F378666

General Info

Members Datasets Scaffolds Average Seq Length
272 147 544 239

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0094478|Ga0501072_0094478_772_1635
Length 287
Sequence MSFTGTPVTLLTDPQFNEQSIWGVDDVGSCSRRRPDHHERRDMTENRANAAPIILVPGFWLGAWAWDEVGAALRADGHRVTAITLPGLESVDTDRSAITFADHVEAIVDAVEAAGEPVVLAVHSASGFSGYAASDRVPEKIAAMVYVDTAPGIGPMDPDFTDVEKPLVWAEIEEGENLDGLTEAQKQTFRERAVPVPGSLIRETVELTDDARRDIPSTLICTGFTAEQYQTYAKEHPDWAFLAGIPELRNATWIDLPTSHWPMWSRPKELAQIIGDVARAHAPVGAD

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
84 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
85 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
86 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
87 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
146 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
147 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.35
Rhizosphere 92.28
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0094478 3300049588 Bacteria 2376
2 rootH2_10079429 3300003320 Bacteria 2157
3 Ga0070690_100136678 3300005330 Bacteria 1660
4 Ga0070687_100415719 3300005343 Bacteria 886
5 Ga0070668_100349886 3300005347 Unclassified 1250
6 Ga0070675_100123227 3300005354 Bacteria 2204
7 Ga0070674_100243540 3300005356 Bacteria 1409
8 Ga0070659_100531529 3300005366 Bacteria 1005
9 Ga0070667_100270642 3300005367 Bacteria 1523
10 Ga0070714_100000759 3300005435 Bacteria 22857
11 Ga0070711_100057900 3300005439 Bacteria 2685
12 Ga0070708_100000791 3300005445 Bacteria 23858
13 Ga0070708_100003775 3300005445 Bacteria 11884
14 Ga0070708_100013867 3300005445 Bacteria 6619
15 Ga0070708_100076142 3300005445 Bacteria 3030
16 Ga0070678_100526380 3300005456 Bacteria 1047
17 Ga0070706_100318953 3300005467 Bacteria 1449
18 Ga0070707_100004627 3300005468 Bacteria 12878
19 Ga0070707_100022795 3300005468 Bacteria 5921
20 Ga0070698_100000174 3300005471 Bacteria 60047
21 Ga0070698_100017607 3300005471 Bacteria 7529
22 Ga0070698_100102342 3300005471 Plasmid 2835
23 Ga0070699_100002307 3300005518 Bacteria 17176
24 Ga0070699_100041844 3300005518 Bacteria 3964
25 Ga0070679_100488941 3300005530 Bacteria 1175
26 Ga0070697_100120758 3300005536 Bacteria 2192
27 Ga0070697_100139064 3300005536 Bacteria 2041
28 Ga0070697_100682675 3300005536 Bacteria 905
29 Ga0070686_100050227 3300005544 Bacteria 2650
30 Ga0070696_100000185 3300005546 Bacteria 36291
31 Ga0070696_100616732 3300005546 Bacteria 876
32 Ga0070704_100193103 3300005549 Bacteria 1638
33 Ga0068856_100236327 3300005614 Bacteria 1843
34 Ga0068860_100200444 3300005843 Bacteria 1934
35 Ga0081455_10013380 3300005937 Bacteria 8114
36 Ga0081455_10017384 3300005937 Bacteria 6898
37 Ga0081539_10020693 3300005985 Bacteria 4431
38 Ga0081539_10062765 3300005985 Bacteria 2030
39 Ga0081539_10093175 3300005985 Bacteria 1552
40 Ga0070712_100001977 3300006175 Bacteria 12563
41 Ga0068871_100032957 3300006358 Bacteria 4097
42 Ga0075430_100086749 3300006846 Bacteria 2620
43 Ga0075433_10002504 3300006852 Bacteria 13975
44 Ga0075434_100242228 3300006871 Bacteria 1823
45 Ga0075429_100071648 3300006880 Bacteria 3018
46 Ga0075435_100338631 3300007076 Bacteria 1289
47 Ga0105240_10777844 3300009093 Bacteria 1038
48 Ga0111539_10443723 3300009094 Bacteria 1511
49 Ga0111539_10699920 3300009094 Unclassified 1179
50 Ga0114129_10001178 3300009147 Bacteria 34683
