F378407

General Info

Members Datasets Scaffolds Average Seq Length
272 179 270 362

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10002145|Ga0207646_100021455
Length 437
Sequence MPPIKGMQASAAAILEGSPVDFGPASDGMIYLHRMEARFVNSESLREQAPNAFASSTVFLFRSGKKQYRLAVISIEVRIGQHSYRVLIGPGLLETVGNAIKEKLSPSRCAIISDTNVAPLFAEPVKKSLTSAGFDSVLIIVPAGEQSKTLEQTSTACEQMLLEGLDRQSFVVGLGGGVIGDLSGFVAAIFQRGIPHVQIPTTLLAMVDSSIGGKTGVNARAGKNLIGAIHQPVLVIDDVDILKTLPSRELRQGFAEIIKHAIIADAEMFAHLTQFAGSKLDCFKQSSFCEEFVSLIRRNIEIKANIVAKDERDRTGERAVLNFGHTIGHAIERAGDYKTFLHGEAVSLGMVATASISVKKAGLPEDERNAIVDLLRKFGLPTKLPTNVPRQKMFDALKFDKKFEHGRIRFLVTPKIGSASLSGDVTMEDIRAAVEKL

Samples

Sample ID Description Type Environment
1 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
2 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
130 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
178 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0
Isolates 0.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 6.99
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 2.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000066 3300000545 Bacteria 19684
2 JGI24744J21845_10021270 3300002077 Bacteria 1277
3 JGI24033J26618_1000014 3300002155 Bacteria 29929
4 JGI25406J46586_10000020 3300003203 Bacteria 86123
5 rootH2_10036383 3300003320 Bacteria 16202
6 rootL2_10151540 3300003322 Bacteria 1810
7 rootH1_10254002 3300003323 Bacteria 7082
8 JGI25405J52794_10002684 3300003911 Bacteria 3086
9 Ga0065704_10008586 3300005289 Bacteria 3428
10 Ga0065704_10019679 3300005289 Unclassified 1549
11 Ga0065704_10024382 3300005289 Bacteria 1808
12 Ga0065712_10088325 3300005290 Bacteria 2527
13 Ga0065712_10109306 3300005290 Unclassified 1847
14 Ga0065715_10099428 3300005293 Bacteria 3400
15 Ga0065715_10104362 3300005293 Bacteria 2967
16 Ga0070658_10022648 3300005327 Bacteria 5041
17 Ga0070676_10105423 3300005328 Unclassified 1748
18 Ga0070676_10107347 3300005328 Bacteria 1733
19 Ga0070676_10208216 3300005328 Bacteria 1285
20 Ga0070690_100008499 3300005330 Bacteria 5916
21 Ga0070670_100005823 3300005331 Bacteria 10421
22 Ga0070670_100133998 3300005331 Bacteria 2140
23 Ga0068869_100107835 3300005334 Bacteria 2115
24 Ga0070666_10051865 3300005335 Bacteria 2764
25 Ga0068868_100132189 3300005338 Bacteria 2043
26 Ga0070689_100125906 3300005340 Unclassified 2050
27 Ga0070661_100009547 3300005344 Bacteria 6721
28 Ga0070668_100011430 3300005347 Bacteria 6612
29 Ga0070675_100005429 3300005354 Bacteria 9746
30 Ga0070675_100083848 3300005354 Bacteria 2661
31 Ga0070675_100098121 3300005354 Bacteria 2464
32 Ga0070671_100041937 3300005355 Bacteria 3804
33 Ga0070671_100065121 3300005355 Bacteria 3035
34 Ga0070674_100024237 3300005356 Bacteria 3936
35 Ga0070673_100018118 3300005364 Bacteria 5026
36 Ga0070673_100166102 3300005364 Bacteria 1881
37 Ga0070667_100341372 3300005367 Bacteria 1354
38 Ga0070714_100076754 3300005435 Unclassified 2902
39 Ga0070713_100110973 3300005436 Bacteria 2391
40 Ga0070710_10024777 3300005437 Bacteria 3169
41 Ga0070711_100002013 3300005439 Bacteria 11443
42 Ga0070711_100142432 3300005439 Unclassified 1799
43 Ga0070711_100213291 3300005439 Bacteria 1496
44 Ga0070708_100021566 3300005445 Bacteria 5450
45 Ga0070708_100086286 3300005445 Bacteria 2850
46 Ga0070708_100128237 3300005445 Bacteria 2346
47 Ga0070708_100282224 3300005445 Unclassified 1563
48 Ga0070678_100070401 3300005456 Bacteria 2614
49 Ga0070678_100098919 3300005456 Unclassified 2256
50 Ga0070681_10179229 3300005458 Bacteria 2040
51 Ga0068867_100000956 3300005459 Bacteria 19662
52 Ga0070706_100000035 3300005467 Bacteria 152107
53 Ga0070706_100000285 3300005467 Bacteria 61353
54 Ga0070706_100002580 3300005467 Bacteria 18211
55 Ga0070706_100190585 3300005467 Unclassified 1916
56 Ga0070706_100236542 3300005467 Bacteria 1705
57 Ga0070707_100001740 3300005468 Bacteria 20969
58 Ga0070707_100037225 3300005468 Bacteria 4643
59 Ga0070707_100104690 3300005468 Bacteria 2743
60 Ga0070707_100172097 3300005468 Unclassified 2110
61 Ga0070707_100296755 3300005468 Bacteria 1570
62 Ga0070698_100000407 3300005471 Bacteria 45661
63 Ga0070698_100010668 3300005471 Bacteria 9788
64 Ga0070698_100171733 3300005471 Bacteria 2109
65 Ga0070698_100195088 3300005471 Bacteria 1962
66 Ga0070699_100223732 3300005518 Bacteria 1677
67 Ga0070684_100007688 3300005535 Bacteria 8405
68 Ga0070697_100005705 3300005536 Bacteria 9588
