F378789
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 273 | 171 | 273 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10031452|rootH1_100314524 |
| Length | 121 |
| Sequence | MTTRGIDMVLVETHNFGKTVAFWKSLGYELEFETDHHSGRLVHPSGAAPAIFVAERPPGQALEVVLGVSVKAPEDFRPPTSGTVRQPFEMQHWGALQMLVADPDERIVAVEAPAPKGEGAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 59 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 60 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 92 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 93 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 94 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 97 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 98 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 99 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 101 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 102 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 103 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 108 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 111 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 112 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 114 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 115 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 116 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 117 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 118 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 119 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 120 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 121 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 122 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 123 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 124 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 135 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 136 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 137 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 138 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 139 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 140 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 141 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 142 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 143 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 144 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 145 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 146 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 147 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 157 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 158 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 159 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 160 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 161 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 162 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 163 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 164 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 165 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 166 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 167 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 168 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 169 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 170 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.49 |
| Nodule | 0 |
| Rhizoplane | 3.66 |
| Rhizosphere | 77.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10163557 | 3300003320 | Bacteria | 3010 |
| 2 | rootL2_10033260 | 3300003322 | Bacteria | 3203 |
| 3 | rootL2_10125555 | 3300003322 | Unclassified | 1880 |
| 4 | rootL2_10264764 | 3300003322 | Bacteria | 2051 |
| 5 | rootH1_10031452 | 3300003323 | Bacteria | 5727 |
| 6 | rootH1_10116647 | 3300003323 | Bacteria | 2895 |
| 7 | rootH1_10149821 | 3300003323 | Bacteria | 2673 |
| 8 | Ga0070658_10207384 | 3300005327 | Bacteria | 1655 |
| 9 | Ga0070683_100190930 | 3300005329 | Bacteria | 1945 |
| 10 | Ga0070690_100934002 | 3300005330 | Bacteria | 680 |
| 11 | Ga0070666_10172574 | 3300005335 | Unclassified | 1515 |
| 12 | Ga0070680_100118282 | 3300005336 | Bacteria | 2210 |
| 13 | Ga0070680_100404409 | 3300005336 | Bacteria | 1164 |
| 14 | Ga0070691_10463066 | 3300005341 | Bacteria | 726 |
| 15 | Ga0070671_100000196 | 3300005355 | Bacteria | 40503 |
| 16 | Ga0070674_100760749 | 3300005356 | Bacteria | 833 |
| 17 | Ga0070667_100048708 | 3300005367 | Unclassified | 3567 |
| 18 | Ga0070681_10185646 | 3300005458 | Bacteria | 2000 |
| 19 | Ga0070681_10544105 | 3300005458 | Bacteria | 1075 |
| 20 | Ga0068867_100091934 | 3300005459 | Bacteria | 2304 |
| 21 | Ga0070679_100015171 | 3300005530 | Bacteria | 7404 |
| 22 | Ga0070679_100470566 | 3300005530 | Bacteria | 1201 |
| 23 | Ga0070684_100625336 | 3300005535 | Bacteria | 1002 |
| 24 | Ga0070684_101874443 | 3300005535 | Unclassified | 566 |
| 25 | Ga0070697_100713136 | 3300005536 | Bacteria | 885 |
| 26 | Ga0068853_100295631 | 3300005539 | Bacteria | 1496 |
| 27 | Ga0070686_100236964 | 3300005544 | Bacteria | 1327 |
| 28 | Ga0070665_100002611 | 3300005548 | Bacteria | 19663 |
