F378789

General Info

Members Datasets Scaffolds Average Seq Length
273 171 273 121

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10031452|rootH1_100314524
Length 121
Sequence MTTRGIDMVLVETHNFGKTVAFWKSLGYELEFETDHHSGRLVHPSGAAPAIFVAERPPGQALEVVLGVSVKAPEDFRPPTSGTVRQPFEMQHWGALQMLVADPDERIVAVEAPAPKGEGAK

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
161 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
162 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
163 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
164 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
165 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
168 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
169 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 3.66
Rhizosphere 77.29
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10163557 3300003320 Bacteria 3010
2 rootL2_10033260 3300003322 Bacteria 3203
3 rootL2_10125555 3300003322 Unclassified 1880
4 rootL2_10264764 3300003322 Bacteria 2051
5 rootH1_10031452 3300003323 Bacteria 5727
6 rootH1_10116647 3300003323 Bacteria 2895
7 rootH1_10149821 3300003323 Bacteria 2673
8 Ga0070658_10207384 3300005327 Bacteria 1655
9 Ga0070683_100190930 3300005329 Bacteria 1945
10 Ga0070690_100934002 3300005330 Bacteria 680
11 Ga0070666_10172574 3300005335 Unclassified 1515
12 Ga0070680_100118282 3300005336 Bacteria 2210
13 Ga0070680_100404409 3300005336 Bacteria 1164
14 Ga0070691_10463066 3300005341 Bacteria 726
15 Ga0070671_100000196 3300005355 Bacteria 40503
16 Ga0070674_100760749 3300005356 Bacteria 833
17 Ga0070667_100048708 3300005367 Unclassified 3567
18 Ga0070681_10185646 3300005458 Bacteria 2000
19 Ga0070681_10544105 3300005458 Bacteria 1075
20 Ga0068867_100091934 3300005459 Bacteria 2304
21 Ga0070679_100015171 3300005530 Bacteria 7404
22 Ga0070679_100470566 3300005530 Bacteria 1201
23 Ga0070684_100625336 3300005535 Bacteria 1002
24 Ga0070684_101874443 3300005535 Unclassified 566
25 Ga0070697_100713136 3300005536 Bacteria 885
26 Ga0068853_100295631 3300005539 Bacteria 1496
27 Ga0070686_100236964 3300005544 Bacteria 1327
28 Ga0070665_100002611 3300005548 Bacteria 19663
29 Ga0070665_100270917 3300005548 Bacteria 1699
30 Ga0070665_100632665 3300005548 Bacteria 1083
31 Ga0068855_100040504 3300005563 Bacteria 5530
32 Ga0068855_100195554 3300005563 Bacteria 2279
33 Ga0068857_100054391 3300005577 Bacteria 3551
34 Ga0068857_100084719 3300005577 Bacteria 2832
35 Ga0068857_100217325 3300005577 Bacteria 1745
36 Ga0068856_100108423 3300005614 Bacteria 2773
37 Ga0068856_100178370 3300005614 Bacteria 2137
38 Ga0068856_102607006 3300005614 Bacteria 511
39 Ga0068852_100844660 3300005616 Unclassified 931
40 Ga0068859_100002402 3300005617 Bacteria 19068
41 Ga0068864_100753955 3300005618 Bacteria 954
42 Ga0068864_102019150 3300005618 Bacteria 583
43 Ga0068861_100617278 3300005719 Bacteria 997
44 Ga0068863_100005215 3300005841 Bacteria 12823
45 Ga0068858_100000113 3300005842 Bacteria 84912
46 Ga0068860_100040823 3300005843 Bacteria 4433
47 Ga0068860_100585618 3300005843 Bacteria 1120
48 Ga0068860_101755908 3300005843 Bacteria 642
49 Ga0068862_100246316 3300005844 Bacteria 1627
50 Ga0097621_100005603 3300006237 Bacteria 8854
51 Ga0068871_100020500 3300006358 Bacteria 5066
52 Ga0068871_101358119 3300006358 Bacteria 669
53 Ga0068865_100005358 3300006881 Bacteria 7768
54 Ga0097620_100002402 3300006931 Bacteria 19068
55 Ga0105250_10013358 3300009092 Bacteria 3383
56 Ga0105240_10002612 3300009093 Bacteria 28788
57 Ga0105240_10025687 3300009093 Bacteria 7737
58 Ga0105240_10048083 3300009093 Bacteria 5394
59 Ga0105240_10082525 3300009093 Bacteria 3947
60 Ga0105240_10127764 3300009093 Bacteria 3052
61 Ga0105240_10277791 3300009093 Bacteria 1925
62 Ga0105240_11531801 3300009093 Unclassified 699
63 Ga0111539_11633586 3300009094 Bacteria 747
64 Ga0105245_10000109 3300009098 Bacteria 79725
65 Ga0105247_10000445 3300009101 Bacteria 34975
66 Ga0105247_10509666 3300009101 Bacteria 878