69 Ga0070697_100009640 3300005536 Bacteria 7543
70 Ga0070697_100012378 3300005536 Bacteria 6684
71 Ga0070697_100022754 3300005536 Bacteria 4980
72 Ga0070697_100055671 3300005536 Bacteria 3216
73 Ga0070697_100220378 3300005536 Unclassified 1617
74 Ga0070672_100017981 3300005543 Viruses 5100
75 Ga0070664_100007666 3300005564 Bacteria 8720
76 Ga0068854_100107592 3300005578 Bacteria 2099
77 Ga0068866_10103385 3300005718 Bacteria 1576
78 Ga0068860_100049133 3300005843 Viruses 4020
79 Ga0081455_10004605 3300005937 Bacteria 15400
80 Ga0081455_10005958 3300005937 Bacteria 13217
81 Ga0081455_10024366 3300005937 Bacteria 5605
82 Ga0081455_10058146 3300005937 Bacteria 3273
83 Ga0081455_10128121 3300005937 Bacteria 1989
84 Ga0081540_1000018 3300005983 Bacteria 164931
85 Ga0081539_10000052 3300005985 Bacteria 268240
86 Ga0081539_10013326 3300005985 Bacteria 6201
87 Ga0070717_10013902 3300006028 Bacteria 6181
88 Ga0070717_10046590 3300006028 Unclassified 3548
89 Ga0070715_10034008 3300006163 Bacteria 2086
90 Ga0070716_100060654 3300006173 Bacteria 2186
91 Ga0070712_100031674 3300006175 Bacteria 3564
92 Ga0070712_100097418 3300006175 Bacteria 2168
93 Ga0097621_100025503 3300006237 Bacteria 4626
94 Ga0097621_100053533 3300006237 Bacteria 3289
95 Ga0068871_100093626 3300006358 Bacteria 2507
96 Ga0068871_100207364 3300006358 Bacteria 1694
97 Ga0075434_100471566 3300006871 Unclassified 1277
98 Ga0075436_100011369 3300006914 Bacteria 6111
99 Ga0075435_100012823 3300007076 Bacteria 6212
100 Ga0111539_10134465 3300009094 Bacteria 2895
101 Ga0105245_10153694 3300009098 Unclassified 2178
102 Ga0105245_10206380 3300009098 Bacteria 1889
103 Ga0105245_10520097 3300009098 Bacteria 1208
104 Ga0114129_10010037 3300009147 Bacteria 13498
105 Ga0114129_10065369 3300009147 Bacteria 5076
106 Ga0114129_10094181 3300009147 Bacteria 4148
107 Ga0105243_10000065 3300009148 Bacteria 124947
108 Ga0105242_10043777 3300009176 Bacteria 3623
109 Ga0105242_10064445 3300009176 Bacteria 3021
110 Ga0105237_10200525 3300009545 Bacteria 1995
111 Ga0099796_10046194 3300010159 Bacteria 1494
112 Ga0105246_10323211 3300011119 Unclassified 1255
113 Ga0157373_10021824 3300013100 Bacteria 4646
114 Ga0157370_10000979 3300013104 Bacteria 36192
115 Ga0157374_10005835 3300013296 Bacteria 10404
116 Ga0157378_10183724 3300013297 Bacteria 1968
117 Ga0157378_10192757 3300013297 Bacteria 1923
118 Ga0163162_10022831 3300013306 Bacteria 6170
119 Ga0163162_10341142 3300013306 Unclassified 1631
120 Ga0157372_10013093 3300013307 Bacteria 8851
121 Ga0157372_10211346 3300013307 Bacteria 2248
122 Ga0157375_10160249 3300013308 Unclassified 2391
123 Ga0157375_10687205 3300013308 Unclassified 1178
124 Ga0182008_10059496 3300014497 Bacteria 1885
125 Ga0163161_10017760 3300017792 Bacteria 4984
126 Ga0207666_1007584 3300025271 Unclassified 1432
127 Ga0207697_10000337 3300025315 Bacteria 26165
128 Ga0207697_10004621 3300025315 Bacteria 6542
129 Ga0207697_10012828 3300025315 Bacteria 3505
130 Ga0207697_10047291 3300025315 Unclassified 1774
131 Ga0207697_10065290 3300025315 Unclassified 1519
132 Ga0207692_10018616 3300025898 Bacteria 3121
133 Ga0207688_10025156 3300025901 Bacteria 3268
134 Ga0207705_10006203 3300025909 Bacteria 8885
135 Ga0207684_10000043 3300025910 Bacteria 259939
136 Ga0207684_10014194 3300025910 Bacteria 6877
137 Ga0207693_10010201 3300025915 Bacteria 7625
138 Ga0207693_10205077 3300025915 Unclassified 1550
139 Ga0207663_10042877 3300025916 Bacteria 2766
140 Ga0207646_10002145 3300025922 Bacteria 23583
141 Ga0207646_10027642 3300025922 Bacteria 5171
142 Ga0207646_10157005 3300025922 Bacteria 2052
143 Ga0207646_10162234 3300025922 Bacteria 2017
144 Ga0207646_10166518 3300025922 Bacteria 1990
145 Ga0207646_10239563 3300025922 Bacteria 1639
146 Ga0207646_10254643 3300025922 Unclassified 1586
147 Ga0207681_10036088 3300025923 Bacteria 3260
148 Ga0207650_10010955 3300025925 Bacteria 6232
149 Ga0207659_10253160 3300025926 Bacteria 1430
150 Ga0207687_10133520 3300025927 Bacteria 1874
151 Ga0207700_10292555 3300025928 Unclassified 1404
152 Ga0207700_10430994 3300025928 Bacteria 1159
153 Ga0207664_10081455 3300025929 Unclassified 2634
154 Ga0207644_10018446 3300025931 Bacteria 4720
155 Ga0207644_10113050 3300025931 Bacteria 2056
156 Ga0207706_10012734 3300025933 Bacteria 7656
157 Ga0207709_10000407 3300025935 Bacteria 42024
158 Ga0207709_10001186 3300025935 Bacteria 18834