| 29 | Ga0070665_100270917 | 3300005548 | Bacteria | 1699 |
| 30 | Ga0070665_100632665 | 3300005548 | Bacteria | 1083 |
| 31 | Ga0068855_100040504 | 3300005563 | Bacteria | 5530 |
| 32 | Ga0068855_100195554 | 3300005563 | Bacteria | 2279 |
| 33 | Ga0068857_100054391 | 3300005577 | Bacteria | 3551 |
| 34 | Ga0068857_100084719 | 3300005577 | Bacteria | 2832 |
| 35 | Ga0068857_100217325 | 3300005577 | Bacteria | 1745 |
| 36 | Ga0068856_100108423 | 3300005614 | Bacteria | 2773 |
| 37 | Ga0068856_100178370 | 3300005614 | Bacteria | 2137 |
| 38 | Ga0068856_102607006 | 3300005614 | Bacteria | 511 |
| 39 | Ga0068852_100844660 | 3300005616 | Unclassified | 931 |
| 40 | Ga0068859_100002402 | 3300005617 | Bacteria | 19068 |
| 41 | Ga0068864_100753955 | 3300005618 | Bacteria | 954 |
| 42 | Ga0068864_102019150 | 3300005618 | Bacteria | 583 |
| 43 | Ga0068861_100617278 | 3300005719 | Bacteria | 997 |
| 44 | Ga0068863_100005215 | 3300005841 | Bacteria | 12823 |
| 45 | Ga0068858_100000113 | 3300005842 | Bacteria | 84912 |
| 46 | Ga0068860_100040823 | 3300005843 | Bacteria | 4433 |
| 47 | Ga0068860_100585618 | 3300005843 | Bacteria | 1120 |
| 48 | Ga0068860_101755908 | 3300005843 | Bacteria | 642 |
| 49 | Ga0068862_100246316 | 3300005844 | Bacteria | 1627 |
| 50 | Ga0097621_100005603 | 3300006237 | Bacteria | 8854 |
| 51 | Ga0068871_100020500 | 3300006358 | Bacteria | 5066 |
| 52 | Ga0068871_101358119 | 3300006358 | Bacteria | 669 |
| 53 | Ga0068865_100005358 | 3300006881 | Bacteria | 7768 |
| 54 | Ga0097620_100002402 | 3300006931 | Bacteria | 19068 |
| 55 | Ga0105250_10013358 | 3300009092 | Bacteria | 3383 |
| 56 | Ga0105240_10002612 | 3300009093 | Bacteria | 28788 |
| 57 | Ga0105240_10025687 | 3300009093 | Bacteria | 7737 |
| 58 | Ga0105240_10048083 | 3300009093 | Bacteria | 5394 |
| 59 | Ga0105240_10082525 | 3300009093 | Bacteria | 3947 |
| 60 | Ga0105240_10127764 | 3300009093 | Bacteria | 3052 |
| 61 | Ga0105240_10277791 | 3300009093 | Bacteria | 1925 |
| 62 | Ga0105240_11531801 | 3300009093 | Unclassified | 699 |
| 63 | Ga0111539_11633586 | 3300009094 | Bacteria | 747 |
| 64 | Ga0105245_10000109 | 3300009098 | Bacteria | 79725 |
| 65 | Ga0105247_10000445 | 3300009101 | Bacteria | 34975 |
| 66 | Ga0105247_10509666 | 3300009101 | Bacteria | 878 |
| 67 | Ga0105243_10125310 | 3300009148 | Bacteria | 2172 |
| 68 | Ga0105241_10028295 | 3300009174 | Bacteria | 4177 |
| 69 | Ga0105241_10088102 | 3300009174 | Bacteria | 2444 |
| 70 | Ga0105241_11804565 | 3300009174 | Bacteria | 597 |
| 71 | Ga0105242_10001829 | 3300009176 | Bacteria | 16719 |
| 72 | Ga0105242_12489056 | 3300009176 | Bacteria | 566 |
| 73 | Ga0105248_10245252 | 3300009177 | Bacteria | 2017 |
| 74 | Ga0105248_10832703 | 3300009177 | Bacteria | 1041 |
| 75 | Ga0105237_10004558 | 3300009545 | Bacteria | 16006 |
| 76 | Ga0105237_10027403 | 3300009545 | Bacteria | 5817 |
| 77 | Ga0105237_10044089 | 3300009545 | Bacteria | 4491 |
| 78 | Ga0105237_10088234 | 3300009545 | Bacteria | 3091 |
| 79 | Ga0105237_10097190 | 3300009545 | Bacteria | 2935 |
| 80 | Ga0105237_10627100 | 3300009545 | Bacteria | 1082 |
| 81 | Ga0105238_10003617 | 3300009551 | Bacteria | 15408 |
| 82 | Ga0105238_10005938 | 3300009551 | Bacteria | 12101 |
| 83 | Ga0105238_10315524 | 3300009551 | Bacteria | 1549 |
| 84 | Ga0105249_10793449 | 3300009553 | Bacteria | 1011 |
| 85 | Ga0105249_11091875 | 3300009553 | Bacteria | 868 |
| 86 | Ga0105239_10011563 | 3300010375 | Bacteria | 9846 |
| 87 | Ga0105239_12036891 | 3300010375 | Bacteria | 667 |
| 88 | Ga0105246_10051881 | 3300011119 | Bacteria | 2817 |
| 89 | Ga0105246_11080947 | 3300011119 | Bacteria | 731 |
| 90 | Ga0157369_10010225 | 3300013105 | Bacteria | 10708 |
| 91 | Ga0157374_10008730 | 3300013296 | Bacteria | 8670 |
| 92 | Ga0157378_10116991 | 3300013297 | Bacteria | 2452 |
| 93 | Ga0157378_10419259 | 3300013297 | Bacteria | 1323 |
| 94 | Ga0157378_10485791 | 3300013297 | Bacteria | 1231 |
| 95 | Ga0163162_10051873 | 3300013306 | Bacteria | 4117 |
| 96 | Ga0163162_10425737 | 3300013306 | Bacteria | 1460 |
| 97 | Ga0157375_10044998 | 3300013308 | Bacteria | 4294 |
| 98 | Ga0163163_10003694 | 3300014325 | Bacteria | 13023 |
| 99 | Ga0163163_10029874 | 3300014325 | Bacteria | 5244 |
| 100 | Ga0163163_10104546 | 3300014325 | Unclassified | 2857 |
| 101 | Ga0157379_10075406 | 3300014968 | Unclassified | 3020 |
| 102 | Ga0157379_10387452 | 3300014968 | Bacteria | 1283 |
| 103 | Ga0157376_10002390 | 3300014969 | Bacteria | 12680 |
| 104 | Ga0157376_10119024 | 3300014969 | Bacteria | 2338 |
| 105 | Ga0157376_11459294 | 3300014969 | Bacteria | 716 |
| 106 | Ga0213873_10076832 | 3300021358 | Unclassified | 928 |
| 107 | Ga0213876_10002757 | 3300021384 | Bacteria | 10233 |
| 108 | Ga0207710_10000334 | 3300025900 | Bacteria | 35251 |
| 109 | Ga0207680_10590456 | 3300025903 | Bacteria | 794 |
| 110 | Ga0207705_10258635 | 3300025909 | Bacteria | 1329 |
| 111 | Ga0207654_10061050 | 3300025911 | Bacteria | 2204 |
| 112 | Ga0207654_10112978 | 3300025911 | Bacteria | 1693 |
| 113 | Ga0207707_10035495 | 3300025912 | Bacteria | 4360 |
| 114 | Ga0207707_10163598 | 3300025912 | Bacteria | 1945 |
