 110 177 3.40.50.1820
4ftwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7656 106 177 3.40.50.1820
af_I1JSY1_436_727_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7593 117 175 3.40.50.1820
af_P95011_169_349_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7244 106 177 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W0V163-F1-model_v4 Lecithin--cholesterol acyltransferase 0.9074 2 355 GO:0006629
GO:0008374
AF-A0A7W1HEK8-F1-model_v4 Alpha/beta hydrolase 0.9023 2 259 GO:0006629
GO:0008374
AF-A0A3B8PEJ4-F1-model_v4 deleted 0.8944 95 230
AF-A0A7V9UMV3-F1-model_v4 Lecithin:cholesterol acyltransferase 0.8538 2 409 GO:0006629
GO:0008374
AF-A0A7C5ZWZ3-F1-model_v4 Lecithin:cholesterol acyltransferase 0.8529 2 405 GO:0006629
GO:0008374

Map