159 Ga0207665_10008481 3300025939 Bacteria 6768
160 Ga0207665_10037291 3300025939 Bacteria 3235
161 Ga0207665_10108302 3300025939 Bacteria 1949
162 Ga0207689_10177920 3300025942 Bacteria 1754
163 Ga0207651_10254323 3300025960 Bacteria 1439
164 Ga0207668_10196492 3300025972 Bacteria 1603
165 Ga0207640_10283919 3300025981 Bacteria 1302
166 Ga0207658_10043683 3300025986 Bacteria 3259
167 Ga0207703_10041467 3300026035 Unclassified 3688
168 Ga0207708_10003672 3300026075 Bacteria 11335
169 Ga0207648_10000702 3300026089 Bacteria 37525
170 Ga0207648_10178495 3300026089 Bacteria 1879
171 Ga0207676_10323258 3300026095 Bacteria 1417
172 Ga0209974_10018090 3300027876 Bacteria 2337
173 Ga0268266_10048138 3300028379 Bacteria 3653
174 Ga0268266_10377245 3300028379 Bacteria 1337
175 Ga0268266_10394412 3300028379 Unclassified 1308
176 Ga0268264_10039761 3300028381 Bacteria 3885
177 Ga0265325_10008239 3300031241 Bacteria 6162
178 Ga0265331_10016951 3300031250 Bacteria 3811
179 Ga0265327_10020136 3300031251 Bacteria 4076
180 Ga0307408_100000061 3300031548 Bacteria 128129
181 Ga0307408_100004272 3300031548 Bacteria 9712
182 Ga0307406_10000692 3300031901 Bacteria 19072
183 Ga0307407_10002054 3300031903 Bacteria 7698
184 Ga0307412_10000013 3300031911 Bacteria 365239
185 Ga0307409_100006937 3300031995 Bacteria 6724
186 Ga0307414_10000033 3300032004 Bacteria 183814
187 Ga0307414_10047216 3300032004 Bacteria 2962
188 Ga0307411_10035410 3300032005 Unclassified 3117
189 Ga0373944_0070026 3300035089 Bacteria 1141
190 Ga0373953_0117987 3300035117 Bacteria 1126
191 Ga0373955_0046243 3300035172 Bacteria 2352
192 Ga0373937_0089447 3300036401 Bacteria 2851
193 Ga0373925_0149549 3300037068 Bacteria 1833
194 Ga0373925_0160957 3300037068 Bacteria 1768
195 Ga0395900_0020114 3300037418 Bacteria 6809
196 Ga0395905_0129431 3300037471 Unclassified 2374
197 Ga0436364_1383393 3300037853 Bacteria 2696
198 Ga0395901_0009988 3300038443 Bacteria 9619
199 Ga0436365_0243283 3300039437 Bacteria 3001
200 Ga0436360_0151859 3300039438 Bacteria 2931
201 Ga0450890_000034 3300042127 Bacteria 31571
202 Ga0450893_0000811 3300042532 Bacteria 4597
203 Ga0466965_0002198 3300044683 Bacteria 8205
204 Ga0466964_0032202 3300044706 Bacteria 2083
205 Ga0466971_0000054 3300044719 Bacteria 44392
206 Ga0466968_0030114 3300044735 Bacteria 2247
207 Ga0451576_0194190 3300045051 Bacteria 2120
208 Ga0495629_0124596 3300046459 Bacteria 1795
209 Ga0495651_0177988 3300046462 Bacteria 1508
210 Ga0495652_0013583 3300046529 Bacteria 7329
211 Ga0495667_0047770 3300046559 Bacteria 2827
212 Ga0495599_0067983 3300046678 Unclassified 2224
213 Ga0495623_0076266 3300046679 Unclassified 2080
214 Ga0495604_0095539 3300047317 Unclassified 2195
215 Ga0495674_0126917 3300047319 Bacteria 2152
216 Ga0495674_0206234 3300047319 Bacteria 1629
217 Ga0495675_0058536 3300047444 Unclassified 2443
218 Ga0495684_0015525 3300047471 Bacteria 5862
219 Ga0495684_0080486 3300047471 Bacteria 2473
220 Ga0495602_0080287 3300048088 Unclassified 2748
221 Ga0496100_0009645 3300048903 Bacteria 5429
222 Ga0496100_0111664 3300048903 Bacteria 1900
223 Ga0496101_0008508 3300048904 Bacteria 6707
224 Ga0496103_0170529 3300048906 Unclassified 1397
225 Ga0496104_0007681 3300048907 Bacteria 9546
226 Ga0496106_0011416 3300048909 Bacteria 6572
227 Ga0496107_0002913 3300048910 Bacteria 11313
228 Ga0496109_0058737 3300048912 Bacteria 3514
229 Ga0496110_0236064 3300048913 Bacteria 1664
230 Ga0496112_0097294 3300048915 Bacteria 2914
231 Ga0496112_0149405 3300048915 Unclassified 2304
232 Ga0496112_0244790 3300048915 Bacteria 1745
233 Ga0496113_0036494 3300048916 Bacteria 3602
234 Ga0496113_0206079 3300048916 Bacteria 1564
235 Ga0496113_0257452 3300048916 Bacteria 1394
236 Ga0496114_0013011 3300048917 Bacteria 6668
237 Ga0496115_0003467 3300048918 Bacteria 11336
238 Ga0496115_0007492 3300048918 Bacteria 8034
239 Ga0496115_0211870 3300048918 Bacteria 1600
240 Ga0501031_0001248 3300049568 Bacteria 15592
241 Ga0501032_0000132 3300049569 Bacteria 60576
242 Ga0501032_0018331 3300049569 Bacteria 4905
243 Ga0501032_0108556 3300049569 Bacteria 1837
244 Ga0501033_0000010 3300049570 Bacteria 270511
245 Ga0501033_0000043 3300049570 Bacteria 135426
246 Ga0501037_0000540 3300049573 Bacteria 30187
247 Ga0501038_0000119 3300049574 Bacteria 67069
248 Ga0501038_0003861 3300049574 Bacteria 13931
249 Ga0501038_0104160 3300049574 Bacteria 2358
