F378342

General Info

Members Datasets Scaffolds Average Seq Length
272 202 262 235

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10182163|Ga0105249_101821632
Length 260
Sequence MEYADVSRCIGIEGTDRGEAMGARQLSRVSKVYGRGASEVHALIDVDLSVDPGELVAVMGPSGSGKSTLLTIAGSLEEPSGGEVTVGDVPLSRLSRNERAALRRRVIGYVFQDFNLLAGLTAAENVSLPLELDGTSGKAARAAALEALDQLGLPDQADRFPDELSGGERQRVAIARAVVGQRRLLLADEPSGALDSVNGESVMRLVRASCQGGVAGVVVTHDAQLAAWADRVVFLRDGRIVDQTAEQDGPESLLEAGPAR

Samples

Sample ID Description Type Environment
1 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
2 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
3 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
4 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
5 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
6 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
7 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
8 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
9 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
10 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
125 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
129 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
130 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
133 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
152 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
153 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
181 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.32
Metatranscriptomes 0
Isolates 3.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.78
Rhizosphere 90.44
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10022186 3300002075 Bacteria 1314
2 JGI25407J50210_10069397 3300003373 Bacteria 880
3 Ga0070690_100201630 3300005330 Bacteria 1385
4 Ga0068869_100016877 3300005334 Bacteria 4934
5 Ga0070660_100043359 3300005339 Bacteria 3438
6 Ga0070689_100032191 3300005340 Bacteria 3987
7 Ga0070692_10008983 3300005345 Bacteria 4484
8 Ga0070668_100000248 3300005347 Bacteria 35756
9 Ga0070668_100003935 3300005347 Bacteria 10980
10 Ga0070671_100024218 3300005355 Bacteria 4968
11 Ga0070674_100014090 3300005356 Bacteria 4963
12 Ga0070673_100004719 3300005364 Bacteria 8654
13 Ga0070688_100061633 3300005365 Bacteria 2372
14 Ga0070667_100069162 3300005367 Bacteria 3004
15 Ga0070709_10013848 3300005434 Bacteria 4546
16 Ga0070709_10105537 3300005434 Bacteria 1884
17 Ga0070714_100073314 3300005435 Bacteria 2966
18 Ga0070713_100058795 3300005436 Bacteria 3208
19 Ga0070713_100061059 3300005436 Bacteria 3153
20 Ga0070710_10015358 3300005437 Bacteria 3874
21 Ga0070711_100046134 3300005439 Bacteria 2968
22 Ga0070700_100097795 3300005441 Bacteria 1928
23 Ga0070663_100028004 3300005455 Bacteria 3831
24 Ga0070662_100003684 3300005457 Bacteria 9579
25 Ga0068867_100433603 3300005459 Bacteria 1116
26 Ga0070679_100346290 3300005530 Bacteria 1434
27 Ga0070697_100129088 3300005536 Bacteria 2119
28 Ga0070695_100004873 3300005545 Bacteria 7901
29 Ga0070665_100054214 3300005548 Bacteria 4021
30 Ga0068855_100011040 3300005563 Bacteria 10898
31 Ga0068856_100099525 3300005614 Bacteria 2899
32 Ga0070702_100004665 3300005615 Bacteria 6286
33 Ga0068852_100036694 3300005616 Bacteria 4104
34 Ga0068852_100044425 3300005616 Bacteria 3773
35 Ga0068852_100428475 3300005616 Bacteria 1306
36 Ga0068864_100041976 3300005618 Bacteria 3913
37 Ga0068864_100332819 3300005618 Bacteria 1429
38 Ga0068861_100174835 3300005719 Bacteria 1783
39 Ga0068851_10032371 3300005834 Bacteria 2602
40 Ga0068863_100002554 3300005841 Bacteria 18067
41 Ga0068863_100093619 3300005841 Bacteria 2851
42 Ga0068858_100012311 3300005842 Bacteria 8069
43 Ga0068858_100019781 3300005842 Bacteria 6294
44 Ga0068860_100104434 3300005843 Bacteria 2705
45 Ga0068862_100380262 3300005844 Bacteria 1317
46 Ga0081455_10019843 3300005937 Bacteria 6348
47 Ga0081455_10071729 3300005937 Bacteria 2870
48 Ga0081455_10115746 3300005937 Bacteria 2122
49 Ga0081540_1008222 3300005983 Bacteria 7308
50 Ga0081540_1106771 3300005983 Bacteria 1193