51 Ga0114129_10042201 3300009147 Bacteria 6423
52 Ga0114129_10210249 3300009147 Bacteria 2630
53 Ga0105243_10812416 3300009148 Bacteria 923
54 Ga0105241_10401846 3300009174 Bacteria 1202
55 Ga0105242_10580393 3300009176 Bacteria 1080
56 Ga0105249_10585040 3300009553 Bacteria 1170
57 Ga0105239_10463338 3300010375 Bacteria 1439
58 Ga0105246_10094570 3300011119 Bacteria 2162
59 Ga0157378_10322411 3300013297 Bacteria 1501
60 Ga0157378_10964389 3300013297 Bacteria 886
61 Ga0157375_10086736 3300013308 Unclassified 3182
62 Ga0157375_10178740 3300013308 Bacteria 2273
63 Ga0163163_10088113 3300014325 Bacteria 3115
64 Ga0163163_10214027 3300014325 Bacteria 1976
65 Ga0163163_10236100 3300014325 Bacteria 1878
66 Ga0163163_10391717 3300014325 Bacteria 1447
67 Ga0157379_10085079 3300014968 Bacteria 2834
68 Ga0157379_10339090 3300014968 Bacteria 1375
69 Ga0157379_10844389 3300014968 Bacteria 866
70 Ga0163161_10126105 3300017792 Bacteria 1928
71 Ga0207684_10022691 3300025910 Bacteria 5358
72 Ga0207693_10001432 3300025915 Bacteria 21142
73 Ga0207663_10252543 3300025916 Bacteria 1299
74 Ga0207662_10070462 3300025918 Bacteria 2115
75 Ga0207646_10000980 3300025922 Bacteria 36687
76 Ga0207646_10134100 3300025922 Bacteria 2230
77 Ga0207681_10662901 3300025923 Bacteria 866
78 Ga0207687_10449696 3300025927 Bacteria 1068
79 Ga0207686_10344768 3300025934 Bacteria 1120
80 Ga0207709_10079833 3300025935 Bacteria 2105
81 Ga0207669_10087203 3300025937 Bacteria 2021
82 Ga0207669_10559882 3300025937 Bacteria 924
83 Ga0207708_10134427 3300026075 Bacteria 1936
84 Ga0207708_10455318 3300026075 Bacteria 1066
85 Ga0207641_10132870 3300026088 Bacteria 2237
86 Ga0207676_10270075 3300026095 Bacteria 1540
87 Ga0207683_10483258 3300026121 Bacteria 1143
88 Ga0209974_10012424 3300027876 Bacteria 2847
89 Ga0265319_1006969 3300028563 Bacteria 5149
90 Ga0265334_10006685 3300028573 Bacteria 4956
91 Ga0265334_10075952 3300028573 Bacteria 1245
92 Ga0265318_10077774 3300028577 Bacteria 1226
93 Ga0265338_10062011 3300028800 Bacteria 3272
94 Ga0265338_10081816 3300028800 Bacteria 2706
95 Ga0265332_10045605 3300031238 Bacteria 1889
96 Ga0265320_10042257 3300031240 Bacteria 2262
97 Ga0265325_10073600 3300031241 Bacteria 1710
98 Ga0265340_10029819 3300031247 Bacteria 2739
99 Ga0265339_10046246 3300031249 Bacteria 2393
100 Ga0265331_10031508 3300031250 Bacteria 2634
101 Ga0265316_10215585 3300031344 Bacteria 1418
102 Ga0265313_10058642 3300031595 Bacteria 1814
103 Ga0265314_10006335 3300031711 Bacteria 10498
104 Ga0265342_10038866 3300031712 Bacteria 2895
105 Ga0307413_10021765 3300031824 Bacteria 3441
106 Ga0307409_100333623 3300031995 Unclassified 1424
107 Ga0307416_100358261 3300032002 Bacteria 1480
108 Ga0307416_100455528 3300032002 Bacteria 1333
109 Ga0373943_0028803 3300035170 Bacteria 2620
110 Ga0395898_0155986 3300037466 Unclassified 2184
111 Ga0395898_0224991 3300037466 Bacteria 1789
112 Ga0395905_0246477 3300037471 Bacteria 1669
113 Ga0439438_042088 3300041405 Bacteria 1182
114 Ga0439461_0010570 3300041410 Bacteria 1697
115 Ga0439445_0039256 3300042004 Bacteria 1254
116 Ga0439449_0136147 3300042007 Bacteria 914
117 Ga0439446_0142566 3300042156 Bacteria 783
118 Ga0451577_0318702 3300042876 Bacteria 1410
119 Ga0451577_0499829 3300042876 Bacteria 1104
120 Ga0451576_0127270 3300045051 Bacteria 2654
121 Ga0495641_0031883 3300046461 Bacteria 2514