250 Ga0501039_0009273 3300049575 Bacteria 7495
251 Ga0501043_0003133 3300049579 Bacteria 13705
252 Ga0501043_0007853 3300049579 Bacteria 8437
253 Ga0501047_0033806 3300049581 Bacteria 4935
254 Ga0501047_0178399 3300049581 Bacteria 1991
255 Ga0501067_0071132 3300049583 Bacteria 1926
256 Ga0501070_0012014 3300049586 Bacteria 7308
257 Ga0501071_0038165 3300049587 Bacteria 3432
258 Ga0501035_0000003 3300049822 Bacteria 557461
259 Ga0501044_0000839 3300049823 Bacteria 36833
260 Ga0501044_0096057 3300049823 Bacteria 2986
261 Ga0501044_0211355 3300049823 Bacteria 1894
262 nmdc:mga05p37_27974_c1 3300050507 Bacteria 6868
263 nmdc:mga05p37_94458_c1 3300050507 Bacteria 3684
264 nmdc:mga0rr50_212215_c1 3300050513 Bacteria 1595
265 Ga0495601_0048165 3300053077 Unclassified 2684
266 Ga0495619_0120611 3300053085 Unclassified 1798
267 Ga0500643_007770 3300053087 Bacteria 4280
268 Ga0500555_000015 3300053103 Bacteria 230204
269 Ga0500556_0049953 3300053104 Bacteria 1510
270 Ga0466962_0000006 3300061719 Bacteria 168917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035089 Ga0373944_0070026 Ga0373944_0070026_250_1122 287
2 3300053104 Ga0500556_0049953 Ga0500556_0049953_524_1429 299
3 3300009094 Ga0111539_10134465 Ga0111539_101344652 310
4 3300009147 Ga0114129_10094181 Ga0114129_100941812 310
5 3300048916 Ga0496113_0206079 Ga0496113_0206079_53_1000 315
6 3300005327 Ga0070658_10022648 Ga0070658_100226482 316
7 3300025909 Ga0207705_10006203 Ga0207705_100062032 316
8 3300005937 Ga0081455_10058146 Ga0081455_100581462 334
9 3300005354 Ga0070675_100005429 Ga0070675_1000054292 336
10 3300005535 Ga0070684_100007688 Ga0070684_1000076882 336
11 3300025315 Ga0207697_10000337 Ga0207697_100003377 336
12 3300026035 Ga0207703_10041467 Ga0207703_100414672 336
13 3300026075 Ga0207708_10003672 Ga0207708_100036727 336
14 3300026095 Ga0207676_10323258 Ga0207676_103232581 336
15 3300028381 Ga0268264_10039761 Ga0268264_100397614 336
16 3300048915 Ga0496112_0244790 Ga0496112_0244790_215_1279 338
17 3300005289 Ga0065704_10019679 Ga0065704_100196792 346
18 3300005293 Ga0065715_10104362 Ga0065715_101043622 346
19 3300005338 Ga0068868_100132189 Ga0068868_1001321892 346
20 3300013297 Ga0157378_10192757 Ga0157378_101927572 346
21 3300025271 Ga0207666_1007584 Ga0207666_10075842 346
22 3300028379 Ga0268266_10394412 Ga0268266_103944121 346
23 3300003911 JGI25405J52794_10002684 JGI25405J52794_100026843 347
24 3300005331 Ga0070670_100133998 Ga0070670_1001339981 347
25 3300005435 Ga0070714_100076754 Ga0070714_1000767542 347
26 3300005937 Ga0081455_10004605 Ga0081455_1000460510 347
27 3300005937 Ga0081455_10128121 Ga0081455_101281212 347
28 3300006871 Ga0075434_100471566 Ga0075434_1004715662 347
29 3300009147 Ga0114129_10065369 Ga0114129_100653694 347
30 3300047471 Ga0495684_0015525 Ga0495684_0015525_2043_3107 347
31 3300005458 Ga0070681_10179229 Ga0070681_101792291 348
32 3300005937 Ga0081455_10005958 Ga0081455_100059582 348
33 3300006173 Ga0070716_100060654 Ga0070716_1000606541 348
34 3300006175 Ga0070712_100097418 Ga0070712_1000974182 348
35 3300025939 Ga0207665_10108302 Ga0207665_101083021 348
36 3300005290 Ga0065712_10109306 Ga0065712_101093061 349
37 3300005445 Ga0070708_100086286 Ga0070708_1000862862 349
38 3300005536 Ga0070697_100005705 Ga0070697_1000057056 349
39 3300025922 Ga0207646_10166518 Ga0207646_101665182 349
40 3300048915 Ga0496112_0149405 Ga0496112_0149405_779_1855 349
41 3300048916 Ga0496113_0036494 Ga0496113_0036494_1856_2932 349
42 3300005334 Ga0068869_100107835 Ga0068869_1001078353 350
43 3300005459 Ga0068867_100000956 Ga0068867_1000009567 350
44 3300005467 Ga0070706_100190585 Ga0070706_1001905852 350
45 3300005468 Ga0070707_100172097 Ga0070707_1001720972 350
46 3300005564 Ga0070664_100007666 Ga0070664_1000076666 350
47 3300005578 Ga0068854_100107592 Ga0068854_1001075922 350
48 3300005937 Ga0081455_10024366 Ga0081455_100243665 350
49 3300009098 Ga0105245_10206380 Ga0105245_102063802 350
50 3300009148 Ga0105243_10000065 Ga0105243_1000006572 350
51 3300009545 Ga0105237_10200525 Ga0105237_102005252 350
52 3300014497 Ga0182008_10059496 Ga0182008_100594962 350
53 3300025927 Ga0207687_10133520 Ga0207687_101335202 350
54 3300025935 Ga0207709_10000407 Ga0207709_1000040715 350
55 3300025942 Ga0207689_10177920 Ga0207689_101779202 350
56 3300025981 Ga0207640_10283919 Ga0207640_102839191 350
57 3300026089 Ga0207648_10000702 Ga0207648_1000070221 350