51 Ga0070717_10034295 3300006028 Bacteria 4102
52 Ga0070716_100088676 3300006173 Bacteria 1866
53 Ga0070716_100101423 3300006173 Bacteria 1765
54 Ga0070712_100042819 3300006175 Bacteria 3114
55 Ga0070712_100384425 3300006175 Bacteria 1156
56 Ga0097621_100036556 3300006237 Bacteria 3929
57 Ga0068871_100027016 3300006358 Bacteria 4484
58 Ga0075428_100002298 3300006844 Bacteria 20687
59 Ga0075428_100133078 3300006844 Bacteria 2704
60 Ga0075428_100250544 3300006844 Bacteria 1909
61 Ga0075430_100016777 3300006846 Bacteria 6237
62 Ga0075430_100042396 3300006846 Bacteria 3848
63 Ga0075431_100024079 3300006847 Bacteria 6234
64 Ga0075431_100059916 3300006847 Bacteria 3928
65 Ga0075431_100082952 3300006847 Bacteria 3309
66 Ga0075431_100356786 3300006847 Bacteria 1469
67 Ga0075429_100069339 3300006880 Bacteria 3070
68 Ga0068865_100088987 3300006881 Bacteria 2235
69 Ga0105240_10154764 3300009093 Bacteria 2728
70 Ga0111539_10033925 3300009094 Bacteria 6193
71 Ga0105245_10046238 3300009098 Bacteria 3890
72 Ga0105245_10112384 3300009098 Bacteria 2535
73 Ga0105245_10119925 3300009098 Bacteria 2456
74 Ga0105247_10020125 3300009101 Bacteria 4011
75 Ga0114129_10006716 3300009147 Bacteria 16336
76 Ga0114129_10041638 3300009147 Bacteria 6470
77 Ga0114129_10052481 3300009147 Bacteria 5722
78 Ga0114129_10058658 3300009147 Bacteria 5384
79 Ga0114129_10145946 3300009147 Bacteria 3241
80 Ga0105241_10026403 3300009174 Bacteria 4320
81 Ga0105241_10038794 3300009174 Bacteria 3591
82 Ga0105248_10650203 3300009177 Bacteria 1190
83 Ga0105249_10182163 3300009553 Bacteria 2044
84 Ga0105239_10070395 3300010375 Bacteria 3843
85 Ga0105246_10885096 3300011119 Bacteria 799
86 Ga0157370_10018423 3300013104 Bacteria 7021
87 Ga0157370_10024321 3300013104 Bacteria 5999
88 Ga0157369_10023979 3300013105 Bacteria 6788
89 Ga0157378_10049163 3300013297 Bacteria 3752
90 Ga0157372_10000046 3300013307 Bacteria 150498
91 Ga0157375_10054884 3300013308 Bacteria 3926
92 Ga0157375_10272103 3300013308 Bacteria 1856
93 Ga0157380_10068993 3300014326 Bacteria 2851
94 Ga0157379_10020396 3300014968 Bacteria 5858
95 Ga0157376_10555281 3300014969 Bacteria 1137
96 Ga0163161_10002916 3300017792 Bacteria 12111
97 Ga0163161_10167759 3300017792 Bacteria 1677
98 Ga0213876_10026137 3300021384 Bacteria 3079
99 Ga0207692_10134427 3300025898 Bacteria 1400
100 Ga0207710_10134651 3300025900 Bacteria 1189
101 Ga0207647_10085519 3300025904 Bacteria 1886
102 Ga0207699_10016907 3300025906 Bacteria 3826
103 Ga0207707_10020941 3300025912 Bacteria 5713
104 Ga0207707_10080883 3300025912 Bacteria 2837
105 Ga0207695_10032266 3300025913 Bacteria 5733
106 Ga0207671_10027199 3300025914 Bacteria 4277
107 Ga0207693_10002076 3300025915 Bacteria 17507
108 Ga0207693_10297143 3300025915 Bacteria 1265
109 Ga0207663_10031802 3300025916 Bacteria 3126
110 Ga0207662_10115123 3300025918 Bacteria 1680
111 Ga0207657_10008753 3300025919 Bacteria 10245
112 Ga0207652_10232964 3300025921 Bacteria 1660
113 Ga0207646_10553291 3300025922 Bacteria 1034
114 Ga0207694_10009057 3300025924 Bacteria 7513
115 Ga0207687_10022725 3300025927 Bacteria 4176
116 Ga0207687_10028249 3300025927 Bacteria 3768
117 Ga0207700_10027333 3300025928 Bacteria 3993
118 Ga0207700_10075660 3300025928 Bacteria 2610
119 Ga0207664_10065355 3300025929 Bacteria 2912
120 Ga0207644_10282784 3300025931 Bacteria 1332
121 Ga0207644_10404592 3300025931 Bacteria 1116
122 Ga0207690_10006623 3300025932 Bacteria 6862
123 Ga0207706_10007216 3300025933 Bacteria 10277
124 Ga0207686_10024929 3300025934 Bacteria 3472
125 Ga0207709_10048259 3300025935 Bacteria 2593
126 Ga0207704_10046399 3300025938 Bacteria 2589
127 Ga0207665_10000414 3300025939 Bacteria 29429
128 Ga0207665_10164033 3300025939 Bacteria 1600
129 Ga0207711_10252890 3300025941 Bacteria 1618
130 Ga0207689_10005301 3300025942 Bacteria 11551
131 Ga0207679_10390200 3300025945 Bacteria 1222
132 Ga0207712_10003349 3300025961 Bacteria 10149
133 Ga0207668_10007126 3300025972 Bacteria 6636
134 Ga0207668_10022744 3300025972 Bacteria 4018