| 115 | Ga0207707_10968164 | 3300025912 | Bacteria | 700 |
| 116 | Ga0207707_11267422 | 3300025912 | Bacteria | 594 |
| 117 | Ga0207695_10006165 | 3300025913 | Bacteria | 15634 |
| 118 | Ga0207695_10083957 | 3300025913 | Bacteria | 3216 |
| 119 | Ga0207695_10199957 | 3300025913 | Unclassified | 1913 |
| 120 | Ga0207671_10042141 | 3300025914 | Bacteria | 3379 |
| 121 | Ga0207671_10048255 | 3300025914 | Bacteria | 3152 |
| 122 | Ga0207671_10077400 | 3300025914 | Bacteria | 2490 |
| 123 | Ga0207671_10237751 | 3300025914 | Bacteria | 1430 |
| 124 | Ga0207657_10514947 | 3300025919 | Bacteria | 937 |
| 125 | Ga0207652_10402463 | 3300025921 | Bacteria | 1235 |
| 126 | Ga0207694_10005456 | 3300025924 | Bacteria | 9773 |
| 127 | Ga0207694_10182296 | 3300025924 | Bacteria | 1703 |
| 128 | Ga0207687_10000200 | 3300025927 | Bacteria | 40532 |
| 129 | Ga0207687_10092161 | 3300025927 | Bacteria | 2212 |
| 130 | Ga0207644_10001248 | 3300025931 | Bacteria | 16369 |
| 131 | Ga0207686_10133063 | 3300025934 | Bacteria | 1708 |
| 132 | Ga0207709_10083857 | 3300025935 | Bacteria | 2062 |
| 133 | Ga0207704_10007335 | 3300025938 | Bacteria | 5204 |
| 134 | Ga0207711_10171992 | 3300025941 | Bacteria | 1966 |
| 135 | Ga0207711_10305855 | 3300025941 | Bacteria | 1467 |
| 136 | Ga0207661_10161339 | 3300025944 | Bacteria | 1945 |
| 137 | Ga0207667_10061328 | 3300025949 | Bacteria | 3934 |
| 138 | Ga0207667_10146675 | 3300025949 | Bacteria | 2429 |
| 139 | Ga0207667_11986557 | 3300025949 | Bacteria | 542 |
| 140 | Ga0207658_10334500 | 3300025986 | Bacteria | 1314 |
| 141 | Ga0207658_11071945 | 3300025986 | Bacteria | 736 |
| 142 | Ga0207703_10264692 | 3300026035 | Unclassified | 1555 |
| 143 | Ga0207703_10512966 | 3300026035 | Bacteria | 1127 |
| 144 | Ga0207703_12248653 | 3300026035 | Bacteria | 521 |
| 145 | Ga0207639_10191801 | 3300026041 | Bacteria | 1746 |
| 146 | Ga0207678_10675286 | 3300026067 | Bacteria | 908 |
| 147 | Ga0207702_10196003 | 3300026078 | Bacteria | 1870 |
| 148 | Ga0207641_10087556 | 3300026088 | Unclassified | 2717 |
| 149 | Ga0207648_10076693 | 3300026089 | Bacteria | 2914 |
| 150 | Ga0207674_10024644 | 3300026116 | Bacteria | 6425 |
| 151 | Ga0207674_10153497 | 3300026116 | Bacteria | 2259 |
| 152 | Ga0207674_10238575 | 3300026116 | Bacteria | 1765 |
| 153 | Ga0207683_11232405 | 3300026121 | Bacteria | 693 |
| 154 | Ga0207698_10876016 | 3300026142 | Unclassified | 904 |
| 155 | Ga0268266_10001047 | 3300028379 | Bacteria | 34703 |
| 156 | Ga0268266_10369157 | 3300028379 | Unclassified | 1351 |
| 157 | Ga0268265_10321840 | 3300028380 | Bacteria | 1401 |
| 158 | Ga0268264_10104136 | 3300028381 | Unclassified | 2473 |
| 159 | Ga0268264_11084426 | 3300028381 | Bacteria | 809 |
| 160 | Ga0268264_11273096 | 3300028381 | Bacteria | 745 |
| 161 | Ga0268264_11578942 | 3300028381 | Bacteria | 667 |
| 162 | Ga0307515_10008608 | 3300028794 | Bacteria | 19864 |
| 163 | Ga0265324_10058096 | 3300029957 | Bacteria | 1324 |
| 164 | Ga0307511_10127722 | 3300030521 | Bacteria | 1544 |
| 165 | Ga0265332_10004581 | 3300031238 | Bacteria | 6470 |
| 166 | Ga0265339_10000189 | 3300031249 | Bacteria | 51800 |
| 167 | Ga0265316_10000794 | 3300031344 | Bacteria | 34821 |
| 168 | Ga0307509_10000829 | 3300031507 | Bacteria | 53068 |
| 169 | Ga0307509_10006755 | 3300031507 | Bacteria | 15279 |
| 170 | Ga0307509_10024763 | 3300031507 | Bacteria | 6716 |
| 171 | Ga0307509_10734560 | 3300031507 | Bacteria | 653 |
| 172 | Ga0307508_10008159 | 3300031616 | Bacteria | 9709 |
| 173 | Ga0307508_10210075 | 3300031616 | Bacteria | 1547 |
| 174 | Ga0265314_10000001 | 3300031711 | Bacteria | 3792860 |
| 175 | Ga0307516_10150219 | 3300031730 | Bacteria | 2091 |
| 176 | Ga0307507_10015952 | 3300033179 | Bacteria | 8788 |
| 177 | Ga0307507_10042082 | 3300033179 | Bacteria | 4560 |
| 178 | Ga0307510_10532022 | 3300033180 | Bacteria | 620 |
| 179 | Ga0373925_1099060 | 3300037068 | Bacteria | 654 |
| 180 | Ga0395899_0010131 | 3300037312 | Bacteria | 7227 |
| 181 | Ga0395900_0008027 | 3300037418 | Bacteria | 10863 |
| 182 | Ga0395898_0002853 | 3300037466 | Bacteria | 19760 |
| 183 | Ga0395898_0124689 | 3300037466 | Bacteria | 2467 |
| 184 | Ga0395898_0201915 | 3300037466 | Bacteria | 1898 |
| 185 | Ga0395898_0360296 | 3300037466 | Bacteria | 1387 |
| 186 | Ga0395905_1419923 | 3300037471 | Unclassified | 598 |
| 187 | Ga0436364_0962317 | 3300037853 | Bacteria | 14426 |
| 188 | Ga0395901_0021350 | 3300038443 | Bacteria | 6633 |
| 189 | Ga0436365_1712698 | 3300039437 | Bacteria | 20322 |
| 190 | Ga0436362_0449493 | 3300039453 | Unclassified | 1666 |
| 191 | Ga0451793_0646439 | 3300041452 | Bacteria | 1260 |
| 192 | Ga0451807_0919810 | 3300041486 | Bacteria | 658 |
| 193 | Ga0466969_0001656 | 3300044656 | Bacteria | 11935 |
| 194 | Ga0466969_0029234 | 3300044656 | Bacteria | 2815 |
| 195 | Ga0466966_0001467 | 3300044684 | Bacteria | 15177 |
| 196 | Ga0466966_0418509 | 3300044684 | Bacteria | 805 |
| 197 | Ga0466961_0017411 | 3300044693 | Bacteria | 4615 |
| 198 | Ga0466961_0345689 | 3300044693 | Bacteria | 906 |
| 199 | Ga0466961_0677849 | 3300044693 | Bacteria | 618 |