67 Ga0105243_10125310 3300009148 Bacteria 2172
68 Ga0105241_10028295 3300009174 Bacteria 4177
69 Ga0105241_10088102 3300009174 Bacteria 2444
70 Ga0105241_11804565 3300009174 Bacteria 597
71 Ga0105242_10001829 3300009176 Bacteria 16719
72 Ga0105242_12489056 3300009176 Bacteria 566
73 Ga0105248_10245252 3300009177 Bacteria 2017
74 Ga0105248_10832703 3300009177 Bacteria 1041
75 Ga0105237_10004558 3300009545 Bacteria 16006
76 Ga0105237_10027403 3300009545 Bacteria 5817
77 Ga0105237_10044089 3300009545 Bacteria 4491
78 Ga0105237_10088234 3300009545 Bacteria 3091
79 Ga0105237_10097190 3300009545 Bacteria 2935
80 Ga0105237_10627100 3300009545 Bacteria 1082
81 Ga0105238_10003617 3300009551 Bacteria 15408
82 Ga0105238_10005938 3300009551 Bacteria 12101
83 Ga0105238_10315524 3300009551 Bacteria 1549
84 Ga0105249_10793449 3300009553 Bacteria 1011
85 Ga0105249_11091875 3300009553 Bacteria 868
86 Ga0105239_10011563 3300010375 Bacteria 9846
87 Ga0105239_12036891 3300010375 Bacteria 667
88 Ga0105246_10051881 3300011119 Bacteria 2817
89 Ga0105246_11080947 3300011119 Bacteria 731
90 Ga0157369_10010225 3300013105 Bacteria 10708
91 Ga0157374_10008730 3300013296 Bacteria 8670
92 Ga0157378_10116991 3300013297 Bacteria 2452
93 Ga0157378_10419259 3300013297 Bacteria 1323
94 Ga0157378_10485791 3300013297 Bacteria 1231
95 Ga0163162_10051873 3300013306 Bacteria 4117
96 Ga0163162_10425737 3300013306 Bacteria 1460
97 Ga0157375_10044998 3300013308 Bacteria 4294
98 Ga0163163_10003694 3300014325 Bacteria 13023
99 Ga0163163_10029874 3300014325 Bacteria 5244
100 Ga0163163_10104546 3300014325 Unclassified 2857
101 Ga0157379_10075406 3300014968 Unclassified 3020
102 Ga0157379_10387452 3300014968 Bacteria 1283
103 Ga0157376_10002390 3300014969 Bacteria 12680
104 Ga0157376_10119024 3300014969 Bacteria 2338
105 Ga0157376_11459294 3300014969 Bacteria 716
106 Ga0213873_10076832 3300021358 Unclassified 928
107 Ga0213876_10002757 3300021384 Bacteria 10233
108 Ga0207710_10000334 3300025900 Bacteria 35251
109 Ga0207680_10590456 3300025903 Bacteria 794
110 Ga0207705_10258635 3300025909 Bacteria 1329
111 Ga0207654_10061050 3300025911 Bacteria 2204
112 Ga0207654_10112978 3300025911 Bacteria 1693
113 Ga0207707_10035495 3300025912 Bacteria 4360
114 Ga0207707_10163598 3300025912 Bacteria 1945
115 Ga0207707_10968164 3300025912 Bacteria 700
116 Ga0207707_11267422 3300025912 Bacteria 594
117 Ga0207695_10006165 3300025913 Bacteria 15634
118 Ga0207695_10083957 3300025913 Bacteria 3216
119 Ga0207695_10199957 3300025913 Unclassified 1913
120 Ga0207671_10042141 3300025914 Bacteria 3379
121 Ga0207671_10048255 3300025914 Bacteria 3152
122 Ga0207671_10077400 3300025914 Bacteria 2490
123 Ga0207671_10237751 3300025914 Bacteria 1430
124 Ga0207657_10514947 3300025919 Bacteria 937
125 Ga0207652_10402463 3300025921 Bacteria 1235
126 Ga0207694_10005456 3300025924 Bacteria 9773
127 Ga0207694_10182296 3300025924 Bacteria 1703
128 Ga0207687_10000200 3300025927 Bacteria 40532
129 Ga0207687_10092161 3300025927 Bacteria 2212
130 Ga0207644_10001248 3300025931 Bacteria 16369
131 Ga0207686_10133063 3300025934 Bacteria 1708
132 Ga0207709_10083857 3300025935 Bacteria 2062
133 Ga0207704_10007335 3300025938 Bacteria 5204
134 Ga0207711_10171992 3300025941 Bacteria 1966
135 Ga0207711_10305855 3300025941 Bacteria 1467
136 Ga0207661_10161339 3300025944 Bacteria 1945
137 Ga0207667_10061328 3300025949 Bacteria 3934
138 Ga0207667_10146675 3300025949 Bacteria 2429
139 Ga0207667_11986557 3300025949 Bacteria 542
140 Ga0207658_10334500 3300025986 Bacteria 1314
141 Ga0207658_11071945 3300025986 Bacteria 736
142 Ga0207703_10264692 3300026035 Unclassified 1555
143 Ga0207703_10512966 3300026035 Bacteria 1127
144 Ga0207703_12248653 3300026035 Bacteria 521
145 Ga0207639_10191801 3300026041 Bacteria 1746
146 Ga0207678_10675286 3300026067 Bacteria 908
147 Ga0207702_10196003 3300026078 Bacteria 1870
148 Ga0207641_10087556 3300026088 Unclassified 2717