135 Ga0207658_10059524 3300025986 Bacteria 2847
136 Ga0207658_10068013 3300025986 Bacteria 2686
137 Ga0207703_10452652 3300026035 Bacteria 1199
138 Ga0207678_10060470 3300026067 Bacteria 3259
139 Ga0207678_10163113 3300026067 Bacteria 1903
140 Ga0207708_10188489 3300026075 Bacteria 1641
141 Ga0207702_10071271 3300026078 Bacteria 2992
142 Ga0207641_10002240 3300026088 Bacteria 18067
143 Ga0207648_10155253 3300026089 Bacteria 2020
144 Ga0207674_10088467 3300026116 Bacteria 3090
145 Ga0207675_100037998 3300026118 Bacteria 4492
146 Ga0207683_10131512 3300026121 Bacteria 2251
147 Ga0207698_10032862 3300026142 Bacteria 3764
148 Ga0207698_10362779 3300026142 Bacteria 1373
149 Ga0268266_10376633 3300028379 Bacteria 1338
150 Ga0268265_10121197 3300028380 Bacteria 2155
151 Ga0268264_10043391 3300028381 Bacteria 3727
152 Ga0265327_10001394 3300031251 Bacteria 30838
153 Ga0307513_10014621 3300031456 Bacteria 9554
154 Ga0307513_10037095 3300031456 Bacteria 5427
155 Ga0316579_10113709 3300031691 Bacteria 1299
156 Ga0265314_10118497 3300031711 Bacteria 1671
157 Ga0307410_10352076 3300031852 Bacteria 1177
158 Ga0307507_10179466 3300033179 Bacteria 1517
159 Ga0373950_0011415 3300034818 Bacteria 1451
160 Ga0373959_0043498 3300034820 Bacteria 950
161 Ga0373938_0011118 3300034957 Bacteria 1667
162 Ga0373926_0068464 3300035083 Bacteria 1301
163 Ga0373928_0002271 3300035084 Bacteria 3742
164 Ga0373940_0011522 3300035088 Bacteria 2101
165 Ga0373949_0012323 3300035090 Bacteria 1890
166 Ga0373952_0019701 3300035092 Bacteria 1408
167 Ga0373932_0016341 3300035112 Bacteria 1893
168 Ga0373939_0004080 3300035114 Bacteria 3440
169 Ga0373941_0081754 3300035115 Bacteria 1092
170 Ga0373962_0003770 3300035242 Bacteria 3647
171 Ga0373927_0152679 3300035695 Bacteria 1512
172 Ga0373927_0262430 3300035695 Bacteria 1136
173 Ga0373947_0011789 3300035725 Bacteria 5008
174 Ga0316584_0032289 3300036712 Bacteria 3875
175 Ga0316584_0087880 3300036712 Bacteria 2327
176 Ga0316584_0301965 3300036712 Bacteria 1159
177 Ga0373925_0009849 3300037068 Bacteria 6941
178 Ga0395899_0076720 3300037312 Bacteria 2439
179 Ga0395900_0038975 3300037418 Bacteria 4898
180 Ga0395898_0004795 3300037466 Bacteria 14718
181 Ga0395905_0097434 3300037471 Bacteria 2761
182 Ga0395905_0172850 3300037471 Bacteria 2029
183 Ga0395901_0001235 3300038443 Bacteria 27293
184 Ga0395901_0025340 3300038443 Bacteria 6088
185 Ga0395901_0179574 3300038443 Bacteria 2220
186 Ga0395901_0276999 3300038443 Bacteria 1744
187 Ga0436365_0268684 3300039437 Bacteria 5641
188 Ga0436365_1270537 3300039437 Bacteria 6831
189 Ga0436362_0875499 3300039453 Bacteria 10251
190 Ga0439451_031779 3300042009 Bacteria 1061
191 Ga0439440_0034153 3300042993 Bacteria 1215
192 Ga0466969_0131523 3300044656 Bacteria 1160
193 Ga0466966_0002599 3300044684 Bacteria 11837
194 Ga0466961_0002003 3300044693 Bacteria 12661
195 Ga0466961_0013715 3300044693 Bacteria 5193
196 Ga0466961_0393560 3300044693 Bacteria 841
197 Ga0466963_0074169 3300044694 Bacteria 2294
198 Ga0466971_0138911 3300044719 Bacteria 1131
199 Ga0466970_0090097 3300044765 Bacteria 1664
200 Ga0466959_0010217 3300045049 Bacteria 6703
201 Ga0466959_0044512 3300045049 Bacteria 3271
202 Ga0466959_0286335 3300045049 Bacteria 1130
203 Ga0451576_0224255 3300045051 Bacteria 1963
204 Ga0466958_0128611 3300045836 Bacteria 1589
205 Ga0466967_0000500 3300045976 Bacteria 19166
206 Ga0466967_0344909 3300045976 Bacteria 1441
207 Ga0495629_0001088 3300046459 Bacteria 21535
208 Ga0495582_0000078 3300046473 Bacteria 49080
209 Ga0495662_0145100 3300046476 Bacteria 1168
210 Ga0495630_0419043 3300046517 Bacteria 1026
211 Ga0495613_0000207 3300046689 Bacteria 58099
212 Ga0495613_0603138 3300046689 Bacteria 730
213 Ga0495676_0014628 3300047321 Bacteria 7018
214 Ga0495614_0030348 3300048089 Bacteria 2326
215 Ga0495626_0059669 3300048091 Bacteria 1740
216 Ga0496104_0372238 3300048907 Bacteria 1341
217 Ga0496104_0566237 3300048907 Bacteria 1047
218 Ga0496105_0283054 3300048908 Bacteria 1336
219 Ga0496107_0366088 3300048910 Bacteria 1072