58 3300031250 Ga0265331_10016951 Ga0265331_100169513 350
59 3300031251 Ga0265327_10020136 Ga0265327_100201362 350
60 3300031548 Ga0307408_100000061 Ga0307408_10000006175 350
61 3300031903 Ga0307407_10002054 Ga0307407_100020543 350
62 3300032005 Ga0307411_10035410 Ga0307411_100354102 350
63 3300042127 Ga0450890_000034 Ga0450890_000034_11958_13043 350
64 3300042532 Ga0450893_0000811 Ga0450893_0000811_2977_4062 350
65 3300049569 Ga0501032_0018331 Ga0501032_0018331_944_2029 350
66 3300050507 nmdc:mga05p37_94458_c1 nmdc:mga05p37_94458_c1_1624_2739 350
67 3300003323 rootH1_10254002 rootH1_102540026 351
68 3300005289 Ga0065704_10008586 Ga0065704_100085862 351
69 3300005445 Ga0070708_100282224 Ga0070708_1002822241 351
70 3300005468 Ga0070707_100296755 Ga0070707_1002967552 351
71 3300005536 Ga0070697_100055671 Ga0070697_1000556713 351
72 3300005983 Ga0081540_1000018 Ga0081540_100001839 351
73 3300006175 Ga0070712_100031674 Ga0070712_1000316743 351
74 3300009147 Ga0114129_10010037 Ga0114129_100100373 351
75 3300013100 Ga0157373_10021824 Ga0157373_100218243 351
76 3300013104 Ga0157370_10000979 Ga0157370_1000097926 351
77 3300025315 Ga0207697_10047291 Ga0207697_100472911 351
78 3300025915 Ga0207693_10010201 Ga0207693_100102017 351
79 3300025916 Ga0207663_10042877 Ga0207663_100428771 351
80 3300025922 Ga0207646_10254643 Ga0207646_102546432 351
81 3300025972 Ga0207668_10196492 Ga0207668_101964922 351
82 3300027876 Ga0209974_10018090 Ga0209974_100180903 351
83 3300028379 Ga0268266_10377245 Ga0268266_103772451 351
84 3300031241 Ga0265325_10008239 Ga0265325_100082394 351
85 3300037418 Ga0395900_0020114 Ga0395900_0020114_728_1810 351
86 3300037471 Ga0395905_0129431 Ga0395905_0129431_220_1302 351
87 3300038443 Ga0395901_0009988 Ga0395901_0009988_4449_5531 351
88 3300048912 Ga0496109_0058737 Ga0496109_0058737_1222_2277 351
89 3300048913 Ga0496110_0236064 Ga0496110_0236064_48_1103 351
90 3300048918 Ga0496115_0211870 Ga0496115_0211870_213_1268 351
91 3300050507 nmdc:mga05p37_27974_c1 nmdc:mga05p37_27974_c1_3375_4484 351
92 iso_pu_bacteria 2786546548 2787508857 351
93 3300005471 Ga0070698_100195088 Ga0070698_1001950882 352
94 3300005536 Ga0070697_100009640 Ga0070697_1000096405 352
95 3300005985 Ga0081539_10013326 Ga0081539_100133264 352
96 3300039437 Ga0436365_0243283 Ga0436365_0243283_1116_2222 352
97 3300002077 JGI24744J21845_10021270 JGI24744J21845_100212702 353
98 3300005536 Ga0070697_100022754 Ga0070697_1000227545 353
99 3300006028 Ga0070717_10046590 Ga0070717_100465904 353
100 3300013307 Ga0157372_10013093 Ga0157372_100130937 353
101 3300025315 Ga0207697_10065290 Ga0207697_100652901 353
102 3300025939 Ga0207665_10037291 Ga0207665_100372912 353
103 3300031548 Ga0307408_100004272 Ga0307408_1000042722 353
104 3300031901 Ga0307406_10000692 Ga0307406_100006924 353
105 3300031911 Ga0307412_10000013 Ga0307412_10000013306 353
106 3300031995 Ga0307409_100006937 Ga0307409_1000069373 353
107 3300032004 Ga0307414_10000033 Ga0307414_1000003336 353
108 3300032004 Ga0307414_10047216 Ga0307414_100472163 353
109 3300036401 Ga0373937_0089447 Ga0373937_0089447_920_2134 353
110 3300037853 Ga0436364_1383393 Ga0436364_1383393_91_1152 353
111 3300039438 Ga0436360_0151859 Ga0436360_0151859_445_1536 353
112 3300045051 Ga0451576_0194190 Ga0451576_0194190_288_1376 353
113 3300046459 Ga0495629_0124596 Ga0495629_0124596_645_1745 353
114 3300046529 Ga0495652_0013583 Ga0495652_0013583_312_1526 353
115 3300046559 Ga0495667_0047770 Ga0495667_0047770_1179_2393 353
116 3300046678 Ga0495599_0067983 Ga0495599_0067983_178_1392 353
117 3300046679 Ga0495623_0076266 Ga0495623_0076266_803_2017 353
118 3300047317 Ga0495604_0095539 Ga0495604_0095539_64_1278 353
119 3300047319 Ga0495674_0206234 Ga0495674_0206234_56_1270 353
120 3300047444 Ga0495675_0058536 Ga0495675_0058536_96_1310 353
121 3300048088 Ga0495602_0080287 Ga0495602_0080287_152_1366 353
122 3300053077 Ga0495601_0048165 Ga0495601_0048165_1053_2267 353
123 3300053085 Ga0495619_0120611 Ga0495619_0120611_87_1241 353
124 3300053087 Ga0500643_007770 Ga0500643_007770_3139_4206 353
125 3300053103 Ga0500555_000015 Ga0500555_000015_58807_59874 353
126 3300003203 JGI25406J46586_10000020 JGI25406J46586_1000002027 354
127 3300003322 rootL2_10151540 rootL2_101515402 354
128 3300005289 Ga0065704_10024382 Ga0065704_100243822 354
129 3300005290 Ga0065712_10088325 Ga0065712_100883251 354