149 Ga0207648_10076693 3300026089 Bacteria 2914
150 Ga0207674_10024644 3300026116 Bacteria 6425
151 Ga0207674_10153497 3300026116 Bacteria 2259
152 Ga0207674_10238575 3300026116 Bacteria 1765
153 Ga0207683_11232405 3300026121 Bacteria 693
154 Ga0207698_10876016 3300026142 Unclassified 904
155 Ga0268266_10001047 3300028379 Bacteria 34703
156 Ga0268266_10369157 3300028379 Unclassified 1351
157 Ga0268265_10321840 3300028380 Bacteria 1401
158 Ga0268264_10104136 3300028381 Unclassified 2473
159 Ga0268264_11084426 3300028381 Bacteria 809
160 Ga0268264_11273096 3300028381 Bacteria 745
161 Ga0268264_11578942 3300028381 Bacteria 667
162 Ga0307515_10008608 3300028794 Bacteria 19864
163 Ga0265324_10058096 3300029957 Bacteria 1324
164 Ga0307511_10127722 3300030521 Bacteria 1544
165 Ga0265332_10004581 3300031238 Bacteria 6470
166 Ga0265339_10000189 3300031249 Bacteria 51800
167 Ga0265316_10000794 3300031344 Bacteria 34821
168 Ga0307509_10000829 3300031507 Bacteria 53068
169 Ga0307509_10006755 3300031507 Bacteria 15279
170 Ga0307509_10024763 3300031507 Bacteria 6716
171 Ga0307509_10734560 3300031507 Bacteria 653
172 Ga0307508_10008159 3300031616 Bacteria 9709
173 Ga0307508_10210075 3300031616 Bacteria 1547
174 Ga0265314_10000001 3300031711 Bacteria 3792860
175 Ga0307516_10150219 3300031730 Bacteria 2091
176 Ga0307507_10015952 3300033179 Bacteria 8788
177 Ga0307507_10042082 3300033179 Bacteria 4560
178 Ga0307510_10532022 3300033180 Bacteria 620
179 Ga0373925_1099060 3300037068 Bacteria 654
180 Ga0395899_0010131 3300037312 Bacteria 7227
181 Ga0395900_0008027 3300037418 Bacteria 10863
182 Ga0395898_0002853 3300037466 Bacteria 19760
183 Ga0395898_0124689 3300037466 Bacteria 2467
184 Ga0395898_0201915 3300037466 Bacteria 1898
185 Ga0395898_0360296 3300037466 Bacteria 1387
186 Ga0395905_1419923 3300037471 Unclassified 598
187 Ga0436364_0962317 3300037853 Bacteria 14426
188 Ga0395901_0021350 3300038443 Bacteria 6633
189 Ga0436365_1712698 3300039437 Bacteria 20322
190 Ga0436362_0449493 3300039453 Unclassified 1666
191 Ga0451793_0646439 3300041452 Bacteria 1260
192 Ga0451807_0919810 3300041486 Bacteria 658
193 Ga0466969_0001656 3300044656 Bacteria 11935
194 Ga0466969_0029234 3300044656 Bacteria 2815
195 Ga0466966_0001467 3300044684 Bacteria 15177
196 Ga0466966_0418509 3300044684 Bacteria 805
197 Ga0466961_0017411 3300044693 Bacteria 4615
198 Ga0466961_0345689 3300044693 Bacteria 906
199 Ga0466961_0677849 3300044693 Bacteria 618
200 Ga0466964_0000571 3300044706 Bacteria 11587
201 Ga0466971_0014140 3300044719 Bacteria 3508
202 Ga0466971_0470539 3300044719 Bacteria 618
203 Ga0466968_0391183 3300044735 Bacteria 680
204 Ga0466970_0008652 3300044765 Bacteria 5128
205 Ga0466957_0381499 3300044842 Bacteria 961
206 Ga0466960_0347328 3300044901 Bacteria 845
207 Ga0466959_0002031 3300045049 Bacteria 12781
208 Ga0466959_0036457 3300045049 Bacteria 3634
209 Ga0466959_0042708 3300045049 Bacteria 3344
210 Ga0466959_0044228 3300045049 Bacteria 3281
211 Ga0466959_0171639 3300045049 Bacteria 1521
212 Ga0466959_0296365 3300045049 Bacteria 1108
213 Ga0466959_0391700 3300045049 Bacteria 945
214 Ga0466958_0133355 3300045836 Bacteria 1561
215 Ga0466958_0265738 3300045836 Unclassified 1098
216 Ga0466958_0706090 3300045836 Bacteria 657
217 Ga0466967_0543392 3300045976 Bacteria 1143
218 Ga0495596_0284852 3300046500 Bacteria 642
219 Ga0495643_0060674 3300046522 Bacteria 2007
220 Ga0495589_0103531 3300046794 Bacteria 1376
221 Ga0495683_0443143 3300047323 Bacteria 534
222 Ga0495602_0667313 3300048088 Bacteria 708
223 Ga0496100_0169148 3300048903 Bacteria 1572
224 Ga0496101_0137906 3300048904 Bacteria 1857
225 Ga0496102_0017007 3300048905 Bacteria 6365
226 Ga0496103_0088660 3300048906 Unclassified 1951
227 Ga0496104_0247476 3300048907 Bacteria 1695
228 Ga0496105_0005709 3300048908 Bacteria 9472
229 Ga0496107_0064141 3300048910 Bacteria 2663
230 Ga0496107_0329016 3300048910 Bacteria 1137
231 Ga0496116_0167767 3300048919 Bacteria 1194