220 Ga0496108_0130027 3300048911 Bacteria 2164
221 Ga0496110_0064795 3300048913 Bacteria 3230
222 Ga0496110_0103363 3300048913 Bacteria 2555
223 Ga0496111_0025280 3300048914 Bacteria 4190
224 Ga0496112_0083249 3300048915 Bacteria 3164
225 Ga0496112_0673609 3300048915 Bacteria 963
226 Ga0496113_0012047 3300048916 Bacteria 5800
227 Ga0496113_0102612 3300048916 Bacteria 2218
228 Ga0496113_0146791 3300048916 Bacteria 1859
229 Ga0496118_0127916 3300048921 Bacteria 1638
230 Ga0496121_0029326 3300048924 Bacteria 5092
231 Ga0496123_0168136 3300048926 Bacteria 1160
232 Ga0501034_0048784 3300049571 Bacteria 4272
233 Ga0501036_0709986 3300049572 Bacteria 831
234 Ga0501039_0186433 3300049575 Bacteria 1632
235 Ga0501040_0208707 3300049576 Bacteria 1388
236 Ga0501048_0434254 3300049582 Bacteria 940
237 Ga0501068_0142173 3300049584 Bacteria 1505
238 Ga0501069_0154260 3300049585 Bacteria 1321
239 Ga0501071_0014869 3300049587 Bacteria 5332
240 Ga0501071_0024351 3300049587 Bacteria 4233
241 Ga0501075_0347671 3300049591 Bacteria 1130
242 Ga0501076_0048722 3300049592 Bacteria 3348
243 Ga0501081_0057303 3300049743 Bacteria 2694
244 nmdc:mga05p37_116054_c1 3300050507 Bacteria 3290
245 nmdc:mga05p37_134982_c1 3300050507 Bacteria 3027
246 nmdc:mga05p37_246627_c1 3300050507 Bacteria 2144
247 nmdc:mga05p37_41188_c1 3300050507 Bacteria 5672
248 nmdc:mga05p37_44811_c1 3300050507 Bacteria 5441
249 nmdc:mga09592_37291_c1 3300050508 Bacteria 4078
250 nmdc:mga09592_92533_c1 3300050508 Bacteria 2585
251 nmdc:mga0qj67_12416_c1 3300050509 Bacteria 6417
252 nmdc:mga06r32_137015_c1 3300050510 Bacteria 2423
253 nmdc:mga06r32_152180_c1 3300050510 Bacteria 2292
254 nmdc:mga06r32_204932_c1 3300050510 Bacteria 1960
255 nmdc:mga06r32_365888_c1 3300050510 Bacteria 1426
256 nmdc:mga08y16_409869_c1 3300050511 Bacteria 1386
257 nmdc:mga0n895_5213_c1 3300050512 Bacteria 10823
258 nmdc:mga0a205_75677_c1 3300050515 Bacteria 3253
259 Ga0501084_0086759 3300054114 Bacteria 2628
260 Ga0501082_0274021 3300060353 Bacteria 1469
261 Ga0501082_0350453 3300060353 Bacteria 1287
262 Ga0501082_0404298 3300060353 Bacteria 1192

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0068464 Ga0373926_0068464_195_917 211
2 3300035725 Ga0373947_0011789 Ga0373947_0011789_2586_3308 211
3 3300037068 Ga0373925_0009849 Ga0373925_0009849_2870_3592 211
4 3300046459 Ga0495629_0001088 Ga0495629_0001088_2466_3188 211
5 3300046473 Ga0495582_0000078 Ga0495582_0000078_18603_19325 211
6 3300046476 Ga0495662_0145100 Ga0495662_0145100_124_846 211
7 3300046689 Ga0495613_0000207 Ga0495613_0000207_32066_32788 211
8 3300047321 Ga0495676_0014628 Ga0495676_0014628_780_1502 211
9 3300048089 Ga0495614_0030348 Ga0495614_0030348_793_1515 211
10 3300049592 Ga0501076_0048722 Ga0501076_0048722_2682_3338 211
11 3300035695 Ga0373927_0262430 Ga0373927_0262430_57_698 213
12 3300044765 Ga0466970_0090097 Ga0466970_0090097_220_954 213
13 3300005434 Ga0070709_10013848 Ga0070709_100138482 216
14 3300005436 Ga0070713_100058795 Ga0070713_1000587954 216
15 3300005439 Ga0070711_100046134 Ga0070711_1000461342 216
16 3300006028 Ga0070717_10034295 Ga0070717_100342952 216
17 3300006173 Ga0070716_100101423 Ga0070716_1001014232 216
18 3300006175 Ga0070712_100384425 Ga0070712_1003844252 216
19 3300025906 Ga0207699_10016907 Ga0207699_100169072 216
20 3300025915 Ga0207693_10297143 Ga0207693_102971432 216
21 3300025916 Ga0207663_10031802 Ga0207663_100318022 216
22 3300025928 Ga0207700_10027333 Ga0207700_100273332 216
23 3300025939 Ga0207665_10164033 Ga0207665_101640332 216
24 3300049743 Ga0501081_0057303 Ga0501081_0057303_1637_2362 218
25 3300060353 Ga0501082_0350453 Ga0501082_0350453_510_1235 218
26 3300044656 Ga0466969_0131523 Ga0466969_0131523_179_901 219
27 3300049582 Ga0501048_0434254 Ga0501048_0434254_259_918 219
28 3300005616 Ga0068852_100428475 Ga0068852_1004284752 220
29 3300026142 Ga0207698_10362779 Ga0207698_103627792 220
30 3300031711 Ga0265314_10118497 Ga0265314_101184972 220
31 3300050510 nmdc:mga06r32_204932_c1 nmdc:mga06r32_204932_c1_936_1661 220