122 Ga0495664_0368854 3300046477 Bacteria 864
123 Ga0495623_0320246 3300046679 Bacteria 852
124 Ga0495613_0231992 3300046689 Bacteria 1293
125 Ga0495676_0068855 3300047321 Bacteria 2733
126 Ga0495676_0178692 3300047321 Bacteria 1489
127 Ga0496100_0428693 3300048903 Bacteria 1011
128 Ga0496104_0013016 3300048907 Bacteria 7491
129 Ga0496104_0018991 3300048907 Bacteria 6281
130 Ga0496104_0201748 3300048907 Bacteria 1901
131 Ga0496104_0301930 3300048907 Bacteria 1513
132 Ga0496105_0021650 3300048908 Bacteria 5202
133 Ga0496107_0139834 3300048910 Bacteria 1790
134 Ga0496108_0041981 3300048911 Bacteria 3817
135 Ga0496108_0237627 3300048911 Bacteria 1585
136 Ga0496108_0281760 3300048911 Bacteria 1447
137 Ga0496108_0310340 3300048911 Bacteria 1374
138 Ga0496109_0152513 3300048912 Bacteria 2164
139 Ga0496109_0296120 3300048912 Bacteria 1525
140 Ga0496109_0606990 3300048912 Bacteria 1030
141 Ga0496110_0011129 3300048913 Bacteria 7348
142 Ga0496110_0024205 3300048913 Bacteria 5172
143 Ga0496111_0149988 3300048914 Bacteria 1729
144 Ga0496112_0000001 3300048915 Bacteria 1346031
145 Ga0496112_0065700 3300048915 Bacteria 3580
146 Ga0496114_0148042 3300048917 Bacteria 2036
147 Ga0501031_0007598 3300049568 Bacteria 7058
148 Ga0501031_0133145 3300049568 Bacteria 1624
149 Ga0501031_0148414 3300049568 Bacteria 1532
150 Ga0501031_0405779 3300049568 Bacteria 881
151 Ga0501033_0371569 3300049570 Bacteria 1000
152 Ga0501036_0052778 3300049572 Bacteria 3443
153 Ga0501036_0122149 3300049572 Bacteria 2199
154 Ga0501036_0130809 3300049572 Bacteria 2119
155 Ga0501036_0194305 3300049572 Bacteria 1707
156 Ga0501036_0237757 3300049572 Bacteria 1528
157 Ga0501037_0289334 3300049573 Bacteria 1140
158 Ga0501037_0548769 3300049573 Bacteria 780
159 Ga0501038_0106211 3300049574 Bacteria 2331
160 Ga0501038_0224232 3300049574 Bacteria 1498
161 Ga0501039_0013953 3300049575 Bacteria 6147
162 Ga0501039_0028768 3300049575 Bacteria 4279
163 Ga0501039_0045555 3300049575 Bacteria 3389
164 Ga0501039_0269804 3300049575 Bacteria 1337
165 Ga0501040_0028842 3300049576 Bacteria 3743
166 Ga0501040_0067502 3300049576 Bacteria 2465
167 Ga0501040_0131999 3300049576 Bacteria 1756
168 Ga0501041_0027520 3300049577 Bacteria 3426
169 Ga0501041_0079454 3300049577 Bacteria 2019
170 Ga0501041_0237671 3300049577 Unclassified 1144
171 Ga0501042_0124571 3300049578 Bacteria 1855
172 Ga0501043_0097436 3300049579 Bacteria 2312
173 Ga0501046_0055397 3300049580 Unclassified 3116
174 Ga0501046_0129145 3300049580 Bacteria 1917
175 Ga0501046_0295624 3300049580 Bacteria 1184
176 Ga0501048_0004805 3300049582 Bacteria 10296
177 Ga0501048_0334854 3300049582 Bacteria 1079
178 Ga0501048_0335104 3300049582 Bacteria 1078
179 Ga0501067_0036334 3300049583 Bacteria 2735
180 Ga0501067_0076500 3300049583 Bacteria 1854
181 Ga0501068_0017414 3300049584 Bacteria 4155
182 Ga0501068_0134334 3300049584 Bacteria 1549
183 Ga0501068_0188364 3300049584 Bacteria 1306
184 Ga0501069_0004119 3300049585 Bacteria 7505
185 Ga0501069_0006871 3300049585 Bacteria 5951
186 Ga0501069_0085961 3300049585 Bacteria 1775
187 Ga0501069_0256600 3300049585 Bacteria 1020
188 Ga0501070_0078194 3300049586 Bacteria 2738
189 Ga0501071_0040806 3300049587 Bacteria 3322
190 Ga0501071_0073568 3300049587 Bacteria 2493
191 Ga0501071_0100541 3300049587 Bacteria 2131
192 Ga0501071_0187883 3300049587 Bacteria 1549