232 Ga0496117_0140472 3300048920 Bacteria 1447
233 Ga0496117_0218230 3300048920 Bacteria 1063
234 Ga0496118_0004157 3300048921 Bacteria 17480
235 Ga0496118_0005013 3300048921 Bacteria 15296
236 Ga0496119_0000030 3300048922 Bacteria 240167
237 Ga0496120_0000033 3300048923 Bacteria 218355
238 Ga0496121_0000063 3300048924 Bacteria 273080
239 Ga0496121_0009623 3300048924 Bacteria 11069
240 Ga0496121_0014157 3300048924 Bacteria 8495
241 Ga0496121_0400401 3300048924 Unclassified 899
242 Ga0496125_0012911 3300048928 Bacteria 8246
243 Ga0496126_0000134 3300048929 Bacteria 169693
244 Ga0496126_0038663 3300048929 Bacteria 4436
245 Ga0496126_0233218 3300048929 Unclassified 1541
246 Ga0501033_0028778 3300049570 Bacteria 4175
247 Ga0501036_0437533 3300049572 Bacteria 1090
248 Ga0501037_0401937 3300049573 Bacteria 939
249 Ga0501038_0070063 3300049574 Bacteria 2978
250 Ga0501042_1186196 3300049578 Bacteria 557
251 Ga0501043_0536054 3300049579 Bacteria 871
252 Ga0501047_0191718 3300049581 Bacteria 1907
253 Ga0501067_0022343 3300049583 Bacteria 3501
254 Ga0501071_0332662 3300049587 Bacteria 1155
255 Ga0501044_0040025 3300049823 Bacteria 4887
256 Ga0500635_0007307 3300053080 Bacteria 2992
257 Ga0500646_0010672 3300053090 Bacteria 2357
258 Ga0500583_0267046 3300053092 Bacteria 842
259 Ga0500566_0001723 3300053094 Bacteria 12840
260 Ga0500566_0314794 3300053094 Bacteria 731
261 Ga0500595_143517 3300053119 Bacteria 669
262 Ga0500597_186041 3300053120 Bacteria 878
263 Ga0500614_004919 3300053123 Bacteria 2811
264 Ga0500642_0020645 3300053130 Bacteria 2593
265 Ga0500585_062058 3300053144 Bacteria 1346
266 Ga0500603_001157 3300053150 Bacteria 6152
267 Ga0500616_0006526 3300053153 Bacteria 7624
268 Ga0500620_157276 3300053155 Bacteria 790
269 Ga0500636_0393594 3300053177 Bacteria 645
270 Ga0500637_0029679 3300053178 Bacteria 3036
271 Ga0501082_0102478 3300060353 Bacteria 2476
272 Ga0466962_0082205 3300061719 Bacteria 1540
273 Ga0466962_0272120 3300061719 Bacteria 835

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053080 Ga0500635_0007307 Ga0500635_0007307_1800_2177 113
2 3300053094 Ga0500566_0001723 Ga0500566_0001723_2293_2670 113
3 3300053144 Ga0500585_062058 Ga0500585_062058_405_782 113
4 3300053150 Ga0500603_001157 Ga0500603_001157_1809_2186 113
5 3300053155 Ga0500620_157276 Ga0500620_157276_154_531 113
6 3300005719 Ga0068861_100617278 Ga0068861_1006172783 114
7 3300005843 Ga0068860_100585618 Ga0068860_1005856182 114
8 3300005844 Ga0068862_100246316 Ga0068862_1002463162 114
9 3300009093 Ga0105240_10025687 Ga0105240_100256878 114
10 3300009148 Ga0105243_10125310 Ga0105243_101253103 114
11 3300009176 Ga0105242_12489056 Ga0105242_124890562 114
12 3300009545 Ga0105237_10097190 Ga0105237_100971902 114
13 3300009551 Ga0105238_10315524 Ga0105238_103155243 114
14 3300013297 Ga0157378_10116991 Ga0157378_101169915 114
15 3300025935 Ga0207709_10083857 Ga0207709_100838572 114
16 3300028380 Ga0268265_10321840 Ga0268265_103218402 114
17 3300028381 Ga0268264_11273096 Ga0268264_112730962 114
18 3300029957 Ga0265324_10058096 Ga0265324_100580962 114
19 3300031249 Ga0265339_10000189 Ga0265339_1000018933 114
20 3300031344 Ga0265316_10000794 Ga0265316_1000079410 114
21 3300031711 Ga0265314_10000001 Ga0265314_100000013112 114
22 3300053153 Ga0500616_0006526 Ga0500616_0006526_3517_3864 114
23 3300031507 Ga0307509_10006755 Ga0307509_100067556 115
24 3300044735 Ga0466968_0391183 Ga0466968_0391183_288_638 115
25 3300046500 Ga0495596_0284852 Ga0495596_0284852_240_599 115
26 3300003323 rootH1_10031452 rootH1_100314524 116
27 3300005548 Ga0070665_100002611 Ga0070665_10000261118 116
28 3300005548 Ga0070665_100632665 Ga0070665_1006326652 116
29 3300009093 Ga0105240_10127764 Ga0105240_101277644 116
30 3300009101 Ga0105247_10509666 Ga0105247_105096662 116
31 3300009545 Ga0105237_10027403 Ga0105237_100274035 116
32 3300009545 Ga0105237_10088234 Ga0105237_100882343 116
33 3300009551 Ga0105238_10005938 Ga0105238_100059387 116