32 3300036712 Ga0316584_0301965 Ga0316584_0301965_17_700 221
33 3300044684 Ga0466966_0002599 Ga0466966_0002599_5911_6633 221
34 3300044693 Ga0466961_0002003 Ga0466961_0002003_10508_11230 221
35 3300044694 Ga0466963_0074169 Ga0466963_0074169_1291_2016 221
36 3300045049 Ga0466959_0010217 Ga0466959_0010217_777_1499 221
37 3300045976 Ga0466967_0000500 Ga0466967_0000500_17605_18330 221
38 3300048924 Ga0496121_0029326 Ga0496121_0029326_3855_4577 225
39 3300005356 Ga0070674_100014090 Ga0070674_1000140903 226
40 3300005367 Ga0070667_100069162 Ga0070667_1000691622 226
41 3300005441 Ga0070700_100097795 Ga0070700_1000977952 226
42 3300005618 Ga0068864_100041976 Ga0068864_1000419763 226
43 3300005834 Ga0068851_10032371 Ga0068851_100323712 226
44 3300005841 Ga0068863_100093619 Ga0068863_1000936192 226
45 3300005842 Ga0068858_100019781 Ga0068858_1000197813 226
46 3300005937 Ga0081455_10019843 Ga0081455_100198435 226
47 3300006237 Ga0097621_100036556 Ga0097621_1000365562 226
48 3300006358 Ga0068871_100027016 Ga0068871_1000270162 226
49 3300009101 Ga0105247_10020125 Ga0105247_100201252 226
50 3300014968 Ga0157379_10020396 Ga0157379_100203963 226
51 3300017792 Ga0163161_10002916 Ga0163161_1000291610 226
52 3300025900 Ga0207710_10134651 Ga0207710_101346512 226
53 3300025918 Ga0207662_10115123 Ga0207662_101151233 226
54 3300025986 Ga0207658_10068013 Ga0207658_100680133 226
55 3300026035 Ga0207703_10452652 Ga0207703_104526522 226
56 3300026116 Ga0207674_10088467 Ga0207674_100884672 226
57 3300026121 Ga0207683_10131512 Ga0207683_101315122 226
58 3300028380 Ga0268265_10121197 Ga0268265_101211972 226
59 3300048910 Ga0496107_0366088 Ga0496107_0366088_271_993 226
60 3300048911 Ga0496108_0130027 Ga0496108_0130027_265_987 226
61 3300048915 Ga0496112_0083249 Ga0496112_0083249_1276_1998 226
62 3300048916 Ga0496113_0102612 Ga0496113_0102612_76_798 226
63 3300006844 Ga0075428_100250544 Ga0075428_1002505442 227
64 3300009147 Ga0114129_10145946 Ga0114129_101459462 227
65 3300050507 nmdc:mga05p37_44811_c1 nmdc:mga05p37_44811_c1_2450_3166 227
66 3300003373 JGI25407J50210_10069397 JGI25407J50210_100693971 228
67 3300049575 Ga0501039_0186433 Ga0501039_0186433_266_991 228
68 3300049576 Ga0501040_0208707 Ga0501040_0208707_207_932 228
69 3300049587 Ga0501071_0014869 Ga0501071_0014869_1887_2612 228
70 3300049591 Ga0501075_0347671 Ga0501075_0347671_96_821 228
71 3300060353 Ga0501082_0404298 Ga0501082_0404298_176_901 228
72 3300046689 Ga0495613_0603138 Ga0495613_0603138_18_716 232
73 3300050507 nmdc:mga05p37_246627_c1 nmdc:mga05p37_246627_c1_1030_1737 232
74 3300009147 Ga0114129_10052481 Ga0114129_100524812 233
75 3300035112 Ga0373932_0016341 Ga0373932_0016341_370_1092 233
76 3300006844 Ga0075428_100133078 Ga0075428_1001330783 234
77 3300009147 Ga0114129_10058658 Ga0114129_100586582 234
78 iso_pu_bacteria 2946033335 2946034279 236
79 3300005937 Ga0081455_10115746 Ga0081455_101157463 237
80 3300025922 Ga0207646_10553291 Ga0207646_105532912 237
81 3300021384 Ga0213876_10026137 Ga0213876_100261372 238
82 3300025912 Ga0207707_10020941 Ga0207707_100209417 238
83 3300025912 Ga0207707_10080883 Ga0207707_100808834 238
84 3300031456 Ga0307513_10037095 Ga0307513_100370952 238
85 3300039437 Ga0436365_1270537 Ga0436365_1270537_120_839 238
86 3300039453 Ga0436362_0875499 Ga0436362_0875499_5513_6232 238
87 iso_pu_bacteria 2904501621 2904501966 238
88 iso_pu_bacteria 2908674828 2908675979 238
89 iso_pu_bacteria 2909074476 2909076456 238
90 iso_pu_bacteria 2919039151 2919040215 238
91 iso_pu_bacteria 2928500415 2928501147 238
92 3300005347 Ga0070668_100000248 Ga0070668_10000024820 239
93 3300005614 Ga0068856_100099525 Ga0068856_1000995252 239
94 3300005616 Ga0068852_100044425 Ga0068852_1000444252 239
95 3300006844 Ga0075428_100002298 Ga0075428_1000022986 239
96 3300006846 Ga0075430_100016777 Ga0075430_1000167772 239
97 3300006846 Ga0075430_100042396 Ga0075430_1000423965 239
98 3300006847 Ga0075431_100059916 Ga0075431_1000599162 239
99 3300006847 Ga0075431_100082952 Ga0075431_1000829522 239