193 Ga0501071_0234960 3300049587 Bacteria 1381
194 Ga0501072_0026415 3300049588 Bacteria 4527
195 Ga0501072_0035930 3300049588 Bacteria 3883
196 Ga0501072_0236707 3300049588 Bacteria 1454
197 Ga0501072_0276040 3300049588 Bacteria 1337
198 Ga0501072_0391349 3300049588 Bacteria 1103
199 Ga0501072_0400142 3300049588 Bacteria 1089
200 Ga0501073_0238614 3300049589 Bacteria 1256
201 Ga0501073_0317580 3300049589 Bacteria 1075
202 Ga0501073_0427665 3300049589 Unclassified 915
203 Ga0501074_0012865 3300049590 Bacteria 6083
204 Ga0501074_0051989 3300049590 Bacteria 2957
205 Ga0501074_0081480 3300049590 Bacteria 2321
206 Ga0501074_0149903 3300049590 Bacteria 1668
207 Ga0501074_0158288 3300049590 Bacteria 1617
208 Ga0501074_0351723 3300049590 Bacteria 1046
209 Ga0501074_0440226 3300049590 Bacteria 924
210 Ga0501075_0009635 3300049591 Bacteria 6763
211 Ga0501075_0061657 3300049591 Bacteria 2826
212 Ga0501075_0168207 3300049591 Bacteria 1672
213 Ga0501075_0201879 3300049591 Bacteria 1516
214 Ga0501075_0223861 3300049591 Bacteria 1435
215 Ga0501075_0340659 3300049591 Bacteria 1143
216 Ga0501075_0697355 3300049591 Bacteria 773
217 Ga0501076_0008134 3300049592 Bacteria 7670
218 Ga0501076_0060048 3300049592 Bacteria 3024
219 Ga0501076_0082105 3300049592 Bacteria 2587
220 Ga0501076_0089237 3300049592 Bacteria 2478
221 Ga0501076_0223709 3300049592 Bacteria 1538
222 Ga0501077_0002858 3300049593 Bacteria 10356
223 Ga0501077_0071442 3300049593 Bacteria 2200
224 Ga0501077_0123013 3300049593 Bacteria 1645
225 Ga0501079_0009643 3300049741 Bacteria 7322
226 Ga0501079_0018929 3300049741 Bacteria 5261
227 Ga0501079_0035484 3300049741 Bacteria 3838
228 Ga0501079_0309687 3300049741 Unclassified 1235
229 Ga0501079_0630493 3300049741 Bacteria 844
230 Ga0501080_0020443 3300049742 Bacteria 6128
231 Ga0501080_0187411 3300049742 Bacteria 1902
232 Ga0501080_0209751 3300049742 Bacteria 1785
233 Ga0501080_0257605 3300049742 Bacteria 1590
234 Ga0501081_0000855 3300049743 Bacteria 17979
235 Ga0501081_0050468 3300049743 Bacteria 2866
236 Ga0501081_0097530 3300049743 Bacteria 2074
237 Ga0501081_0180835 3300049743 Bacteria 1525
238 Ga0501083_0035555 3300049744 Bacteria 3402
239 Ga0501035_0193462 3300049822 Unclassified 1748
240 Ga0501035_0315328 3300049822 Bacteria 1315
241 Ga0501045_0047843 3300049824 Bacteria 3116
242 Ga0501045_0214241 3300049824 Unclassified 1434
243 Ga0501045_0362287 3300049824 Bacteria 1079
244 nmdc:mga05p37_122227_c1 3300050507 Bacteria 3197
245 nmdc:mga05p37_1842_c1 3300050507 Bacteria 24712
246 nmdc:mga09592_239242_c1 3300050508 Bacteria 1573
247 nmdc:mga0qj67_253057_c1 3300050509 Bacteria 1429
248 nmdc:mga06r32_536317_c1 3300050510 Bacteria 1145
249 nmdc:mga08y16_210739_c1 3300050511 Bacteria 2012
250 nmdc:mga0n895_95918_c1 3300050512 Bacteria 2971
251 nmdc:mga0a205_77056_c1 3300050515 Bacteria 3222
252 Ga0501084_0022161 3300054114 Bacteria 5300
253 Ga0501084_0042356 3300054114 Bacteria 3809
254 Ga0501084_0158440 3300054114 Bacteria 1910
255 Ga0501084_0256707 3300054114 Bacteria 1475
256 Ga0501084_0337218 3300054114 Unclassified 1273
257 Ga0501084_0569730 3300054114 Bacteria 957
258 Ga0590071_000659 3300059421 Bacteria 9786
259 Ga0590074_005294 3300059423 Bacteria 2135
260 Ga0501082_0004081 3300060353 Bacteria 12742
261 Ga0501082_0187640 3300060353 Bacteria 1799
262 Ga0501082_0351330 3300060353 Bacteria 1285