34 3300010375 Ga0105239_12036891 Ga0105239_120368912 116
35 3300014968 Ga0157379_10387452 Ga0157379_103874522 116
36 3300014969 Ga0157376_11459294 Ga0157376_114592942 116
37 3300025914 Ga0207671_10077400 Ga0207671_100774003 116
38 3300025924 Ga0207694_10005456 Ga0207694_100054564 116
39 3300025949 Ga0207667_11986557 Ga0207667_119865571 116
40 3300025986 Ga0207658_11071945 Ga0207658_110719451 116
41 3300026067 Ga0207678_10675286 Ga0207678_106752862 116
42 3300028379 Ga0268266_10001047 Ga0268266_100010478 116
43 3300037466 Ga0395898_0002853 Ga0395898_0002853_13690_14043 116
44 3300037466 Ga0395898_0360296 Ga0395898_0360296_466_864 116
45 3300044656 Ga0466969_0001656 Ga0466969_0001656_4641_4994 116
46 3300044684 Ga0466966_0001467 Ga0466966_0001467_10128_10481 116
47 3300044684 Ga0466966_0418509 Ga0466966_0418509_179_532 116
48 3300044693 Ga0466961_0017411 Ga0466961_0017411_2045_2398 116
49 3300044693 Ga0466961_0677849 Ga0466961_0677849_206_559 116
50 3300044706 Ga0466964_0000571 Ga0466964_0000571_6830_7183 116
51 3300044719 Ga0466971_0014140 Ga0466971_0014140_2057_2410 116
52 3300044765 Ga0466970_0008652 Ga0466970_0008652_2558_2911 116
53 3300044842 Ga0466957_0381499 Ga0466957_0381499_211_564 116
54 3300045049 Ga0466959_0044228 Ga0466959_0044228_307_660 116
55 3300045049 Ga0466959_0171639 Ga0466959_0171639_1026_1379 116
56 3300045836 Ga0466958_0133355 Ga0466958_0133355_327_680 116
57 3300045836 Ga0466958_0706090 Ga0466958_0706090_96_449 116
58 3300048907 Ga0496104_0247476 Ga0496104_0247476_253_606 116
59 3300048908 Ga0496105_0005709 Ga0496105_0005709_274_627 116
60 3300048910 Ga0496107_0064141 Ga0496107_0064141_2024_2377 116
61 3300048919 Ga0496116_0167767 Ga0496116_0167767_698_1051 116
62 3300048920 Ga0496117_0140472 Ga0496117_0140472_108_461 116
63 3300048921 Ga0496118_0005013 Ga0496118_0005013_14778_15131 116
64 3300048922 Ga0496119_0000030 Ga0496119_0000030_101826_102179 116
65 3300048923 Ga0496120_0000033 Ga0496120_0000033_137997_138350 116
66 3300048924 Ga0496121_0000063 Ga0496121_0000063_113953_114306 116
67 3300048924 Ga0496121_0400401 Ga0496121_0400401_389_742 116
68 3300048929 Ga0496126_0038663 Ga0496126_0038663_2676_3029 116
69 3300061719 Ga0466962_0082205 Ga0466962_0082205_878_1231 116
70 3300003322 rootL2_10033260 rootL2_100332604 117
71 3300005327 Ga0070658_10207384 Ga0070658_102073842 117
72 3300006358 Ga0068871_101358119 Ga0068871_1013581191 117
73 3300009093 Ga0105240_10277791 Ga0105240_102777913 117
74 3300009093 Ga0105240_11531801 Ga0105240_115318012 117
75 3300021358 Ga0213873_10076832 Ga0213873_100768321 117
76 3300021384 Ga0213876_10002757 Ga0213876_100027577 117
77 3300025909 Ga0207705_10258635 Ga0207705_102586352 117
78 3300025913 Ga0207695_10083957 Ga0207695_100839574 117
79 3300033180 Ga0307510_10532022 Ga0307510_105320222 117
80 3300037312 Ga0395899_0010131 Ga0395899_0010131_4819_5175 117
81 3300037418 Ga0395900_0008027 Ga0395900_0008027_547_903 117
82 3300037466 Ga0395898_0124689 Ga0395898_0124689_1094_1450 117
83 3300037471 Ga0395905_1419923 Ga0395905_1419923_158_517 117
84 3300037853 Ga0436364_0962317 Ga0436364_0962317_1308_1679 117
85 3300038443 Ga0395901_0021350 Ga0395901_0021350_1222_1578 117
86 3300039437 Ga0436365_1712698 Ga0436365_1712698_13221_13592 117
87 3300039453 Ga0436362_0449493 Ga0436362_0449493_497_868 117
88 3300041452 Ga0451793_0646439 Ga0451793_0646439_39_422 117
89 3300041486 Ga0451807_0919810 Ga0451807_0919810_77_433 117
90 3300048088 Ga0495602_0667313 Ga0495602_0667313_38_397 117
91 3300048903 Ga0496100_0169148 Ga0496100_0169148_323_679 117
92 3300048904 Ga0496101_0137906 Ga0496101_0137906_1180_1536 117
93 3300048910 Ga0496107_0329016 Ga0496107_0329016_189_545 117
94 3300048920 Ga0496117_0218230 Ga0496117_0218230_600_956 117
95 3300048921 Ga0496118_0004157 Ga0496118_0004157_17087_17443 117
96 3300048924 Ga0496121_0014157 Ga0496121_0014157_7073_7429 117
97 3300048929 Ga0496126_0000134 Ga0496126_0000134_295_651 117
98 3300003323 rootH1_10116647 rootH1_101166473 118