100 3300006880 Ga0075429_100069339 Ga0075429_1000693393 239
101 3300009098 Ga0105245_10119925 Ga0105245_101199252 239
102 3300009147 Ga0114129_10006716 Ga0114129_1000671614 239
103 3300009147 Ga0114129_10041638 Ga0114129_100416385 239
104 3300013105 Ga0157369_10023979 Ga0157369_100239794 239
105 3300025927 Ga0207687_10028249 Ga0207687_100282494 239
106 3300025972 Ga0207668_10022744 Ga0207668_100227444 239
107 3300026078 Ga0207702_10071271 Ga0207702_100712712 239
108 3300026142 Ga0207698_10032862 Ga0207698_100328622 239
109 3300031852 Ga0307410_10352076 Ga0307410_103520762 239
110 3300048091 Ga0495626_0059669 Ga0495626_0059669_345_1073 239
111 3300048926 Ga0496123_0168136 Ga0496123_0168136_366_1094 239
112 3300049571 Ga0501034_0048784 Ga0501034_0048784_3300_4025 239
113 3300049572 Ga0501036_0709986 Ga0501036_0709986_75_797 239
114 3300049584 Ga0501068_0142173 Ga0501068_0142173_642_1364 239
115 3300049587 Ga0501071_0024351 Ga0501071_0024351_1983_2708 239
116 3300050507 nmdc:mga05p37_41188_c1 nmdc:mga05p37_41188_c1_4871_5590 239
117 3300050508 nmdc:mga09592_37291_c1 nmdc:mga09592_37291_c1_495_1214 239
118 3300050508 nmdc:mga09592_92533_c1 nmdc:mga09592_92533_c1_568_1287 239
119 3300050509 nmdc:mga0qj67_12416_c1 nmdc:mga0qj67_12416_c1_1159_1878 239
120 3300050510 nmdc:mga06r32_137015_c1 nmdc:mga06r32_137015_c1_368_1087 239
121 3300050510 nmdc:mga06r32_365888_c1 nmdc:mga06r32_365888_c1_663_1382 239
122 3300054114 Ga0501084_0086759 Ga0501084_0086759_1128_1850 239
123 3300060353 Ga0501082_0274021 Ga0501082_0274021_579_1298 239
124 iso_pu_bacteria 2775506735 2775658666 239
125 iso_pu_bacteria 2808606357 2808829955 239
126 iso_pu_bacteria 2811994871 2812318356 239
127 iso_pu_bacteria 2945941187 2945944574 239
128 3300002075 JGI24738J21930_10022186 JGI24738J21930_100221862 240
129 3300005330 Ga0070690_100201630 Ga0070690_1002016302 240
130 3300005334 Ga0068869_100016877 Ga0068869_1000168772 240
131 3300005339 Ga0070660_100043359 Ga0070660_1000433592 240
132 3300005340 Ga0070689_100032191 Ga0070689_1000321912 240
133 3300005345 Ga0070692_10008983 Ga0070692_100089833 240
134 3300005347 Ga0070668_100003935 Ga0070668_1000039353 240
135 3300005355 Ga0070671_100024218 Ga0070671_1000242182 240
136 3300005364 Ga0070673_100004719 Ga0070673_1000047194 240
137 3300005365 Ga0070688_100061633 Ga0070688_1000616333 240
138 3300005434 Ga0070709_10105537 Ga0070709_101055373 240
139 3300005435 Ga0070714_100073314 Ga0070714_1000733142 240
140 3300005436 Ga0070713_100061059 Ga0070713_1000610593 240
141 3300005437 Ga0070710_10015358 Ga0070710_100153582 240
142 3300005455 Ga0070663_100028004 Ga0070663_1000280043 240
143 3300005457 Ga0070662_100003684 Ga0070662_1000036842 240
144 3300005459 Ga0068867_100433603 Ga0068867_1004336031 240
145 3300005530 Ga0070679_100346290 Ga0070679_1003462902 240
146 3300005536 Ga0070697_100129088 Ga0070697_1001290883 240
147 3300005545 Ga0070695_100004873 Ga0070695_1000048735 240
148 3300005548 Ga0070665_100054214 Ga0070665_1000542143 240
149 3300005563 Ga0068855_100011040 Ga0068855_1000110409 240
150 3300005615 Ga0070702_100004665 Ga0070702_1000046655 240
151 3300005616 Ga0068852_100036694 Ga0068852_1000366942 240
152 3300005618 Ga0068864_100332819 Ga0068864_1003328192 240
153 3300005719 Ga0068861_100174835 Ga0068861_1001748352 240
154 3300005841 Ga0068863_100002554 Ga0068863_10000255414 240
155 3300005842 Ga0068858_100012311 Ga0068858_1000123112 240
156 3300005843 Ga0068860_100104434 Ga0068860_1001044342 240
157 3300005844 Ga0068862_100380262 Ga0068862_1003802622 240
158 3300005937 Ga0081455_10071729 Ga0081455_100717293 240
159 3300005983 Ga0081540_1008222 Ga0081540_10082225 240
160 3300005983 Ga0081540_1106771 Ga0081540_11067712 240
161 3300006173 Ga0070716_100088676 Ga0070716_1000886762 240
162 3300006175 Ga0070712_100042819 Ga0070712_1000428192 240
163 3300006847 Ga0075431_100024079 Ga0075431_1000240798 240
164 3300006847 Ga0075431_100356786 Ga0075431_1003567862 240
165 3300006881 Ga0068865_100088987 Ga0068865_1000889872 240