130 3300005328 Ga0070676_10208216 Ga0070676_102082161 354
131 3300005331 Ga0070670_100005823 Ga0070670_1000058234 354
132 3300005335 Ga0070666_10051865 Ga0070666_100518652 354
133 3300005340 Ga0070689_100125906 Ga0070689_1001259062 354
134 3300005354 Ga0070675_100083848 Ga0070675_1000838482 354
135 3300005354 Ga0070675_100098121 Ga0070675_1000981213 354
136 3300005355 Ga0070671_100065121 Ga0070671_1000651212 354
137 3300005364 Ga0070673_100018118 Ga0070673_1000181183 354
138 3300005436 Ga0070713_100110973 Ga0070713_1001109733 354
139 3300005437 Ga0070710_10024777 Ga0070710_100247772 354
140 3300005439 Ga0070711_100002013 Ga0070711_10000201314 354
141 3300005439 Ga0070711_100142432 Ga0070711_1001424322 354
142 3300005445 Ga0070708_100021566 Ga0070708_1000215665 354
143 3300005468 Ga0070707_100001740 Ga0070707_1000017408 354
144 3300005468 Ga0070707_100037225 Ga0070707_1000372255 354
145 3300005468 Ga0070707_100104690 Ga0070707_1001046902 354
146 3300005985 Ga0081539_10000052 Ga0081539_1000005240 354
147 3300006028 Ga0070717_10013902 Ga0070717_100139024 354
148 3300006237 Ga0097621_100025503 Ga0097621_1000255034 354
149 3300006237 Ga0097621_100053533 Ga0097621_1000535331 354
150 3300006358 Ga0068871_100093626 Ga0068871_1000936264 354
151 3300006358 Ga0068871_100207364 Ga0068871_1002073641 354
152 3300006914 Ga0075436_100011369 Ga0075436_1000113694 354
153 3300007076 Ga0075435_100012823 Ga0075435_1000128232 354
154 3300009098 Ga0105245_10520097 Ga0105245_105200971 354
155 3300009176 Ga0105242_10043777 Ga0105242_100437773 354
156 3300013296 Ga0157374_10005835 Ga0157374_100058356 354
157 3300013306 Ga0163162_10341142 Ga0163162_103411422 354
158 3300013307 Ga0157372_10211346 Ga0157372_102113463 354
159 3300013308 Ga0157375_10687205 Ga0157375_106872051 354
160 3300025315 Ga0207697_10012828 Ga0207697_100128284 354
161 3300025898 Ga0207692_10018616 Ga0207692_100186163 354
162 3300025901 Ga0207688_10025156 Ga0207688_100251562 354
163 3300025922 Ga0207646_10027642 Ga0207646_100276424 354
164 3300025922 Ga0207646_10162234 Ga0207646_101622341 354
165 3300025922 Ga0207646_10239563 Ga0207646_102395631 354
166 3300025923 Ga0207681_10036088 Ga0207681_100360883 354
167 3300025925 Ga0207650_10010955 Ga0207650_100109553 354
168 3300025928 Ga0207700_10430994 Ga0207700_104309941 354
169 3300025929 Ga0207664_10081455 Ga0207664_100814553 354
170 3300025931 Ga0207644_10018446 Ga0207644_100184464 354
171 3300025931 Ga0207644_10113050 Ga0207644_101130502 354
172 3300025935 Ga0207709_10001186 Ga0207709_1000118615 354
173 3300025986 Ga0207658_10043683 Ga0207658_100436834 354
174 3300026089 Ga0207648_10178495 Ga0207648_101784952 354
175 3300028379 Ga0268266_10048138 Ga0268266_100481384 354
176 3300035117 Ga0373953_0117987 Ga0373953_0117987_37_1113 354
177 3300035172 Ga0373955_0046243 Ga0373955_0046243_1006_2082 354
178 3300037068 Ga0373925_0149549 Ga0373925_0149549_83_1159 354
179 3300044683 Ga0466965_0002198 Ga0466965_0002198_2513_3616 354
180 3300044706 Ga0466964_0032202 Ga0466964_0032202_289_1392 354
181 3300044719 Ga0466971_0000054 Ga0466971_0000054_20346_21449 354
182 3300044735 Ga0466968_0030114 Ga0466968_0030114_344_1447 354
183 3300046462 Ga0495651_0177988 Ga0495651_0177988_182_1246 354
184 3300047319 Ga0495674_0126917 Ga0495674_0126917_1043_2119 354
185 3300047471 Ga0495684_0080486 Ga0495684_0080486_508_1584 354
186 3300048903 Ga0496100_0111664 Ga0496100_0111664_652_1716 354
187 3300048916 Ga0496113_0257452 Ga0496113_0257452_286_1350 354
188 3300048917 Ga0496114_0013011 Ga0496114_0013011_4069_5133 354
189 3300048918 Ga0496115_0003467 Ga0496115_0003467_9459_10523 354
190 3300049568 Ga0501031_0001248 Ga0501031_0001248_4501_5643 354
191 3300049569 Ga0501032_0108556 Ga0501032_0108556_542_1645 354
192 3300049570 Ga0501033_0000043 Ga0501033_0000043_104513_105652 354
193 3300049573 Ga0501037_0000540 Ga0501037_0000540_20087_21229 354
194 3300049574 Ga0501038_0003861 Ga0501038_0003861_7649_8788 354
195 3300049574 Ga0501038_0104160 Ga0501038_0104160_892_2034 354
196 3300049575 Ga0501039_0009273 Ga0501039_0009273_3252_4394 354
197 3300049579 Ga0501043_0003133 Ga0501043_0003133_9817_10959 354
198 3300049579 Ga0501043_0007853 Ga0501043_0007853_2609_3715 354
199 3300049581 Ga0501047_0033806 Ga0501047_0033806_2725_3867 354
200 3300049581 Ga0501047_0178399 Ga0501047_0178399_751_1857 354
201 3300049586 Ga0501070_0012014 Ga0501070_0012014_1987_3129 354