99 3300003323 rootH1_10149821 rootH1_101498213 118
100 3300005329 Ga0070683_100190930 Ga0070683_1001909305 118
101 3300005330 Ga0070690_100934002 Ga0070690_1009340022 118
102 3300005335 Ga0070666_10172574 Ga0070666_101725742 118
103 3300005355 Ga0070671_100000196 Ga0070671_10000019628 118
104 3300005356 Ga0070674_100760749 Ga0070674_1007607491 118
105 3300005367 Ga0070667_100048708 Ga0070667_1000487083 118
106 3300005459 Ga0068867_100091934 Ga0068867_1000919344 118
107 3300005530 Ga0070679_100470566 Ga0070679_1004705663 118
108 3300005535 Ga0070684_100625336 Ga0070684_1006253362 118
109 3300005536 Ga0070697_100713136 Ga0070697_1007131361 118
110 3300005539 Ga0068853_100295631 Ga0068853_1002956312 118
111 3300005544 Ga0070686_100236964 Ga0070686_1002369643 118
112 3300005548 Ga0070665_100270917 Ga0070665_1002709172 118
113 3300005563 Ga0068855_100040504 Ga0068855_1000405046 118
114 3300005563 Ga0068855_100195554 Ga0068855_1001955544 118
115 3300005577 Ga0068857_100054391 Ga0068857_1000543913 118
116 3300005614 Ga0068856_100178370 Ga0068856_1001783703 118
117 3300005614 Ga0068856_102607006 Ga0068856_1026070062 118
118 3300005616 Ga0068852_100844660 Ga0068852_1008446602 118
119 3300005617 Ga0068859_100002402 Ga0068859_10000240218 118
120 3300005841 Ga0068863_100005215 Ga0068863_10000521513 118
121 3300005842 Ga0068858_100000113 Ga0068858_10000011333 118
122 3300005843 Ga0068860_100040823 Ga0068860_1000408236 118
123 3300005843 Ga0068860_101755908 Ga0068860_1017559082 118
124 3300006237 Ga0097621_100005603 Ga0097621_1000056039 118
125 3300006358 Ga0068871_100020500 Ga0068871_1000205005 118
126 3300006881 Ga0068865_100005358 Ga0068865_1000053586 118
127 3300006931 Ga0097620_100002402 Ga0097620_10000240218 118
128 3300009092 Ga0105250_10013358 Ga0105250_100133582 118
129 3300009093 Ga0105240_10048083 Ga0105240_100480835 118
130 3300009093 Ga0105240_10082525 Ga0105240_100825256 118
131 3300009101 Ga0105247_10000445 Ga0105247_1000044518 118
132 3300009174 Ga0105241_10028295 Ga0105241_100282953 118
133 3300009174 Ga0105241_11804565 Ga0105241_118045652 118
134 3300009176 Ga0105242_10001829 Ga0105242_100018294 118
135 3300009177 Ga0105248_10832703 Ga0105248_108327032 118
136 3300009545 Ga0105237_10044089 Ga0105237_100440895 118
137 3300009545 Ga0105237_10627100 Ga0105237_106271003 118
138 3300009551 Ga0105238_10003617 Ga0105238_100036179 118
139 3300009553 Ga0105249_10793449 Ga0105249_107934492 118
140 3300009553 Ga0105249_11091875 Ga0105249_110918752 118
141 3300010375 Ga0105239_10011563 Ga0105239_1001156310 118
142 3300011119 Ga0105246_10051881 Ga0105246_100518814 118
143 3300013105 Ga0157369_10010225 Ga0157369_1001022514 118
144 3300013296 Ga0157374_10008730 Ga0157374_100087309 118
145 3300013297 Ga0157378_10419259 Ga0157378_104192591 118
146 3300013306 Ga0163162_10051873 Ga0163162_100518735 118
147 3300013306 Ga0163162_10425737 Ga0163162_104257372 118
148 3300013308 Ga0157375_10044998 Ga0157375_100449985 118
149 3300014325 Ga0163163_10029874 Ga0163163_100298744 118
150 3300014325 Ga0163163_10104546 Ga0163163_101045463 118
151 3300014968 Ga0157379_10075406 Ga0157379_100754064 118
152 3300025900 Ga0207710_10000334 Ga0207710_1000033418 118
153 3300025903 Ga0207680_10590456 Ga0207680_105904562 118
154 3300025913 Ga0207695_10199957 Ga0207695_101999572 118
155 3300025914 Ga0207671_10237751 Ga0207671_102377512 118
156 3300025931 Ga0207644_10001248 Ga0207644_1000124814 118
157 3300025941 Ga0207711_10305855 Ga0207711_103058552 118
158 3300025949 Ga0207667_10146675 Ga0207667_101466754 118
159 3300025986 Ga0207658_10334500 Ga0207658_103345002 118
160 3300026035 Ga0207703_10264692 Ga0207703_102646922 118
161 3300026035 Ga0207703_10512966 Ga0207703_105129662 118
162 3300026088 Ga0207641_10087556 Ga0207641_100875563 118
163 3300028379 Ga0268266_10369157 Ga0268266_103691573 118
164 3300028381 Ga0268264_10104136 Ga0268264_101041363 118
165 3300028381 Ga0268264_11084426 Ga0268264_110844262 118