166 3300009093 Ga0105240_10154764 Ga0105240_101547643 240
167 3300009094 Ga0111539_10033925 Ga0111539_100339256 240
168 3300009098 Ga0105245_10046238 Ga0105245_100462382 240
169 3300009098 Ga0105245_10112384 Ga0105245_101123843 240
170 3300009174 Ga0105241_10026403 Ga0105241_100264032 240
171 3300009174 Ga0105241_10038794 Ga0105241_100387942 240
172 3300009177 Ga0105248_10650203 Ga0105248_106502031 240
173 3300009553 Ga0105249_10182163 Ga0105249_101821632 240
174 3300010375 Ga0105239_10070395 Ga0105239_100703953 240
175 3300011119 Ga0105246_10885096 Ga0105246_108850961 240
176 3300013104 Ga0157370_10018423 Ga0157370_100184236 240
177 3300013104 Ga0157370_10024321 Ga0157370_100243213 240
178 3300013297 Ga0157378_10049163 Ga0157378_100491634 240
179 3300013307 Ga0157372_10000046 Ga0157372_1000004640 240
180 3300013308 Ga0157375_10054884 Ga0157375_100548843 240
181 3300013308 Ga0157375_10272103 Ga0157375_102721032 240
182 3300014326 Ga0157380_10068993 Ga0157380_100689931 240
183 3300014969 Ga0157376_10555281 Ga0157376_105552812 240
184 3300017792 Ga0163161_10167759 Ga0163161_101677592 240
185 3300025898 Ga0207692_10134427 Ga0207692_101344272 240
186 3300025904 Ga0207647_10085519 Ga0207647_100855192 240
187 3300025913 Ga0207695_10032266 Ga0207695_100322662 240
188 3300025914 Ga0207671_10027199 Ga0207671_100271995 240
189 3300025915 Ga0207693_10002076 Ga0207693_100020766 240
190 3300025919 Ga0207657_10008753 Ga0207657_100087537 240
191 3300025921 Ga0207652_10232964 Ga0207652_102329642 240
192 3300025924 Ga0207694_10009057 Ga0207694_100090577 240
193 3300025927 Ga0207687_10022725 Ga0207687_100227252 240
194 3300025928 Ga0207700_10075660 Ga0207700_100756602 240
195 3300025929 Ga0207664_10065355 Ga0207664_100653553 240
196 3300025931 Ga0207644_10282784 Ga0207644_102827842 240
197 3300025931 Ga0207644_10404592 Ga0207644_104045921 240
198 3300025932 Ga0207690_10006623 Ga0207690_100066232 240
199 3300025933 Ga0207706_10007216 Ga0207706_100072162 240
200 3300025934 Ga0207686_10024929 Ga0207686_100249292 240
201 3300025935 Ga0207709_10048259 Ga0207709_100482593 240
202 3300025938 Ga0207704_10046399 Ga0207704_100463992 240
203 3300025939 Ga0207665_10000414 Ga0207665_1000041412 240
204 3300025941 Ga0207711_10252890 Ga0207711_102528902 240
205 3300025942 Ga0207689_10005301 Ga0207689_100053017 240
206 3300025945 Ga0207679_10390200 Ga0207679_103902002 240
207 3300025961 Ga0207712_10003349 Ga0207712_100033497 240
208 3300025972 Ga0207668_10007126 Ga0207668_100071265 240
209 3300025986 Ga0207658_10059524 Ga0207658_100595242 240
210 3300026067 Ga0207678_10060470 Ga0207678_100604702 240
211 3300026067 Ga0207678_10163113 Ga0207678_101631132 240
212 3300026075 Ga0207708_10188489 Ga0207708_101884892 240
213 3300026088 Ga0207641_10002240 Ga0207641_1000224012 240
214 3300026089 Ga0207648_10155253 Ga0207648_101552532 240
215 3300026118 Ga0207675_100037998 Ga0207675_1000379983 240
216 3300028379 Ga0268266_10376633 Ga0268266_103766332 240
217 3300028381 Ga0268264_10043391 Ga0268264_100433912 240
218 3300031251 Ga0265327_10001394 Ga0265327_100013943 240
219 3300031456 Ga0307513_10014621 Ga0307513_100146218 240
220 3300031691 Ga0316579_10113709 Ga0316579_101137092 240
221 3300033179 Ga0307507_10179466 Ga0307507_101794661 240
222 3300034818 Ga0373950_0011415 Ga0373950_0011415_321_1043 240
223 3300034820 Ga0373959_0043498 Ga0373959_0043498_22_744 240
224 3300034957 Ga0373938_0011118 Ga0373938_0011118_238_960 240
225 3300035084 Ga0373928_0002271 Ga0373928_0002271_2151_2873 240
226 3300035088 Ga0373940_0011522 Ga0373940_0011522_499_1221 240
227 3300035090 Ga0373949_0012323 Ga0373949_0012323_70_792 240
228 3300035092 Ga0373952_0019701 Ga0373952_0019701_265_987 240
229 3300035114 Ga0373939_0004080 Ga0373939_0004080_1578_2300 240
230 3300035115 Ga0373941_0081754 Ga0373941_0081754_184_906 240
231 3300035242 Ga0373962_0003770 Ga0373962_0003770_654_1376 240
232 3300035695 Ga0373927_0152679 Ga0373927_0152679_775_1497 240
233 3300036712 Ga0316584_0032289 Ga0316584_0032289_1828_2571 240