| 200 | Ga0466964_0000571 | 3300044706 | Bacteria | 11587 |
| 201 | Ga0466971_0014140 | 3300044719 | Bacteria | 3508 |
| 202 | Ga0466971_0470539 | 3300044719 | Bacteria | 618 |
| 203 | Ga0466968_0391183 | 3300044735 | Bacteria | 680 |
| 204 | Ga0466970_0008652 | 3300044765 | Bacteria | 5128 |
| 205 | Ga0466957_0381499 | 3300044842 | Bacteria | 961 |
| 206 | Ga0466960_0347328 | 3300044901 | Bacteria | 845 |
| 207 | Ga0466959_0002031 | 3300045049 | Bacteria | 12781 |
| 208 | Ga0466959_0036457 | 3300045049 | Bacteria | 3634 |
| 209 | Ga0466959_0042708 | 3300045049 | Bacteria | 3344 |
| 210 | Ga0466959_0044228 | 3300045049 | Bacteria | 3281 |
| 211 | Ga0466959_0171639 | 3300045049 | Bacteria | 1521 |
| 212 | Ga0466959_0296365 | 3300045049 | Bacteria | 1108 |
| 213 | Ga0466959_0391700 | 3300045049 | Bacteria | 945 |
| 214 | Ga0466958_0133355 | 3300045836 | Bacteria | 1561 |
| 215 | Ga0466958_0265738 | 3300045836 | Unclassified | 1098 |
| 216 | Ga0466958_0706090 | 3300045836 | Bacteria | 657 |
| 217 | Ga0466967_0543392 | 3300045976 | Bacteria | 1143 |
| 218 | Ga0495596_0284852 | 3300046500 | Bacteria | 642 |
| 219 | Ga0495643_0060674 | 3300046522 | Bacteria | 2007 |
| 220 | Ga0495589_0103531 | 3300046794 | Bacteria | 1376 |
| 221 | Ga0495683_0443143 | 3300047323 | Bacteria | 534 |
| 222 | Ga0495602_0667313 | 3300048088 | Bacteria | 708 |
| 223 | Ga0496100_0169148 | 3300048903 | Bacteria | 1572 |
| 224 | Ga0496101_0137906 | 3300048904 | Bacteria | 1857 |
| 225 | Ga0496102_0017007 | 3300048905 | Bacteria | 6365 |
| 226 | Ga0496103_0088660 | 3300048906 | Unclassified | 1951 |
| 227 | Ga0496104_0247476 | 3300048907 | Bacteria | 1695 |
| 228 | Ga0496105_0005709 | 3300048908 | Bacteria | 9472 |
| 229 | Ga0496107_0064141 | 3300048910 | Bacteria | 2663 |
| 230 | Ga0496107_0329016 | 3300048910 | Bacteria | 1137 |
| 231 | Ga0496116_0167767 | 3300048919 | Bacteria | 1194 |
| 232 | Ga0496117_0140472 | 3300048920 | Bacteria | 1447 |
| 233 | Ga0496117_0218230 | 3300048920 | Bacteria | 1063 |
| 234 | Ga0496118_0004157 | 3300048921 | Bacteria | 17480 |
| 235 | Ga0496118_0005013 | 3300048921 | Bacteria | 15296 |
| 236 | Ga0496119_0000030 | 3300048922 | Bacteria | 240167 |
| 237 | Ga0496120_0000033 | 3300048923 | Bacteria | 218355 |
| 238 | Ga0496121_0000063 | 3300048924 | Bacteria | 273080 |
| 239 | Ga0496121_0009623 | 3300048924 | Bacteria | 11069 |
| 240 | Ga0496121_0014157 | 3300048924 | Bacteria | 8495 |
| 241 | Ga0496121_0400401 | 3300048924 | Unclassified | 899 |
| 242 | Ga0496125_0012911 | 3300048928 | Bacteria | 8246 |
| 243 | Ga0496126_0000134 | 3300048929 | Bacteria | 169693 |
| 244 | Ga0496126_0038663 | 3300048929 | Bacteria | 4436 |
| 245 | Ga0496126_0233218 | 3300048929 | Unclassified | 1541 |
| 246 | Ga0501033_0028778 | 3300049570 | Bacteria | 4175 |
| 247 | Ga0501036_0437533 | 3300049572 | Bacteria | 1090 |
| 248 | Ga0501037_0401937 | 3300049573 | Bacteria | 939 |
| 249 | Ga0501038_0070063 | 3300049574 | Bacteria | 2978 |
| 250 | Ga0501042_1186196 | 3300049578 | Bacteria | 557 |
| 251 | Ga0501043_0536054 | 3300049579 | Bacteria | 871 |
| 252 | Ga0501047_0191718 | 3300049581 | Bacteria | 1907 |
| 253 | Ga0501067_0022343 | 3300049583 | Bacteria | 3501 |
| 254 | Ga0501071_0332662 | 3300049587 | Bacteria | 1155 |
| 255 | Ga0501044_0040025 | 3300049823 | Bacteria | 4887 |
| 256 | Ga0500635_0007307 | 3300053080 | Bacteria | 2992 |
| 257 | Ga0500646_0010672 | 3300053090 | Bacteria | 2357 |
| 258 | Ga0500583_0267046 | 3300053092 | Bacteria | 842 |
| 259 | Ga0500566_0001723 | 3300053094 | Bacteria | 12840 |
| 260 | Ga0500566_0314794 | 3300053094 | Bacteria | 731 |
| 261 | Ga0500595_143517 | 3300053119 | Bacteria | 669 |
| 262 | Ga0500597_186041 | 3300053120 | Bacteria | 878 |
| 263 | Ga0500614_004919 | 3300053123 | Bacteria | 2811 |
| 264 | Ga0500642_0020645 | 3300053130 | Bacteria | 2593 |
| 265 | Ga0500585_062058 | 3300053144 | Bacteria | 1346 |
| 266 | Ga0500603_001157 | 3300053150 | Bacteria | 6152 |
| 267 | Ga0500616_0006526 | 3300053153 | Bacteria | 7624 |
| 268 | Ga0500620_157276 | 3300053155 | Bacteria | 790 |
| 269 | Ga0500636_0393594 | 3300053177 | Bacteria | 645 |
| 270 | Ga0500637_0029679 | 3300053178 | Bacteria | 3036 |
| 271 | Ga0501082_0102478 | 3300060353 | Bacteria | 2476 |
| 272 | Ga0466962_0082205 | 3300061719 | Bacteria | 1540 |
| 273 | Ga0466962_0272120 | 3300061719 | Bacteria | 835 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053080 | Ga0500635_0007307 | Ga0500635_0007307_1800_2177 | 113 |
| 2 | 3300053094 | Ga0500566_0001723 | Ga0500566_0001723_2293_2670 | 113 |
| 3 | 3300053144 | Ga0500585_062058 | Ga0500585_062058_405_782 | 113 |
| 4 | 3300053150 | Ga0500603_001157 | Ga0500603_001157_1809_2186 | 113 |
| 5 | 3300053155 | Ga0500620_157276 | Ga0500620_157276_154_531 | 113 |
| 6 | 3300005719 | Ga0068861_100617278 | Ga0068861_1006172783 | 114 |
| 7 | 3300005843 | Ga0068860_100585618 | Ga0068860_1005856182 | 114 |
| 8 | 3300005844 | Ga0068862_100246316 | Ga0068862_1002463162 | 114 |
| 9 | 3300009093 | Ga0105240_10025687 | Ga0105240_100256878 | 114 |
| 10 | 3300009148 | Ga0105243_10125310 | Ga0105243_101253103 | 114 |