166 3300028794 Ga0307515_10008608 Ga0307515_1000860818 118
167 3300030521 Ga0307511_10127722 Ga0307511_101277222 118
168 3300031238 Ga0265332_10004581 Ga0265332_100045815 118
169 3300031507 Ga0307509_10000829 Ga0307509_100008294 118
170 3300031507 Ga0307509_10024763 Ga0307509_100247634 118
171 3300031507 Ga0307509_10734560 Ga0307509_107345601 118
172 3300031616 Ga0307508_10008159 Ga0307508_100081596 118
173 3300031616 Ga0307508_10210075 Ga0307508_102100753 118
174 3300031730 Ga0307516_10150219 Ga0307516_101502193 118
175 3300033179 Ga0307507_10042082 Ga0307507_100420823 118
176 3300037466 Ga0395898_0201915 Ga0395898_0201915_1303_1665 118
177 3300044656 Ga0466969_0029234 Ga0466969_0029234_1757_2119 118
178 3300044693 Ga0466961_0345689 Ga0466961_0345689_93_455 118
179 3300044719 Ga0466971_0470539 Ga0466971_0470539_66_428 118
180 3300045049 Ga0466959_0002031 Ga0466959_0002031_265_627 118
181 3300045049 Ga0466959_0036457 Ga0466959_0036457_1185_1547 118
182 3300045049 Ga0466959_0042708 Ga0466959_0042708_595_957 118
183 3300045049 Ga0466959_0296365 Ga0466959_0296365_111_542 118
184 3300045049 Ga0466959_0391700 Ga0466959_0391700_140_505 118
185 3300045836 Ga0466958_0265738 Ga0466958_0265738_35_397 118
186 3300046522 Ga0495643_0060674 Ga0495643_0060674_585_947 118
187 3300047323 Ga0495683_0443143 Ga0495683_0443143_132_494 118
188 3300048905 Ga0496102_0017007 Ga0496102_0017007_5471_5833 118
189 3300048906 Ga0496103_0088660 Ga0496103_0088660_42_431 118
190 3300048924 Ga0496121_0009623 Ga0496121_0009623_10280_10642 118
191 3300048928 Ga0496125_0012911 Ga0496125_0012911_6977_7339 118
192 3300048929 Ga0496126_0233218 Ga0496126_0233218_1011_1373 118
193 3300049570 Ga0501033_0028778 Ga0501033_0028778_3501_3866 118
194 3300049572 Ga0501036_0437533 Ga0501036_0437533_456_821 118
195 3300049573 Ga0501037_0401937 Ga0501037_0401937_420_785 118
196 3300049574 Ga0501038_0070063 Ga0501038_0070063_1876_2241 118
197 3300049581 Ga0501047_0191718 Ga0501047_0191718_946_1311 118
198 3300049583 Ga0501067_0022343 Ga0501067_0022343_1301_1669 118
199 3300049823 Ga0501044_0040025 Ga0501044_0040025_3665_4030 118
200 3300053090 Ga0500646_0010672 Ga0500646_0010672_466_834 118
201 3300053092 Ga0500583_0267046 Ga0500583_0267046_369_737 118
202 3300053094 Ga0500566_0314794 Ga0500566_0314794_28_396 118
203 3300053130 Ga0500642_0020645 Ga0500642_0020645_86_451 118
204 3300060353 Ga0501082_0102478 Ga0501082_0102478_803_1180 118
205 3300003322 rootL2_10264764 rootL2_102647642 119
206 3300005336 Ga0070680_100404409 Ga0070680_1004044092 119
207 3300005535 Ga0070684_101874443 Ga0070684_1018744431 119
208 3300005618 Ga0068864_100753955 Ga0068864_1007539552 119
209 3300005618 Ga0068864_102019150 Ga0068864_1020191501 119
210 3300009094 Ga0111539_11633586 Ga0111539_116335862 119
211 3300009098 Ga0105245_10000109 Ga0105245_1000010975 119
212 3300009177 Ga0105248_10245252 Ga0105248_102452523 119
213 3300011119 Ga0105246_11080947 Ga0105246_110809472 119
214 3300013297 Ga0157378_10485791 Ga0157378_104857911 119
215 3300014969 Ga0157376_10002390 Ga0157376_100023905 119
216 3300014969 Ga0157376_10119024 Ga0157376_101190243 119
217 3300025911 Ga0207654_10061050 Ga0207654_100610504 119
218 3300025912 Ga0207707_10035495 Ga0207707_100354953 119
219 3300025919 Ga0207657_10514947 Ga0207657_105149473 119
220 3300025921 Ga0207652_10402463 Ga0207652_104024632 119
221 3300025924 Ga0207694_10182296 Ga0207694_101822963 119
222 3300025927 Ga0207687_10000200 Ga0207687_100002004 119
223 3300025927 Ga0207687_10092161 Ga0207687_100921613 119
224 3300025934 Ga0207686_10133063 Ga0207686_101330633 119
225 3300025938 Ga0207704_10007335 Ga0207704_100073353 119
226 3300025941 Ga0207711_10171992 Ga0207711_101719923 119
227 3300025944 Ga0207661_10161339 Ga0207661_101613394 119
228 3300026041 Ga0207639_10191801 Ga0207639_101918013 119
229 3300026078 Ga0207702_10196003 Ga0207702_101960033 119
230 3300026089 Ga0207648_10076693 Ga0207648_100766935 119