263 Ga0530510_0011804 3300061734 Bacteria 6129
264 Ga0530510_0086374 3300061734 Bacteria 2286
265 Ga0530510_0211668 3300061734 Bacteria 1440
266 Ga0530510_0231507 3300061734 Unclassified 1374
267 Ga0530510_0318556 3300061734 Bacteria 1165
268 Ga0530510_0325786 3300061734 Bacteria 1152
269 Ga0530510_0489285 3300061734 Bacteria 932
270 3001270328 3001267043 Bacteria 4823521
271 3001896059 3001892409 Bacteria 6328293
272 3006990192 3006988479 Bacteria 4767936
273 Ga0501072_0094478
274 rootH2_10079429
275 Ga0070690_100136678
276 Ga0070687_100415719
277 Ga0070668_100349886
278 Ga0070675_100123227
279 Ga0070674_100243540
280 Ga0070659_100531529
281 Ga0070667_100270642
282 Ga0070714_100000759
283 Ga0070711_100057900
284 Ga0070708_100000791
285 Ga0070708_100003775
286 Ga0070708_100013867
287 Ga0070708_100076142
288 Ga0070678_100526380
289 Ga0070706_100318953
290 Ga0070707_100004627
291 Ga0070707_100022795
292 Ga0070698_100000174
293 Ga0070698_100017607
294 Ga0070698_100102342
295 Ga0070699_100002307
296 Ga0070699_100041844
297 Ga0070679_100488941
298 Ga0070697_100120758
299 Ga0070697_100139064
300 Ga0070697_100682675
301 Ga0070686_100050227
302 Ga0070696_100000185
303 Ga0070696_100616732
304 Ga0070704_100193103
305 Ga0068856_100236327
306 Ga0068860_100200444
307 Ga0081455_10013380
308 Ga0081455_10017384
309 Ga0081539_10020693
310 Ga0081539_10062765
311 Ga0081539_10093175
312 Ga0070712_100001977
313 Ga0068871_100032957
314 Ga0075430_100086749
315 Ga0075433_10002504
316 Ga0075434_100242228
317 Ga0075429_100071648
318 Ga0075435_100338631
319 Ga0105240_10777844
320 Ga0111539_10443723
321 Ga0111539_10699920
322 Ga0114129_10001178
323 Ga0114129_10042201
324 Ga0114129_10210249
325 Ga0105243_10812416
326 Ga0105241_10401846
327 Ga0105242_10580393
328 Ga0105249_10585040
329 Ga0105239_10463338
330 Ga0105246_10094570
331 Ga0157378_10322411
332 Ga0157378_10964389
333 Ga0157375_10086736
334 Ga0157375_10178740
335 Ga0163163_10088113
336 Ga0163163_10214027
337 Ga0163163_10236100
338 Ga0163163_10391717
339 Ga0157379_10085079
340 Ga0157379_10339090
341 Ga0157379_10844389
342 Ga0163161_10126105
343 Ga0207684_10022691
344 Ga0207693_10001432
345 Ga0207663_10252543
346 Ga0207662_10070462
347 Ga0207646_10000980
348 Ga0207646_10134100
349 Ga0207681_10662901
350 Ga0207687_10449696
351 Ga0207686_10344768
352 Ga0207709_10079833
353 Ga0207669_10087203
354 Ga0207669_10559882
355 Ga0207708_10134427
356 Ga0207708_10455318
357 Ga0207641_10132870
358 Ga0207676_10270075
359 Ga0207683_10483258
360 Ga0209974_10012424
361 Ga0265319_1006969
362 Ga0265334_10006685
363 Ga0265334_10075952
364 Ga0265318_10077774
365 Ga0265338_10062011
366 Ga0265338_10081816
367 Ga0265332_10045605
368 Ga0265320_10042257
369 Ga0265325_10073600
370 Ga0265340_10029819
371 Ga0265339_10046246
372 Ga0265331_10031508
373 Ga0265316_10215585
374 Ga0265313_10058642
375 Ga0265314_10006335
376 Ga0265342_10038866
377 Ga0307413_10021765
378 Ga0307409_100333623
379 Ga0307416_100358261
380 Ga0307416_100455528
381 Ga0373943_0028803
382 Ga0395898_0155986
383 Ga0395898_0224991
384 Ga0395905_0246477
385 Ga0439438_042088
386 Ga0439461_0010570
387 Ga0439445_0039256
388 Ga0439449_0136147
389 Ga0439446_0142566
390 Ga0451577_0318702
391 Ga0451577_0499829
392 Ga0451576_0127270
393 Ga0495641_0031883
394 Ga0495664_0368854
395 Ga0495623_0320246
396 Ga0495613_0231992