| 11 | 3300009176 | Ga0105242_12489056 | Ga0105242_124890562 | 114 |
| 12 | 3300009545 | Ga0105237_10097190 | Ga0105237_100971902 | 114 |
| 13 | 3300009551 | Ga0105238_10315524 | Ga0105238_103155243 | 114 |
| 14 | 3300013297 | Ga0157378_10116991 | Ga0157378_101169915 | 114 |
| 15 | 3300025935 | Ga0207709_10083857 | Ga0207709_100838572 | 114 |
| 16 | 3300028380 | Ga0268265_10321840 | Ga0268265_103218402 | 114 |
| 17 | 3300028381 | Ga0268264_11273096 | Ga0268264_112730962 | 114 |
| 18 | 3300029957 | Ga0265324_10058096 | Ga0265324_100580962 | 114 |
| 19 | 3300031249 | Ga0265339_10000189 | Ga0265339_1000018933 | 114 |
| 20 | 3300031344 | Ga0265316_10000794 | Ga0265316_1000079410 | 114 |
| 21 | 3300031711 | Ga0265314_10000001 | Ga0265314_100000013112 | 114 |
| 22 | 3300053153 | Ga0500616_0006526 | Ga0500616_0006526_3517_3864 | 114 |
| 23 | 3300031507 | Ga0307509_10006755 | Ga0307509_100067556 | 115 |
| 24 | 3300044735 | Ga0466968_0391183 | Ga0466968_0391183_288_638 | 115 |
| 25 | 3300046500 | Ga0495596_0284852 | Ga0495596_0284852_240_599 | 115 |
| 26 | 3300003323 | rootH1_10031452 | rootH1_100314524 | 116 |
| 27 | 3300005548 | Ga0070665_100002611 | Ga0070665_10000261118 | 116 |
| 28 | 3300005548 | Ga0070665_100632665 | Ga0070665_1006326652 | 116 |
| 29 | 3300009093 | Ga0105240_10127764 | Ga0105240_101277644 | 116 |
| 30 | 3300009101 | Ga0105247_10509666 | Ga0105247_105096662 | 116 |
| 31 | 3300009545 | Ga0105237_10027403 | Ga0105237_100274035 | 116 |
| 32 | 3300009545 | Ga0105237_10088234 | Ga0105237_100882343 | 116 |
| 33 | 3300009551 | Ga0105238_10005938 | Ga0105238_100059387 | 116 |
| 34 | 3300010375 | Ga0105239_12036891 | Ga0105239_120368912 | 116 |
| 35 | 3300014968 | Ga0157379_10387452 | Ga0157379_103874522 | 116 |
| 36 | 3300014969 | Ga0157376_11459294 | Ga0157376_114592942 | 116 |
| 37 | 3300025914 | Ga0207671_10077400 | Ga0207671_100774003 | 116 |
| 38 | 3300025924 | Ga0207694_10005456 | Ga0207694_100054564 | 116 |
| 39 | 3300025949 | Ga0207667_11986557 | Ga0207667_119865571 | 116 |
| 40 | 3300025986 | Ga0207658_11071945 | Ga0207658_110719451 | 116 |
| 41 | 3300026067 | Ga0207678_10675286 | Ga0207678_106752862 | 116 |
| 42 | 3300028379 | Ga0268266_10001047 | Ga0268266_100010478 | 116 |
| 43 | 3300037466 | Ga0395898_0002853 | Ga0395898_0002853_13690_14043 | 116 |
| 44 | 3300037466 | Ga0395898_0360296 | Ga0395898_0360296_466_864 | 116 |
| 45 | 3300044656 | Ga0466969_0001656 | Ga0466969_0001656_4641_4994 | 116 |
| 46 | 3300044684 | Ga0466966_0001467 | Ga0466966_0001467_10128_10481 | 116 |
| 47 | 3300044684 | Ga0466966_0418509 | Ga0466966_0418509_179_532 | 116 |
| 48 | 3300044693 | Ga0466961_0017411 | Ga0466961_0017411_2045_2398 | 116 |
| 49 | 3300044693 | Ga0466961_0677849 | Ga0466961_0677849_206_559 | 116 |
| 50 | 3300044706 | Ga0466964_0000571 | Ga0466964_0000571_6830_7183 | 116 |
| 51 | 3300044719 | Ga0466971_0014140 | Ga0466971_0014140_2057_2410 | 116 |
| 52 | 3300044765 | Ga0466970_0008652 | Ga0466970_0008652_2558_2911 | 116 |
| 53 | 3300044842 | Ga0466957_0381499 | Ga0466957_0381499_211_564 | 116 |
| 54 | 3300045049 | Ga0466959_0044228 | Ga0466959_0044228_307_660 | 116 |
| 55 | 3300045049 | Ga0466959_0171639 | Ga0466959_0171639_1026_1379 | 116 |
| 56 | 3300045836 | Ga0466958_0133355 | Ga0466958_0133355_327_680 | 116 |
| 57 | 3300045836 | Ga0466958_0706090 | Ga0466958_0706090_96_449 | 116 |
| 58 | 3300048907 | Ga0496104_0247476 | Ga0496104_0247476_253_606 | 116 |
| 59 | 3300048908 | Ga0496105_0005709 | Ga0496105_0005709_274_627 | 116 |
| 60 | 3300048910 | Ga0496107_0064141 | Ga0496107_0064141_2024_2377 | 116 |
| 61 | 3300048919 | Ga0496116_0167767 | Ga0496116_0167767_698_1051 | 116 |
| 62 | 3300048920 | Ga0496117_0140472 | Ga0496117_0140472_108_461 | 116 |
| 63 | 3300048921 | Ga0496118_0005013 | Ga0496118_0005013_14778_15131 | 116 |
| 64 | 3300048922 | Ga0496119_0000030 | Ga0496119_0000030_101826_102179 | 116 |
| 65 | 3300048923 | Ga0496120_0000033 | Ga0496120_0000033_137997_138350 | 116 |
| 66 | 3300048924 | Ga0496121_0000063 | Ga0496121_0000063_113953_114306 | 116 |
| 67 | 3300048924 | Ga0496121_0400401 | Ga0496121_0400401_389_742 | 116 |
| 68 | 3300048929 | Ga0496126_0038663 | Ga0496126_0038663_2676_3029 | 116 |
| 69 | 3300061719 | Ga0466962_0082205 | Ga0466962_0082205_878_1231 | 116 |
| 70 | 3300003322 | rootL2_10033260 | rootL2_100332604 | 117 |
| 71 | 3300005327 | Ga0070658_10207384 | Ga0070658_102073842 | 117 |
| 72 | 3300006358 | Ga0068871_101358119 | Ga0068871_1013581191 | 117 |
| 73 | 3300009093 | Ga0105240_10277791 | Ga0105240_102777913 | 117 |
| 74 | 3300009093 | Ga0105240_11531801 | Ga0105240_115318012 | 117 |
| 75 | 3300021358 | Ga0213873_10076832 | Ga0213873_100768321 | 117 |
| 76 | 3300021384 | Ga0213876_10002757 | Ga0213876_100027577 | 117 |
| 77 | 3300025909 | Ga0207705_10258635 | Ga0207705_102586352 | 117 |
| 78 | 3300025913 | Ga0207695_10083957 | Ga0207695_100839574 | 117 |
| 79 | 3300033180 | Ga0307510_10532022 | Ga0307510_105320222 | 117 |
| 80 | 3300037312 | Ga0395899_0010131 | Ga0395899_0010131_4819_5175 | 117 |
| 81 | 3300037418 | Ga0395900_0008027 | Ga0395900_0008027_547_903 | 117 |