234 3300036712 Ga0316584_0087880 Ga0316584_0087880_853_1641 240
235 3300037312 Ga0395899_0076720 Ga0395899_0076720_675_1397 240
236 3300037418 Ga0395900_0038975 Ga0395900_0038975_1607_2329 240
237 3300037466 Ga0395898_0004795 Ga0395898_0004795_976_1701 240
238 3300037471 Ga0395905_0097434 Ga0395905_0097434_1646_2368 240
239 3300037471 Ga0395905_0172850 Ga0395905_0172850_1136_1861 240
240 3300038443 Ga0395901_0001235 Ga0395901_0001235_13478_14203 240
241 3300038443 Ga0395901_0025340 Ga0395901_0025340_2598_3320 240
242 3300038443 Ga0395901_0179574 Ga0395901_0179574_566_1291 240
243 3300038443 Ga0395901_0276999 Ga0395901_0276999_960_1682 240
244 3300039437 Ga0436365_0268684 Ga0436365_0268684_1417_2139 240
245 3300042009 Ga0439451_031779 Ga0439451_031779_186_911 240
246 3300042993 Ga0439440_0034153 Ga0439440_0034153_454_1179 240
247 3300044693 Ga0466961_0013715 Ga0466961_0013715_3865_4590 240
248 3300044693 Ga0466961_0393560 Ga0466961_0393560_94_816 240
249 3300044719 Ga0466971_0138911 Ga0466971_0138911_109_831 240
250 3300045049 Ga0466959_0044512 Ga0466959_0044512_1671_2393 240
251 3300045049 Ga0466959_0286335 Ga0466959_0286335_153_878 240
252 3300045051 Ga0451576_0224255 Ga0451576_0224255_754_1476 240
253 3300045836 Ga0466958_0128611 Ga0466958_0128611_430_1155 240
254 3300045976 Ga0466967_0344909 Ga0466967_0344909_480_1202 240
255 3300046517 Ga0495630_0419043 Ga0495630_0419043_77_799 240
256 3300048907 Ga0496104_0372238 Ga0496104_0372238_539_1261 240
257 3300048907 Ga0496104_0566237 Ga0496104_0566237_127_852 240
258 3300048908 Ga0496105_0283054 Ga0496105_0283054_145_867 240
259 3300048913 Ga0496110_0064795 Ga0496110_0064795_731_1453 240
260 3300048913 Ga0496110_0103363 Ga0496110_0103363_920_1642 240
261 3300048914 Ga0496111_0025280 Ga0496111_0025280_1366_2088 240
262 3300048915 Ga0496112_0673609 Ga0496112_0673609_131_853 240
263 3300048916 Ga0496113_0012047 Ga0496113_0012047_2054_2776 240
264 3300048916 Ga0496113_0146791 Ga0496113_0146791_277_999 240
265 3300048921 Ga0496118_0127916 Ga0496118_0127916_426_1148 240
266 3300049585 Ga0501069_0154260 Ga0501069_0154260_288_1013 240
267 3300050507 nmdc:mga05p37_116054_c1 nmdc:mga05p37_116054_c1_1166_1891 240
268 3300050507 nmdc:mga05p37_134982_c1 nmdc:mga05p37_134982_c1_1578_2300 240
269 3300050510 nmdc:mga06r32_152180_c1 nmdc:mga06r32_152180_c1_1338_2063 240
270 3300050511 nmdc:mga08y16_409869_c1 nmdc:mga08y16_409869_c1_197_919 240
271 3300050512 nmdc:mga0n895_5213_c1 nmdc:mga0n895_5213_c1_8520_9242 240
272 3300050515 nmdc:mga0a205_75677_c1 nmdc:mga0a205_75677_c1_1176_1898 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

43

192

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9685 1 226
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9601 1 226
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9497 4 227
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9484 1 224
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9464 3 219
ID Description Score Start End Superfamily
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9602 1 226 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.958 2 225 3.40.50.300
af_Q2FVR1_1_221_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9526 4 222 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9519 1 226 3.40.50.300
af_P9WQK5_1_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9505 1 214 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3N4ZAL6-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9711 2 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A5C0AW49-F1-model_v4 ABC transporter ATP-binding protein 0.9708 2 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A3D6A155-F1-model_v4 deleted 0.9707 1 229
AF-A0A346PK27-F1-model_v4 ABC-type antimicrobial peptide transport system, ATPase component 0.9686 2 228 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7J0BSF2-F1-model_v4 ABC transporter ATP-binding protein 0.9672 2 226 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
87.86 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map