397 Ga0495676_0068855
398 Ga0495676_0178692
399 Ga0496100_0428693
400 Ga0496104_0013016
401 Ga0496104_0018991
402 Ga0496104_0201748
403 Ga0496104_0301930
404 Ga0496105_0021650
405 Ga0496107_0139834
406 Ga0496108_0041981
407 Ga0496108_0237627
408 Ga0496108_0281760
409 Ga0496108_0310340
410 Ga0496109_0152513
411 Ga0496109_0296120
412 Ga0496109_0606990
413 Ga0496110_0011129
414 Ga0496110_0024205
415 Ga0496111_0149988
416 Ga0496112_0000001
417 Ga0496112_0065700
418 Ga0496114_0148042
419 Ga0501031_0007598
420 Ga0501031_0133145
421 Ga0501031_0148414
422 Ga0501031_0405779
423 Ga0501033_0371569
424 Ga0501036_0052778
425 Ga0501036_0122149
426 Ga0501036_0130809
427 Ga0501036_0194305
428 Ga0501036_0237757
429 Ga0501037_0289334
430 Ga0501037_0548769
431 Ga0501038_0106211
432 Ga0501038_0224232
433 Ga0501039_0013953
434 Ga0501039_0028768
435 Ga0501039_0045555
436 Ga0501039_0269804
437 Ga0501040_0028842
438 Ga0501040_0067502
439 Ga0501040_0131999
440 Ga0501041_0027520
441 Ga0501041_0079454
442 Ga0501041_0237671
443 Ga0501042_0124571
444 Ga0501043_0097436
445 Ga0501046_0055397
446 Ga0501046_0129145
447 Ga0501046_0295624
448 Ga0501048_0004805
449 Ga0501048_0334854
450 Ga0501048_0335104
451 Ga0501067_0036334
452 Ga0501067_0076500
453 Ga0501068_0017414
454 Ga0501068_0134334
455 Ga0501068_0188364
456 Ga0501069_0004119
457 Ga0501069_0006871
458 Ga0501069_0085961
459 Ga0501069_0256600
460 Ga0501070_0078194
461 Ga0501071_0040806
462 Ga0501071_0073568
463 Ga0501071_0100541
464 Ga0501071_0187883
465 Ga0501071_0234960
466 Ga0501072_0026415
467 Ga0501072_0035930
468 Ga0501072_0236707
469 Ga0501072_0276040
470 Ga0501072_0391349
471 Ga0501072_0400142
472 Ga0501073_0238614
473 Ga0501073_0317580
474 Ga0501073_0427665
475 Ga0501074_0012865
476 Ga0501074_0051989
477 Ga0501074_0081480
478 Ga0501074_0149903
479 Ga0501074_0158288
480 Ga0501074_0351723
481 Ga0501074_0440226
482 Ga0501075_0009635
483 Ga0501075_0061657
484 Ga0501075_0168207
485 Ga0501075_0201879
486 Ga0501075_0223861
487 Ga0501075_0340659
488 Ga0501075_0697355
489 Ga0501076_0008134
490 Ga0501076_0060048
491 Ga0501076_0082105
492 Ga0501076_0089237
493 Ga0501076_0223709
494 Ga0501077_0002858
495 Ga0501077_0071442
496 Ga0501077_0123013
497 Ga0501079_0009643
498 Ga0501079_0018929
499 Ga0501079_0035484
500 Ga0501079_0309687
501 Ga0501079_0630493
502 Ga0501080_0020443
503 Ga0501080_0187411
504 Ga0501080_0209751
505 Ga0501080_0257605
506 Ga0501081_0000855
507 Ga0501081_0050468
508 Ga0501081_0097530
509 Ga0501081_0180835
510 Ga0501083_0035555
511 Ga0501035_0193462
512 Ga0501035_0315328
513 Ga0501045_0047843
514 Ga0501045_0214241
515 Ga0501045_0362287
516 nmdc:mga05p37_122227_c1
517 nmdc:mga05p37_1842_c1
518 nmdc:mga09592_239242_c1
519 nmdc:mga0qj67_253057_c1
520 nmdc:mga06r32_536317_c1
521 nmdc:mga08y16_210739_c1
522 nmdc:mga0n895_95918_c1
523 nmdc:mga0a205_77056_c1
524 Ga0501084_0022161
525 Ga0501084_0042356
526 Ga0501084_0158440
527 Ga0501084_0256707
528 Ga0501084_0337218
529 Ga0501084_0569730
530 Ga0590071_000659
531 Ga0590074_005294
532 Ga0501082_0004081
533 Ga0501082_0187640
534 Ga0501082_0351330
535 Ga0530510_0011804
536 Ga0530510_0086374
537 Ga0530510_0211668
538 Ga0530510_0231507
539 Ga0530510_0318556
540 Ga0530510_0325786
541 Ga0530510_0489285
542 3001270328
543 3001896059
544 3006990192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