| 82 | 3300037466 | Ga0395898_0124689 | Ga0395898_0124689_1094_1450 | 117 |
| 83 | 3300037471 | Ga0395905_1419923 | Ga0395905_1419923_158_517 | 117 |
| 84 | 3300037853 | Ga0436364_0962317 | Ga0436364_0962317_1308_1679 | 117 |
| 85 | 3300038443 | Ga0395901_0021350 | Ga0395901_0021350_1222_1578 | 117 |
| 86 | 3300039437 | Ga0436365_1712698 | Ga0436365_1712698_13221_13592 | 117 |
| 87 | 3300039453 | Ga0436362_0449493 | Ga0436362_0449493_497_868 | 117 |
| 88 | 3300041452 | Ga0451793_0646439 | Ga0451793_0646439_39_422 | 117 |
| 89 | 3300041486 | Ga0451807_0919810 | Ga0451807_0919810_77_433 | 117 |
| 90 | 3300048088 | Ga0495602_0667313 | Ga0495602_0667313_38_397 | 117 |
| 91 | 3300048903 | Ga0496100_0169148 | Ga0496100_0169148_323_679 | 117 |
| 92 | 3300048904 | Ga0496101_0137906 | Ga0496101_0137906_1180_1536 | 117 |
| 93 | 3300048910 | Ga0496107_0329016 | Ga0496107_0329016_189_545 | 117 |
| 94 | 3300048920 | Ga0496117_0218230 | Ga0496117_0218230_600_956 | 117 |
| 95 | 3300048921 | Ga0496118_0004157 | Ga0496118_0004157_17087_17443 | 117 |
| 96 | 3300048924 | Ga0496121_0014157 | Ga0496121_0014157_7073_7429 | 117 |
| 97 | 3300048929 | Ga0496126_0000134 | Ga0496126_0000134_295_651 | 117 |
| 98 | 3300003323 | rootH1_10116647 | rootH1_101166473 | 118 |
| 99 | 3300003323 | rootH1_10149821 | rootH1_101498213 | 118 |
| 100 | 3300005329 | Ga0070683_100190930 | Ga0070683_1001909305 | 118 |
| 101 | 3300005330 | Ga0070690_100934002 | Ga0070690_1009340022 | 118 |
| 102 | 3300005335 | Ga0070666_10172574 | Ga0070666_101725742 | 118 |
| 103 | 3300005355 | Ga0070671_100000196 | Ga0070671_10000019628 | 118 |
| 104 | 3300005356 | Ga0070674_100760749 | Ga0070674_1007607491 | 118 |
| 105 | 3300005367 | Ga0070667_100048708 | Ga0070667_1000487083 | 118 |
| 106 | 3300005459 | Ga0068867_100091934 | Ga0068867_1000919344 | 118 |
| 107 | 3300005530 | Ga0070679_100470566 | Ga0070679_1004705663 | 118 |
| 108 | 3300005535 | Ga0070684_100625336 | Ga0070684_1006253362 | 118 |
| 109 | 3300005536 | Ga0070697_100713136 | Ga0070697_1007131361 | 118 |
| 110 | 3300005539 | Ga0068853_100295631 | Ga0068853_1002956312 | 118 |
| 111 | 3300005544 | Ga0070686_100236964 | Ga0070686_1002369643 | 118 |
| 112 | 3300005548 | Ga0070665_100270917 | Ga0070665_1002709172 | 118 |
| 113 | 3300005563 | Ga0068855_100040504 | Ga0068855_1000405046 | 118 |
| 114 | 3300005563 | Ga0068855_100195554 | Ga0068855_1001955544 | 118 |
| 115 | 3300005577 | Ga0068857_100054391 | Ga0068857_1000543913 | 118 |
| 116 | 3300005614 | Ga0068856_100178370 | Ga0068856_1001783703 | 118 |
| 117 | 3300005614 | Ga0068856_102607006 | Ga0068856_1026070062 | 118 |
| 118 | 3300005616 | Ga0068852_100844660 | Ga0068852_1008446602 | 118 |
| 119 | 3300005617 | Ga0068859_100002402 | Ga0068859_10000240218 | 118 |
| 120 | 3300005841 | Ga0068863_100005215 | Ga0068863_10000521513 | 118 |
| 121 | 3300005842 | Ga0068858_100000113 | Ga0068858_10000011333 | 118 |
| 122 | 3300005843 | Ga0068860_100040823 | Ga0068860_1000408236 | 118 |
| 123 | 3300005843 | Ga0068860_101755908 | Ga0068860_1017559082 | 118 |
| 124 | 3300006237 | Ga0097621_100005603 | Ga0097621_1000056039 | 118 |
| 125 | 3300006358 | Ga0068871_100020500 | Ga0068871_1000205005 | 118 |
| 126 | 3300006881 | Ga0068865_100005358 | Ga0068865_1000053586 | 118 |
| 127 | 3300006931 | Ga0097620_100002402 | Ga0097620_10000240218 | 118 |
| 128 | 3300009092 | Ga0105250_10013358 | Ga0105250_100133582 | 118 |
| 129 | 3300009093 | Ga0105240_10048083 | Ga0105240_100480835 | 118 |
| 130 | 3300009093 | Ga0105240_10082525 | Ga0105240_100825256 | 118 |
| 131 | 3300009101 | Ga0105247_10000445 | Ga0105247_1000044518 | 118 |
| 132 | 3300009174 | Ga0105241_10028295 | Ga0105241_100282953 | 118 |
| 133 | 3300009174 | Ga0105241_11804565 | Ga0105241_118045652 | 118 |
| 134 | 3300009176 | Ga0105242_10001829 | Ga0105242_100018294 | 118 |
| 135 | 3300009177 | Ga0105248_10832703 | Ga0105248_108327032 | 118 |
| 136 | 3300009545 | Ga0105237_10044089 | Ga0105237_100440895 | 118 |
| 137 | 3300009545 | Ga0105237_10627100 | Ga0105237_106271003 | 118 |
| 138 | 3300009551 | Ga0105238_10003617 | Ga0105238_100036179 | 118 |
| 139 | 3300009553 | Ga0105249_10793449 | Ga0105249_107934492 | 118 |
| 140 | 3300009553 | Ga0105249_11091875 | Ga0105249_110918752 | 118 |
| 141 | 3300010375 | Ga0105239_10011563 | Ga0105239_1001156310 | 118 |
| 142 | 3300011119 | Ga0105246_10051881 | Ga0105246_100518814 | 118 |
| 143 | 3300013105 | Ga0157369_10010225 | Ga0157369_1001022514 | 118 |
| 144 | 3300013296 | Ga0157374_10008730 | Ga0157374_100087309 | 118 |
| 145 | 3300013297 | Ga0157378_10419259 | Ga0157378_104192591 | 118 |
| 146 | 3300013306 | Ga0163162_10051873 | Ga0163162_100518735 | 118 |
| 147 | 3300013306 | Ga0163162_10425737 | Ga0163162_104257372 | 118 |
| 148 | 3300013308 | Ga0157375_10044998 | Ga0157375_100449985 | 118 |
| 149 | 3300014325 | Ga0163163_10029874 | Ga0163163_100298744 | 118 |
| 150 | 3300014325 | Ga0163163_10104546 | Ga0163163_101045463 | 118 |
| 151 | 3300014968 | Ga0157379_10075406 | Ga0157379_100754064 | 118 |
| 152 | 3300025900 | Ga0207710_10000334 | Ga0207710_1000033418 | 118 |
| 153 | 3300025903 | Ga0207680_10590456 | Ga0207680_105904562 | 118 |