202 3300049587 Ga0501071_0038165 Ga0501071_0038165_884_2026 354
203 3300049822 Ga0501035_0000003 Ga0501035_0000003_143391_144533 354
204 3300049823 Ga0501044_0000839 Ga0501044_0000839_27630_28772 354
205 3300049823 Ga0501044_0096057 Ga0501044_0096057_788_1891 354
206 3300049823 Ga0501044_0211355 Ga0501044_0211355_755_1861 354
207 3300061719 Ga0466962_0000006 Ga0466962_0000006_147213_148316 354
208 3300005293 Ga0065715_10099428 Ga0065715_100994284 355
209 3300005328 Ga0070676_10105423 Ga0070676_101054231 355
210 3300005330 Ga0070690_100008499 Ga0070690_1000084991 355
211 3300005347 Ga0070668_100011430 Ga0070668_1000114302 355
212 3300005355 Ga0070671_100041937 Ga0070671_1000419374 355
213 3300005356 Ga0070674_100024237 Ga0070674_1000242372 355
214 3300005364 Ga0070673_100166102 Ga0070673_1001661022 355
215 3300005367 Ga0070667_100341372 Ga0070667_1003413721 355
216 3300005439 Ga0070711_100213291 Ga0070711_1002132913 355
217 3300005456 Ga0070678_100070401 Ga0070678_1000704012 355
218 3300005456 Ga0070678_100098919 Ga0070678_1000989192 355
219 3300005467 Ga0070706_100000285 Ga0070706_10000028519 355
220 3300005471 Ga0070698_100171733 Ga0070698_1001717332 355
221 3300005536 Ga0070697_100220378 Ga0070697_1002203782 355
222 3300005543 Ga0070672_100017981 Ga0070672_1000179812 355
223 3300005718 Ga0068866_10103385 Ga0068866_101033851 355
224 3300005843 Ga0068860_100049133 Ga0068860_1000491331 355
225 3300006163 Ga0070715_10034008 Ga0070715_100340082 355
226 3300009098 Ga0105245_10153694 Ga0105245_101536942 355
227 3300009176 Ga0105242_10064445 Ga0105242_100644453 355
228 3300011119 Ga0105246_10323211 Ga0105246_103232111 355
229 3300013297 Ga0157378_10183724 Ga0157378_101837242 355
230 3300013306 Ga0163162_10022831 Ga0163162_100228315 355
231 3300013308 Ga0157375_10160249 Ga0157375_101602493 355
232 3300017792 Ga0163161_10017760 Ga0163161_100177601 355
233 3300025315 Ga0207697_10004621 Ga0207697_100046217 355
234 3300025910 Ga0207684_10014194 Ga0207684_100141943 355
235 3300025915 Ga0207693_10205077 Ga0207693_102050772 355
236 3300025926 Ga0207659_10253160 Ga0207659_102531601 355
237 3300025928 Ga0207700_10292555 Ga0207700_102925552 355
238 3300025933 Ga0207706_10012734 Ga0207706_100127347 355
239 3300025939 Ga0207665_10008481 Ga0207665_100084814 355
240 3300025960 Ga0207651_10254323 Ga0207651_102543231 355
241 3300037068 Ga0373925_0160957 Ga0373925_0160957_401_1477 355
242 3300048903 Ga0496100_0009645 Ga0496100_0009645_112_1185 355
243 3300048904 Ga0496101_0008508 Ga0496101_0008508_5382_6455 355
244 3300048906 Ga0496103_0170529 Ga0496103_0170529_244_1317 355
245 3300048907 Ga0496104_0007681 Ga0496104_0007681_3878_4951 355
246 3300048909 Ga0496106_0011416 Ga0496106_0011416_4370_5443 355
247 3300048910 Ga0496107_0002913 Ga0496107_0002913_1191_2264 355
248 3300048918 Ga0496115_0007492 Ga0496115_0007492_6127_7200 355
249 3300050513 nmdc:mga0rr50_212215_c1 nmdc:mga0rr50_212215_c1_140_1213 355
250 3300002155 JGI24033J26618_1000014 JGI24033J26618_100001421 356
251 3300003320 rootH2_10036383 rootH2_1003638310 356
252 3300005344 Ga0070661_100009547 Ga0070661_1000095473 356
253 3300005445 Ga0070708_100128237 Ga0070708_1001282372 356
254 3300005467 Ga0070706_100236542 Ga0070706_1002365422 356
255 3300005471 Ga0070698_100000407 Ga0070698_10000040722 356
256 3300005518 Ga0070699_100223732 Ga0070699_1002237321 356
257 3300005536 Ga0070697_100012378 Ga0070697_1000123783 356
258 3300010159 Ga0099796_10046194 Ga0099796_100461942 356
259 3300025922 Ga0207646_10002145 Ga0207646_100021455 356
260 3300025922 Ga0207646_10157005 Ga0207646_101570052 356
261 3300048915 Ga0496112_0097294 Ga0496112_0097294_1787_2896 356
262 3300049569 Ga0501032_0000132 Ga0501032_0000132_33152_34231 356
263 3300049570 Ga0501033_0000010 Ga0501033_0000010_97016_98095 356
264 3300049574 Ga0501038_0000119 Ga0501038_0000119_37089_38186 356
265 3300049583 Ga0501067_0071132 Ga0501067_0071132_302_1399 356
266 iso_pu_bacteria 2718217752 2718716051 356
267 3300000545 CNXas_1000066 CNXas_100006612 357
268 3300005328 Ga0070676_10107347 Ga0070676_101073472 357
269 3300005467 Ga0070706_100000035 Ga0070706_10000003564 357
270 3300005467 Ga0070706_100002580 Ga0070706_10000258013 357
271 3300005471 Ga0070698_100010668 Ga0070698_10001066810 357
272 3300025910 Ga0207684_10000043 Ga0207684_1000004360 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01761