231 3300026116 Ga0207674_10024644 Ga0207674_100246445 119
232 3300026121 Ga0207683_11232405 Ga0207683_112324052 119
233 3300028381 Ga0268264_11578942 Ga0268264_115789422 119
234 3300033179 Ga0307507_10015952 Ga0307507_100159528 119
235 3300037068 Ga0373925_1099060 Ga0373925_1099060_160_531 119
236 3300044901 Ga0466960_0347328 Ga0466960_0347328_185_553 119
237 3300045976 Ga0466967_0543392 Ga0466967_0543392_344_721 119
238 3300049578 Ga0501042_1186196 Ga0501042_1186196_117_491 119
239 3300049579 Ga0501043_0536054 Ga0501043_0536054_39_413 119
240 3300049587 Ga0501071_0332662 Ga0501071_0332662_346_720 119
241 3300053119 Ga0500595_143517 Ga0500595_143517_61_441 119
242 3300053120 Ga0500597_186041 Ga0500597_186041_338_718 119
243 3300053123 Ga0500614_004919 Ga0500614_004919_1107_1487 119
244 3300053177 Ga0500636_0393594 Ga0500636_0393594_66_446 119
245 3300053178 Ga0500637_0029679 Ga0500637_0029679_589_969 119
246 3300061719 Ga0466962_0272120 Ga0466962_0272120_289_660 119
247 3300003320 rootH2_10163557 rootH2_101635573 120
248 3300003322 rootL2_10125555 rootL2_101255552 120
249 3300005336 Ga0070680_100118282 Ga0070680_1001182824 120
250 3300005341 Ga0070691_10463066 Ga0070691_104630661 120
251 3300005458 Ga0070681_10185646 Ga0070681_101856465 120
252 3300005458 Ga0070681_10544105 Ga0070681_105441051 120
253 3300005530 Ga0070679_100015171 Ga0070679_10001517110 120
254 3300005577 Ga0068857_100084719 Ga0068857_1000847193 120
255 3300005577 Ga0068857_100217325 Ga0068857_1002173253 120
256 3300005614 Ga0068856_100108423 Ga0068856_1001084233 120
257 3300009093 Ga0105240_10002612 Ga0105240_1000261220 120
258 3300009174 Ga0105241_10088102 Ga0105241_100881024 120
259 3300009545 Ga0105237_10004558 Ga0105237_100045584 120
260 3300014325 Ga0163163_10003694 Ga0163163_100036948 120
261 3300025911 Ga0207654_10112978 Ga0207654_101129782 120
262 3300025912 Ga0207707_10163598 Ga0207707_101635981 120
263 3300025912 Ga0207707_10968164 Ga0207707_109681641 120
264 3300025912 Ga0207707_11267422 Ga0207707_112674222 120
265 3300025913 Ga0207695_10006165 Ga0207695_100061656 120
266 3300025914 Ga0207671_10042141 Ga0207671_100421414 120
267 3300025914 Ga0207671_10048255 Ga0207671_100482554 120
268 3300025949 Ga0207667_10061328 Ga0207667_100613285 120
269 3300026035 Ga0207703_12248653 Ga0207703_122486531 120
270 3300026116 Ga0207674_10153497 Ga0207674_101534973 120
271 3300026116 Ga0207674_10238575 Ga0207674_102385751 120
272 3300026142 Ga0207698_10876016 Ga0207698_108760163 120
273 3300046794 Ga0495589_0103531 Ga0495589_0103531_341_715 120

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yrz-assembly1.cif.gz_D toxin-antitoxin complex from streptococcus pneumoniae 0.8095 13 53
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.7509 3 112
5ywg-assembly1.cif.gz_B crystal structure of arabidopsis thaliana hppd complexed with mesotrione 0.7463 3 112
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.7422 2 114
3hdp-assembly1.cif.gz_A crystal structure of the ni(ii)-bound glyoxalase-i from clostridium acetobutylicum 0.7397 1 111
ID Description Score Start End Superfamily
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8853 85 113 3.30.720.110
5yrzD00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.8095 13 53 3.30.920.30
af_Q2FYM3_1_61_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7964 5 60 3.10.180.10
6g26F00 Alpha Beta;2-Layer Sandwich;Metal Transport, Frataxin; Chain A;Hypothetical protein. 0.7904 13 54 3.30.920.30
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7904 1 55 3.30.720.120
ID Description Score Start End GO Terms
AF-L7PKA0-F1-model_v4 Glyoxalase 0.9652 1 115
AF-A0A369UZ12-F1-model_v4 VOC family protein 0.9297 1 117
AF-A0A1T4S1E5-F1-model_v4 Ribbon-helix-helix protein, copG family 0.9289 1 114 GO:0006355
AF-A0A369UZ12-F1-model_v4 VOC family protein 0.9223 1 117
AF-A0A1M9YHC2-F1-model_v4 deleted 0.9137 69 115

Feature Viewer

pLDDT pTM Quality
92.5 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map