| 154 | 3300025913 | Ga0207695_10199957 | Ga0207695_101999572 | 118 |
| 155 | 3300025914 | Ga0207671_10237751 | Ga0207671_102377512 | 118 |
| 156 | 3300025931 | Ga0207644_10001248 | Ga0207644_1000124814 | 118 |
| 157 | 3300025941 | Ga0207711_10305855 | Ga0207711_103058552 | 118 |
| 158 | 3300025949 | Ga0207667_10146675 | Ga0207667_101466754 | 118 |
| 159 | 3300025986 | Ga0207658_10334500 | Ga0207658_103345002 | 118 |
| 160 | 3300026035 | Ga0207703_10264692 | Ga0207703_102646922 | 118 |
| 161 | 3300026035 | Ga0207703_10512966 | Ga0207703_105129662 | 118 |
| 162 | 3300026088 | Ga0207641_10087556 | Ga0207641_100875563 | 118 |
| 163 | 3300028379 | Ga0268266_10369157 | Ga0268266_103691573 | 118 |
| 164 | 3300028381 | Ga0268264_10104136 | Ga0268264_101041363 | 118 |
| 165 | 3300028381 | Ga0268264_11084426 | Ga0268264_110844262 | 118 |
| 166 | 3300028794 | Ga0307515_10008608 | Ga0307515_1000860818 | 118 |
| 167 | 3300030521 | Ga0307511_10127722 | Ga0307511_101277222 | 118 |
| 168 | 3300031238 | Ga0265332_10004581 | Ga0265332_100045815 | 118 |
| 169 | 3300031507 | Ga0307509_10000829 | Ga0307509_100008294 | 118 |
| 170 | 3300031507 | Ga0307509_10024763 | Ga0307509_100247634 | 118 |
| 171 | 3300031507 | Ga0307509_10734560 | Ga0307509_107345601 | 118 |
| 172 | 3300031616 | Ga0307508_10008159 | Ga0307508_100081596 | 118 |
| 173 | 3300031616 | Ga0307508_10210075 | Ga0307508_102100753 | 118 |
| 174 | 3300031730 | Ga0307516_10150219 | Ga0307516_101502193 | 118 |
| 175 | 3300033179 | Ga0307507_10042082 | Ga0307507_100420823 | 118 |
| 176 | 3300037466 | Ga0395898_0201915 | Ga0395898_0201915_1303_1665 | 118 |
| 177 | 3300044656 | Ga0466969_0029234 | Ga0466969_0029234_1757_2119 | 118 |
| 178 | 3300044693 | Ga0466961_0345689 | Ga0466961_0345689_93_455 | 118 |
| 179 | 3300044719 | Ga0466971_0470539 | Ga0466971_0470539_66_428 | 118 |
| 180 | 3300045049 | Ga0466959_0002031 | Ga0466959_0002031_265_627 | 118 |
| 181 | 3300045049 | Ga0466959_0036457 | Ga0466959_0036457_1185_1547 | 118 |
| 182 | 3300045049 | Ga0466959_0042708 | Ga0466959_0042708_595_957 | 118 |
| 183 | 3300045049 | Ga0466959_0296365 | Ga0466959_0296365_111_542 | 118 |
| 184 | 3300045049 | Ga0466959_0391700 | Ga0466959_0391700_140_505 | 118 |
| 185 | 3300045836 | Ga0466958_0265738 | Ga0466958_0265738_35_397 | 118 |
| 186 | 3300046522 | Ga0495643_0060674 | Ga0495643_0060674_585_947 | 118 |
| 187 | 3300047323 | Ga0495683_0443143 | Ga0495683_0443143_132_494 | 118 |
| 188 | 3300048905 | Ga0496102_0017007 | Ga0496102_0017007_5471_5833 | 118 |
| 189 | 3300048906 | Ga0496103_0088660 | Ga0496103_0088660_42_431 | 118 |
| 190 | 3300048924 | Ga0496121_0009623 | Ga0496121_0009623_10280_10642 | 118 |
| 191 | 3300048928 | Ga0496125_0012911 | Ga0496125_0012911_6977_7339 | 118 |
| 192 | 3300048929 | Ga0496126_0233218 | Ga0496126_0233218_1011_1373 | 118 |
| 193 | 3300049570 | Ga0501033_0028778 | Ga0501033_0028778_3501_3866 | 118 |
| 194 | 3300049572 | Ga0501036_0437533 | Ga0501036_0437533_456_821 | 118 |
| 195 | 3300049573 | Ga0501037_0401937 | Ga0501037_0401937_420_785 | 118 |
| 196 | 3300049574 | Ga0501038_0070063 | Ga0501038_0070063_1876_2241 | 118 |
| 197 | 3300049581 | Ga0501047_0191718 | Ga0501047_0191718_946_1311 | 118 |
| 198 | 3300049583 | Ga0501067_0022343 | Ga0501067_0022343_1301_1669 | 118 |
| 199 | 3300049823 | Ga0501044_0040025 | Ga0501044_0040025_3665_4030 | 118 |
| 200 | 3300053090 | Ga0500646_0010672 | Ga0500646_0010672_466_834 | 118 |
| 201 | 3300053092 | Ga0500583_0267046 | Ga0500583_0267046_369_737 | 118 |
| 202 | 3300053094 | Ga0500566_0314794 | Ga0500566_0314794_28_396 | 118 |
| 203 | 3300053130 | Ga0500642_0020645 | Ga0500642_0020645_86_451 | 118 |
| 204 | 3300060353 | Ga0501082_0102478 | Ga0501082_0102478_803_1180 | 118 |
| 205 | 3300003322 | rootL2_10264764 | rootL2_102647642 | 119 |
| 206 | 3300005336 | Ga0070680_100404409 | Ga0070680_1004044092 | 119 |
| 207 | 3300005535 | Ga0070684_101874443 | Ga0070684_1018744431 | 119 |
| 208 | 3300005618 | Ga0068864_100753955 | Ga0068864_1007539552 | 119 |
| 209 | 3300005618 | Ga0068864_102019150 | Ga0068864_1020191501 | 119 |
| 210 | 3300009094 | Ga0111539_11633586 | Ga0111539_116335862 | 119 |
| 211 | 3300009098 | Ga0105245_10000109 | Ga0105245_1000010975 | 119 |
| 212 | 3300009177 | Ga0105248_10245252 | Ga0105248_102452523 | 119 |
| 213 | 3300011119 | Ga0105246_11080947 | Ga0105246_110809472 | 119 |
| 214 | 3300013297 | Ga0157378_10485791 | Ga0157378_104857911 | 119 |
| 215 | 3300014969 | Ga0157376_10002390 | Ga0157376_100023905 | 119 |
| 216 | 3300014969 | Ga0157376_10119024 | Ga0157376_101190243 | 119 |
| 217 | 3300025911 | Ga0207654_10061050 | Ga0207654_100610504 | 119 |
| 218 | 3300025912 | Ga0207707_10035495 | Ga0207707_100354953 | 119 |
| 219 | 3300025919 | Ga0207657_10514947 | Ga0207657_105149473 | 119 |
| 220 | 3300025921 | Ga0207652_10402463 | Ga0207652_104024632 | 119 |
| 221 | 3300025924 | Ga0207694_10182296 | Ga0207694_101822963 | 119 |
| 222 | 3300025927 | Ga0207687_10000200 | Ga0207687_100002004 | 119 |
| 223 | 3300025927 | Ga0207687_10092161 | Ga0207687_100921613 | 119 |