DHQ_synthase

3-dehydroquinate synthase

138

252

0.98

PF24621

253

403

0.9

PF13685

Fe-ADH_2

Iron-containing alcohol dehydrogenase

87

246

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zok-assembly2.cif.gz_C structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad 0.9455 5 357
6lla-assembly2.cif.gz_D crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and nad 0.9385 4 356
5eks-assembly3.cif.gz_A structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with nad 0.9358 5 356
6lk2-assembly1.cif.gz_C crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9345 4 354
3zok-assembly2.cif.gz_C structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad 0.9328 5 357
ID Description Score Start End Superfamily
af_A0A0R0HLZ4_60_246_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9611 5 176 3.40.50.1970
2gruA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9467 5 175 3.40.50.1970
2gruA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9361 5 175 3.40.50.1970
1xahB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9355 5 176 3.40.50.1970
5hvnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9302 5 173 3.40.50.1970
ID Description Score Start End GO Terms
AF-A0A2X1PI66-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9914 97 206 GO:0003856
GO:0009073
AF-A0A3B9D0Y8-F1-model_v4 3-dehydroquinate synthase 0.9901 54 160 GO:0003856
GO:0009073
AF-A0A7S1KI02-F1-model_v4 3-dehydroquinate synthase domain-containing protein 0.9867 83 187 GO:0003856
GO:0009073
GO:0016020
AF-A0A2N2ET27-F1-model_v4 3-dehydroquinate synthase 0.9864 27 111 GO:0003856
AF-A0A658NMV2-F1-model_v4 3-dehydroquinate synthase 0.9863 79 167 GO:0003856
GO:0009073

Feature Viewer

pLDDT pTM Quality
93.43 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map