51

188

0.85

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

53

273

0.64

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.7856 5 230
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.781 5 230
3dqz-assembly2.cif.gz_D structure of the hydroxynitrile lyase from arabidopsis thaliana 0.7801 3 232
5hk8-assembly1.cif.gz_D crystal structure of a methylesterase protein mes16 from arabidopsis 0.7776 6 228
6cob-assembly1.cif.gz_B athnl enantioselectivity mutant at-a9-h7 apo, y13c,y121l,p126f,l128w,c131t,f179l,a209i 0.774 3 233
ID Description Score Start End Superfamily
af_F4JRA6_1_133_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.914 4 99 3.40.50.1820
af_A0A0N7KCX9_11_155_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8878 2 99 3.40.50.1820
af_A0A1D6J508_11_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8739 3 99 3.40.50.1820
af_Q0JG99_6_268_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7973 1 233 3.40.50.1820
af_F4IMK2_5_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7753 2 234 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W1BQ25-F1-model_v4 Alpha/beta fold hydrolase 0.9885 1 103 GO:0009694
GO:0009696
GO:0080030
GO:0080031
GO:0080032
AF-A0A535XCU7-F1-model_v4 Alpha/beta hydrolase 0.9817 54 237 GO:0016787
AF-A0A537ZT76-F1-model_v4 Alpha/beta hydrolase 0.9804 3 234 GO:0016787
AF-A0A7Y9FHL4-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9803 2 233
AF-A0A536AN70-F1-model_v4 Alpha/beta hydrolase 0.9799 1 178 GO:0016787

Map