| 224 | 3300025934 | Ga0207686_10133063 | Ga0207686_101330633 | 119 |
| 225 | 3300025938 | Ga0207704_10007335 | Ga0207704_100073353 | 119 |
| 226 | 3300025941 | Ga0207711_10171992 | Ga0207711_101719923 | 119 |
| 227 | 3300025944 | Ga0207661_10161339 | Ga0207661_101613394 | 119 |
| 228 | 3300026041 | Ga0207639_10191801 | Ga0207639_101918013 | 119 |
| 229 | 3300026078 | Ga0207702_10196003 | Ga0207702_101960033 | 119 |
| 230 | 3300026089 | Ga0207648_10076693 | Ga0207648_100766935 | 119 |
| 231 | 3300026116 | Ga0207674_10024644 | Ga0207674_100246445 | 119 |
| 232 | 3300026121 | Ga0207683_11232405 | Ga0207683_112324052 | 119 |
| 233 | 3300028381 | Ga0268264_11578942 | Ga0268264_115789422 | 119 |
| 234 | 3300033179 | Ga0307507_10015952 | Ga0307507_100159528 | 119 |
| 235 | 3300037068 | Ga0373925_1099060 | Ga0373925_1099060_160_531 | 119 |
| 236 | 3300044901 | Ga0466960_0347328 | Ga0466960_0347328_185_553 | 119 |
| 237 | 3300045976 | Ga0466967_0543392 | Ga0466967_0543392_344_721 | 119 |
| 238 | 3300049578 | Ga0501042_1186196 | Ga0501042_1186196_117_491 | 119 |
| 239 | 3300049579 | Ga0501043_0536054 | Ga0501043_0536054_39_413 | 119 |
| 240 | 3300049587 | Ga0501071_0332662 | Ga0501071_0332662_346_720 | 119 |
| 241 | 3300053119 | Ga0500595_143517 | Ga0500595_143517_61_441 | 119 |
| 242 | 3300053120 | Ga0500597_186041 | Ga0500597_186041_338_718 | 119 |
| 243 | 3300053123 | Ga0500614_004919 | Ga0500614_004919_1107_1487 | 119 |
| 244 | 3300053177 | Ga0500636_0393594 | Ga0500636_0393594_66_446 | 119 |
| 245 | 3300053178 | Ga0500637_0029679 | Ga0500637_0029679_589_969 | 119 |
| 246 | 3300061719 | Ga0466962_0272120 | Ga0466962_0272120_289_660 | 119 |
| 247 | 3300003320 | rootH2_10163557 | rootH2_101635573 | 120 |
| 248 | 3300003322 | rootL2_10125555 | rootL2_101255552 | 120 |
| 249 | 3300005336 | Ga0070680_100118282 | Ga0070680_1001182824 | 120 |
| 250 | 3300005341 | Ga0070691_10463066 | Ga0070691_104630661 | 120 |
| 251 | 3300005458 | Ga0070681_10185646 | Ga0070681_101856465 | 120 |
| 252 | 3300005458 | Ga0070681_10544105 | Ga0070681_105441051 | 120 |
| 253 | 3300005530 | Ga0070679_100015171 | Ga0070679_10001517110 | 120 |
| 254 | 3300005577 | Ga0068857_100084719 | Ga0068857_1000847193 | 120 |
| 255 | 3300005577 | Ga0068857_100217325 | Ga0068857_1002173253 | 120 |
| 256 | 3300005614 | Ga0068856_100108423 | Ga0068856_1001084233 | 120 |
| 257 | 3300009093 | Ga0105240_10002612 | Ga0105240_1000261220 | 120 |
| 258 | 3300009174 | Ga0105241_10088102 | Ga0105241_100881024 | 120 |
| 259 | 3300009545 | Ga0105237_10004558 | Ga0105237_100045584 | 120 |
| 260 | 3300014325 | Ga0163163_10003694 | Ga0163163_100036948 | 120 |
| 261 | 3300025911 | Ga0207654_10112978 | Ga0207654_101129782 | 120 |
| 262 | 3300025912 | Ga0207707_10163598 | Ga0207707_101635981 | 120 |
| 263 | 3300025912 | Ga0207707_10968164 | Ga0207707_109681641 | 120 |
| 264 | 3300025912 | Ga0207707_11267422 | Ga0207707_112674222 | 120 |
| 265 | 3300025913 | Ga0207695_10006165 | Ga0207695_100061656 | 120 |
| 266 | 3300025914 | Ga0207671_10042141 | Ga0207671_100421414 | 120 |
| 267 | 3300025914 | Ga0207671_10048255 | Ga0207671_100482554 | 120 |
| 268 | 3300025949 | Ga0207667_10061328 | Ga0207667_100613285 | 120 |
| 269 | 3300026035 | Ga0207703_12248653 | Ga0207703_122486531 | 120 |
| 270 | 3300026116 | Ga0207674_10153497 | Ga0207674_101534973 | 120 |
| 271 | 3300026116 | Ga0207674_10238575 | Ga0207674_102385751 | 120 |
| 272 | 3300026142 | Ga0207698_10876016 | Ga0207698_108760163 | 120 |
| 273 | 3300046794 | Ga0495589_0103531 | Ga0495589_0103531_341_715 | 120 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5yrz-assembly1.cif.gz_D | toxin-antitoxin complex from streptococcus pneumoniae | 0.8095 | 13 | 53 |
| 3oxh-assembly1.cif.gz_A | mycobacterium tuberculosis kinase inhibitor homolog rv0577 | 0.7509 | 3 | 112 |
| 5ywg-assembly1.cif.gz_B | crystal structure of arabidopsis thaliana hppd complexed with mesotrione | 0.7463 | 3 | 112 |
| 6xbv-assembly1.cif.gz_A-2 | streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa | 0.7422 | 2 | 114 |
| 3hdp-assembly1.cif.gz_A | crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum | 0.7397 | 1 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bt3B02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8853 | 85 | 113 | 3.30.720.110 |
| 5yrzD00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. | 0.8095 | 13 | 53 | 3.30.920.30 |
| af_Q2FYM3_1_61_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7964 | 5 | 60 | 3.10.180.10 |
| 6g26F00 | Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. | 0.7904 | 13 | 54 | 3.30.920.30 |
| 2kjzB01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7904 | 1 | 55 | 3.30.720.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-L7PKA0-F1-model_v4 | Glyoxalase | 0.9652 | 1 | 115 |
|
| AF-A0A369UZ12-F1-model_v4 | VOC family protein | 0.9297 | 1 | 117 |
|
| AF-A0A1T4S1E5-F1-model_v4 | Ribbon-helix-helix protein, copG family | 0.9289 | 1 | 114 |
GO:0006355
|
| AF-A0A369UZ12-F1-model_v4 | VOC family protein | 0.9223 | 1 | 117 |
|
| AF-A0A1M9YHC2-F1-model_v4 | deleted | 0.9137 | 69 | 115 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar