F378342
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 272 | 202 | 262 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10182163|Ga0105249_101821632 |
| Length | 260 |
| Sequence | MEYADVSRCIGIEGTDRGEAMGARQLSRVSKVYGRGASEVHALIDVDLSVDPGELVAVMGPSGSGKSTLLTIAGSLEEPSGGEVTVGDVPLSRLSRNERAALRRRVIGYVFQDFNLLAGLTAAENVSLPLELDGTSGKAARAAALEALDQLGLPDQADRFPDELSGGERQRVAIARAVVGQRRLLLADEPSGALDSVNGESVMRLVRASCQGGVAGVVVTHDAQLAAWADRVVFLRDGRIVDQTAEQDGPESLLEAGPAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 2 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 3 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 4 | 2904501621 | Curtobacterium sp. 1909 | Isolate | Unclassified |
| 5 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 6 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 7 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 8 | 2928500415 | Curtobacterium oceanosedimentum 1257 | Isolate | Rhizosphere |
| 9 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 10 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 125 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 129 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 130 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 131 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 132 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 133 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 134 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 136 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 137 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 139 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 140 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 141 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 142 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 143 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 151 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 152 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 153 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 154 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 155 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 156 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 157 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 158 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 159 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 160 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 161 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 162 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 173 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 181 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 182 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 183 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.32 |
| Metatranscriptomes | 0 |
| Isolates | 3.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.78 |
| Rhizosphere | 90.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10022186 | 3300002075 | Bacteria | 1314 |
| 2 | JGI25407J50210_10069397 | 3300003373 | Bacteria | 880 |
| 3 | Ga0070690_100201630 | 3300005330 | Bacteria | 1385 |
| 4 | Ga0068869_100016877 | 3300005334 | Bacteria | 4934 |
| 5 | Ga0070660_100043359 | 3300005339 | Bacteria | 3438 |
| 6 | Ga0070689_100032191 | 3300005340 | Bacteria | 3987 |
| 7 | Ga0070692_10008983 | 3300005345 | Bacteria | 4484 |
| 8 | Ga0070668_100000248 | 3300005347 | Bacteria | 35756 |
| 9 | Ga0070668_100003935 | 3300005347 | Bacteria | 10980 |
| 10 | Ga0070671_100024218 | 3300005355 | Bacteria | 4968 |
| 11 | Ga0070674_100014090 | 3300005356 | Bacteria | 4963 |
| 12 | Ga0070673_100004719 | 3300005364 | Bacteria | 8654 |
| 13 | Ga0070688_100061633 | 3300005365 | Bacteria | 2372 |
| 14 | Ga0070667_100069162 | 3300005367 | Bacteria | 3004 |
| 15 | Ga0070709_10013848 | 3300005434 | Bacteria | 4546 |
| 16 | Ga0070709_10105537 | 3300005434 | Bacteria | 1884 |
| 17 | Ga0070714_100073314 | 3300005435 | Bacteria | 2966 |
| 18 | Ga0070713_100058795 | 3300005436 | Bacteria | 3208 |
| 19 | Ga0070713_100061059 | 3300005436 | Bacteria | 3153 |
| 20 | Ga0070710_10015358 | 3300005437 | Bacteria | 3874 |
| 21 | Ga0070711_100046134 | 3300005439 | Bacteria | 2968 |
| 22 | Ga0070700_100097795 | 3300005441 | Bacteria | 1928 |
| 23 | Ga0070663_100028004 | 3300005455 | Bacteria | 3831 |
| 24 | Ga0070662_100003684 | 3300005457 | Bacteria | 9579 |
| 25 | Ga0068867_100433603 | 3300005459 | Bacteria | 1116 |
| 26 | Ga0070679_100346290 | 3300005530 | Bacteria | 1434 |
| 27 | Ga0070697_100129088 | 3300005536 | Bacteria | 2119 |
| 28 | Ga0070695_100004873 | 3300005545 | Bacteria | 7901 |
| 29 | Ga0070665_100054214 | 3300005548 | Bacteria | 4021 |
| 30 | Ga0068855_100011040 | 3300005563 | Bacteria | 10898 |
| 31 | Ga0068856_100099525 | 3300005614 | Bacteria | 2899 |
| 32 | Ga0070702_100004665 | 3300005615 | Bacteria | 6286 |
| 33 | Ga0068852_100036694 | 3300005616 | Bacteria | 4104 |
| 34 | Ga0068852_100044425 | 3300005616 | Bacteria | 3773 |
| 35 | Ga0068852_100428475 | 3300005616 | Bacteria | 1306 |
| 36 | Ga0068864_100041976 | 3300005618 | Bacteria | 3913 |
| 37 | Ga0068864_100332819 | 3300005618 | Bacteria | 1429 |
| 38 | Ga0068861_100174835 | 3300005719 | Bacteria | 1783 |
| 39 | Ga0068851_10032371 | 3300005834 | Bacteria | 2602 |
| 40 | Ga0068863_100002554 | 3300005841 | Bacteria | 18067 |
| 41 | Ga0068863_100093619 | 3300005841 | Bacteria | 2851 |
| 42 | Ga0068858_100012311 | 3300005842 | Bacteria | 8069 |
| 43 | Ga0068858_100019781 | 3300005842 | Bacteria | 6294 |
| 44 | Ga0068860_100104434 | 3300005843 | Bacteria | 2705 |
| 45 | Ga0068862_100380262 | 3300005844 | Bacteria | 1317 |
| 46 | Ga0081455_10019843 | 3300005937 | Bacteria | 6348 |
| 47 | Ga0081455_10071729 | 3300005937 | Bacteria | 2870 |
| 48 | Ga0081455_10115746 | 3300005937 | Bacteria | 2122 |
| 49 | Ga0081540_1008222 | 3300005983 | Bacteria | 7308 |
| 50 | Ga0081540_1106771 | 3300005983 | Bacteria | 1193 |
| 51 | Ga0070717_10034295 | 3300006028 | Bacteria | 4102 |
| 52 | Ga0070716_100088676 | 3300006173 | Bacteria | 1866 |
| 53 | Ga0070716_100101423 | 3300006173 | Bacteria | 1765 |
| 54 | Ga0070712_100042819 | 3300006175 | Bacteria | 3114 |
| 55 | Ga0070712_100384425 | 3300006175 | Bacteria | 1156 |
| 56 | Ga0097621_100036556 | 3300006237 | Bacteria | 3929 |
| 57 | Ga0068871_100027016 | 3300006358 | Bacteria | 4484 |
| 58 | Ga0075428_100002298 | 3300006844 | Bacteria | 20687 |
| 59 | Ga0075428_100133078 | 3300006844 | Bacteria | 2704 |
| 60 | Ga0075428_100250544 | 3300006844 | Bacteria | 1909 |
| 61 | Ga0075430_100016777 | 3300006846 | Bacteria | 6237 |
| 62 | Ga0075430_100042396 | 3300006846 | Bacteria | 3848 |
| 63 | Ga0075431_100024079 | 3300006847 | Bacteria | 6234 |
| 64 | Ga0075431_100059916 | 3300006847 | Bacteria | 3928 |
| 65 | Ga0075431_100082952 | 3300006847 | Bacteria | 3309 |
| 66 | Ga0075431_100356786 | 3300006847 | Bacteria | 1469 |
| 67 | Ga0075429_100069339 | 3300006880 | Bacteria | 3070 |
| 68 | Ga0068865_100088987 | 3300006881 | Bacteria | 2235 |
| 69 | Ga0105240_10154764 | 3300009093 | Bacteria | 2728 |
| 70 | Ga0111539_10033925 | 3300009094 | Bacteria | 6193 |
| 71 | Ga0105245_10046238 | 3300009098 | Bacteria | 3890 |
| 72 | Ga0105245_10112384 | 3300009098 | Bacteria | 2535 |
| 73 | Ga0105245_10119925 | 3300009098 | Bacteria | 2456 |
| 74 | Ga0105247_10020125 | 3300009101 | Bacteria | 4011 |
| 75 | Ga0114129_10006716 | 3300009147 | Bacteria | 16336 |
| 76 | Ga0114129_10041638 | 3300009147 | Bacteria | 6470 |
| 77 | Ga0114129_10052481 | 3300009147 | Bacteria | 5722 |
| 78 | Ga0114129_10058658 | 3300009147 | Bacteria | 5384 |
| 79 | Ga0114129_10145946 | 3300009147 | Bacteria | 3241 |
| 80 | Ga0105241_10026403 | 3300009174 | Bacteria | 4320 |
| 81 | Ga0105241_10038794 | 3300009174 | Bacteria | 3591 |
| 82 | Ga0105248_10650203 | 3300009177 | Bacteria | 1190 |
| 83 | Ga0105249_10182163 | 3300009553 | Bacteria | 2044 |
| 84 | Ga0105239_10070395 | 3300010375 | Bacteria | 3843 |
| 85 | Ga0105246_10885096 | 3300011119 | Bacteria | 799 |
| 86 | Ga0157370_10018423 | 3300013104 | Bacteria | 7021 |
| 87 | Ga0157370_10024321 | 3300013104 | Bacteria | 5999 |
| 88 | Ga0157369_10023979 | 3300013105 | Bacteria | 6788 |
| 89 | Ga0157378_10049163 | 3300013297 | Bacteria | 3752 |
| 90 | Ga0157372_10000046 | 3300013307 | Bacteria | 150498 |
| 91 | Ga0157375_10054884 | 3300013308 | Bacteria | 3926 |
| 92 | Ga0157375_10272103 | 3300013308 | Bacteria | 1856 |
| 93 | Ga0157380_10068993 | 3300014326 | Bacteria | 2851 |
| 94 | Ga0157379_10020396 | 3300014968 | Bacteria | 5858 |
| 95 | Ga0157376_10555281 | 3300014969 | Bacteria | 1137 |
| 96 | Ga0163161_10002916 | 3300017792 | Bacteria | 12111 |
| 97 | Ga0163161_10167759 | 3300017792 | Bacteria | 1677 |
| 98 | Ga0213876_10026137 | 3300021384 | Bacteria | 3079 |
| 99 | Ga0207692_10134427 | 3300025898 | Bacteria | 1400 |
| 100 | Ga0207710_10134651 | 3300025900 | Bacteria | 1189 |
| 101 | Ga0207647_10085519 | 3300025904 | Bacteria | 1886 |
| 102 | Ga0207699_10016907 | 3300025906 | Bacteria | 3826 |
| 103 | Ga0207707_10020941 | 3300025912 | Bacteria | 5713 |
| 104 | Ga0207707_10080883 | 3300025912 | Bacteria | 2837 |
| 105 | Ga0207695_10032266 | 3300025913 | Bacteria | 5733 |
| 106 | Ga0207671_10027199 | 3300025914 | Bacteria | 4277 |
| 107 | Ga0207693_10002076 | 3300025915 | Bacteria | 17507 |
| 108 | Ga0207693_10297143 | 3300025915 | Bacteria | 1265 |
| 109 | Ga0207663_10031802 | 3300025916 | Bacteria | 3126 |
| 110 | Ga0207662_10115123 | 3300025918 | Bacteria | 1680 |
| 111 | Ga0207657_10008753 | 3300025919 | Bacteria | 10245 |
| 112 | Ga0207652_10232964 | 3300025921 | Bacteria | 1660 |
| 113 | Ga0207646_10553291 | 3300025922 | Bacteria | 1034 |
| 114 | Ga0207694_10009057 | 3300025924 | Bacteria | 7513 |
| 115 | Ga0207687_10022725 | 3300025927 | Bacteria | 4176 |
| 116 | Ga0207687_10028249 | 3300025927 | Bacteria | 3768 |
| 117 | Ga0207700_10027333 | 3300025928 | Bacteria | 3993 |
| 118 | Ga0207700_10075660 | 3300025928 | Bacteria | 2610 |
| 119 | Ga0207664_10065355 | 3300025929 | Bacteria | 2912 |
| 120 | Ga0207644_10282784 | 3300025931 | Bacteria | 1332 |
| 121 | Ga0207644_10404592 | 3300025931 | Bacteria | 1116 |
| 122 | Ga0207690_10006623 | 3300025932 | Bacteria | 6862 |
| 123 | Ga0207706_10007216 | 3300025933 | Bacteria | 10277 |
| 124 | Ga0207686_10024929 | 3300025934 | Bacteria | 3472 |
| 125 | Ga0207709_10048259 | 3300025935 | Bacteria | 2593 |
| 126 | Ga0207704_10046399 | 3300025938 | Bacteria | 2589 |
| 127 | Ga0207665_10000414 | 3300025939 | Bacteria | 29429 |
| 128 | Ga0207665_10164033 | 3300025939 | Bacteria | 1600 |
| 129 | Ga0207711_10252890 | 3300025941 | Bacteria | 1618 |
| 130 | Ga0207689_10005301 | 3300025942 | Bacteria | 11551 |
| 131 | Ga0207679_10390200 | 3300025945 | Bacteria | 1222 |
| 132 | Ga0207712_10003349 | 3300025961 | Bacteria | 10149 |
| 133 | Ga0207668_10007126 | 3300025972 | Bacteria | 6636 |
| 134 | Ga0207668_10022744 | 3300025972 | Bacteria | 4018 |
| 135 | Ga0207658_10059524 | 3300025986 | Bacteria | 2847 |
| 136 | Ga0207658_10068013 | 3300025986 | Bacteria | 2686 |
| 137 | Ga0207703_10452652 | 3300026035 | Bacteria | 1199 |
| 138 | Ga0207678_10060470 | 3300026067 | Bacteria | 3259 |
| 139 | Ga0207678_10163113 | 3300026067 | Bacteria | 1903 |
| 140 | Ga0207708_10188489 | 3300026075 | Bacteria | 1641 |
| 141 | Ga0207702_10071271 | 3300026078 | Bacteria | 2992 |
| 142 | Ga0207641_10002240 | 3300026088 | Bacteria | 18067 |
| 143 | Ga0207648_10155253 | 3300026089 | Bacteria | 2020 |
| 144 | Ga0207674_10088467 | 3300026116 | Bacteria | 3090 |
| 145 | Ga0207675_100037998 | 3300026118 | Bacteria | 4492 |
| 146 | Ga0207683_10131512 | 3300026121 | Bacteria | 2251 |
| 147 | Ga0207698_10032862 | 3300026142 | Bacteria | 3764 |
| 148 | Ga0207698_10362779 | 3300026142 | Bacteria | 1373 |
| 149 | Ga0268266_10376633 | 3300028379 | Bacteria | 1338 |
| 150 | Ga0268265_10121197 | 3300028380 | Bacteria | 2155 |
| 151 | Ga0268264_10043391 | 3300028381 | Bacteria | 3727 |
| 152 | Ga0265327_10001394 | 3300031251 | Bacteria | 30838 |
| 153 | Ga0307513_10014621 | 3300031456 | Bacteria | 9554 |
| 154 | Ga0307513_10037095 | 3300031456 | Bacteria | 5427 |
| 155 | Ga0316579_10113709 | 3300031691 | Bacteria | 1299 |
| 156 | Ga0265314_10118497 | 3300031711 | Bacteria | 1671 |
| 157 | Ga0307410_10352076 | 3300031852 | Bacteria | 1177 |
| 158 | Ga0307507_10179466 | 3300033179 | Bacteria | 1517 |
| 159 | Ga0373950_0011415 | 3300034818 | Bacteria | 1451 |
| 160 | Ga0373959_0043498 | 3300034820 | Bacteria | 950 |
| 161 | Ga0373938_0011118 | 3300034957 | Bacteria | 1667 |
| 162 | Ga0373926_0068464 | 3300035083 | Bacteria | 1301 |
| 163 | Ga0373928_0002271 | 3300035084 | Bacteria | 3742 |
| 164 | Ga0373940_0011522 | 3300035088 | Bacteria | 2101 |
| 165 | Ga0373949_0012323 | 3300035090 | Bacteria | 1890 |
| 166 | Ga0373952_0019701 | 3300035092 | Bacteria | 1408 |
| 167 | Ga0373932_0016341 | 3300035112 | Bacteria | 1893 |
| 168 | Ga0373939_0004080 | 3300035114 | Bacteria | 3440 |
| 169 | Ga0373941_0081754 | 3300035115 | Bacteria | 1092 |
| 170 | Ga0373962_0003770 | 3300035242 | Bacteria | 3647 |
| 171 | Ga0373927_0152679 | 3300035695 | Bacteria | 1512 |
| 172 | Ga0373927_0262430 | 3300035695 | Bacteria | 1136 |
| 173 | Ga0373947_0011789 | 3300035725 | Bacteria | 5008 |
| 174 | Ga0316584_0032289 | 3300036712 | Bacteria | 3875 |
| 175 | Ga0316584_0087880 | 3300036712 | Bacteria | 2327 |
| 176 | Ga0316584_0301965 | 3300036712 | Bacteria | 1159 |
| 177 | Ga0373925_0009849 | 3300037068 | Bacteria | 6941 |
| 178 | Ga0395899_0076720 | 3300037312 | Bacteria | 2439 |
| 179 | Ga0395900_0038975 | 3300037418 | Bacteria | 4898 |
| 180 | Ga0395898_0004795 | 3300037466 | Bacteria | 14718 |
| 181 | Ga0395905_0097434 | 3300037471 | Bacteria | 2761 |
| 182 | Ga0395905_0172850 | 3300037471 | Bacteria | 2029 |
| 183 | Ga0395901_0001235 | 3300038443 | Bacteria | 27293 |
| 184 | Ga0395901_0025340 | 3300038443 | Bacteria | 6088 |
| 185 | Ga0395901_0179574 | 3300038443 | Bacteria | 2220 |
| 186 | Ga0395901_0276999 | 3300038443 | Bacteria | 1744 |
| 187 | Ga0436365_0268684 | 3300039437 | Bacteria | 5641 |
| 188 | Ga0436365_1270537 | 3300039437 | Bacteria | 6831 |
| 189 | Ga0436362_0875499 | 3300039453 | Bacteria | 10251 |
| 190 | Ga0439451_031779 | 3300042009 | Bacteria | 1061 |
| 191 | Ga0439440_0034153 | 3300042993 | Bacteria | 1215 |
| 192 | Ga0466969_0131523 | 3300044656 | Bacteria | 1160 |
| 193 | Ga0466966_0002599 | 3300044684 | Bacteria | 11837 |
| 194 | Ga0466961_0002003 | 3300044693 | Bacteria | 12661 |
| 195 | Ga0466961_0013715 | 3300044693 | Bacteria | 5193 |
| 196 | Ga0466961_0393560 | 3300044693 | Bacteria | 841 |
| 197 | Ga0466963_0074169 | 3300044694 | Bacteria | 2294 |
| 198 | Ga0466971_0138911 | 3300044719 | Bacteria | 1131 |
| 199 | Ga0466970_0090097 | 3300044765 | Bacteria | 1664 |
| 200 | Ga0466959_0010217 | 3300045049 | Bacteria | 6703 |
| 201 | Ga0466959_0044512 | 3300045049 | Bacteria | 3271 |
| 202 | Ga0466959_0286335 | 3300045049 | Bacteria | 1130 |
| 203 | Ga0451576_0224255 | 3300045051 | Bacteria | 1963 |
| 204 | Ga0466958_0128611 | 3300045836 | Bacteria | 1589 |
| 205 | Ga0466967_0000500 | 3300045976 | Bacteria | 19166 |
| 206 | Ga0466967_0344909 | 3300045976 | Bacteria | 1441 |
| 207 | Ga0495629_0001088 | 3300046459 | Bacteria | 21535 |
| 208 | Ga0495582_0000078 | 3300046473 | Bacteria | 49080 |
| 209 | Ga0495662_0145100 | 3300046476 | Bacteria | 1168 |
| 210 | Ga0495630_0419043 | 3300046517 | Bacteria | 1026 |
| 211 | Ga0495613_0000207 | 3300046689 | Bacteria | 58099 |
| 212 | Ga0495613_0603138 | 3300046689 | Bacteria | 730 |
| 213 | Ga0495676_0014628 | 3300047321 | Bacteria | 7018 |
| 214 | Ga0495614_0030348 | 3300048089 | Bacteria | 2326 |
| 215 | Ga0495626_0059669 | 3300048091 | Bacteria | 1740 |
| 216 | Ga0496104_0372238 | 3300048907 | Bacteria | 1341 |
| 217 | Ga0496104_0566237 | 3300048907 | Bacteria | 1047 |
| 218 | Ga0496105_0283054 | 3300048908 | Bacteria | 1336 |
| 219 | Ga0496107_0366088 | 3300048910 | Bacteria | 1072 |
| 220 | Ga0496108_0130027 | 3300048911 | Bacteria | 2164 |
| 221 | Ga0496110_0064795 | 3300048913 | Bacteria | 3230 |
| 222 | Ga0496110_0103363 | 3300048913 | Bacteria | 2555 |
| 223 | Ga0496111_0025280 | 3300048914 | Bacteria | 4190 |
| 224 | Ga0496112_0083249 | 3300048915 | Bacteria | 3164 |
| 225 | Ga0496112_0673609 | 3300048915 | Bacteria | 963 |
| 226 | Ga0496113_0012047 | 3300048916 | Bacteria | 5800 |
| 227 | Ga0496113_0102612 | 3300048916 | Bacteria | 2218 |
| 228 | Ga0496113_0146791 | 3300048916 | Bacteria | 1859 |
| 229 | Ga0496118_0127916 | 3300048921 | Bacteria | 1638 |
| 230 | Ga0496121_0029326 | 3300048924 | Bacteria | 5092 |
| 231 | Ga0496123_0168136 | 3300048926 | Bacteria | 1160 |
| 232 | Ga0501034_0048784 | 3300049571 | Bacteria | 4272 |
| 233 | Ga0501036_0709986 | 3300049572 | Bacteria | 831 |
| 234 | Ga0501039_0186433 | 3300049575 | Bacteria | 1632 |
| 235 | Ga0501040_0208707 | 3300049576 | Bacteria | 1388 |
| 236 | Ga0501048_0434254 | 3300049582 | Bacteria | 940 |
| 237 | Ga0501068_0142173 | 3300049584 | Bacteria | 1505 |
| 238 | Ga0501069_0154260 | 3300049585 | Bacteria | 1321 |
| 239 | Ga0501071_0014869 | 3300049587 | Bacteria | 5332 |
| 240 | Ga0501071_0024351 | 3300049587 | Bacteria | 4233 |
| 241 | Ga0501075_0347671 | 3300049591 | Bacteria | 1130 |
| 242 | Ga0501076_0048722 | 3300049592 | Bacteria | 3348 |
| 243 | Ga0501081_0057303 | 3300049743 | Bacteria | 2694 |
| 244 | nmdc:mga05p37_116054_c1 | 3300050507 | Bacteria | 3290 |
| 245 | nmdc:mga05p37_134982_c1 | 3300050507 | Bacteria | 3027 |
| 246 | nmdc:mga05p37_246627_c1 | 3300050507 | Bacteria | 2144 |
| 247 | nmdc:mga05p37_41188_c1 | 3300050507 | Bacteria | 5672 |
| 248 | nmdc:mga05p37_44811_c1 | 3300050507 | Bacteria | 5441 |
| 249 | nmdc:mga09592_37291_c1 | 3300050508 | Bacteria | 4078 |
| 250 | nmdc:mga09592_92533_c1 | 3300050508 | Bacteria | 2585 |
| 251 | nmdc:mga0qj67_12416_c1 | 3300050509 | Bacteria | 6417 |
| 252 | nmdc:mga06r32_137015_c1 | 3300050510 | Bacteria | 2423 |
| 253 | nmdc:mga06r32_152180_c1 | 3300050510 | Bacteria | 2292 |
| 254 | nmdc:mga06r32_204932_c1 | 3300050510 | Bacteria | 1960 |
| 255 | nmdc:mga06r32_365888_c1 | 3300050510 | Bacteria | 1426 |
| 256 | nmdc:mga08y16_409869_c1 | 3300050511 | Bacteria | 1386 |
| 257 | nmdc:mga0n895_5213_c1 | 3300050512 | Bacteria | 10823 |
| 258 | nmdc:mga0a205_75677_c1 | 3300050515 | Bacteria | 3253 |
| 259 | Ga0501084_0086759 | 3300054114 | Bacteria | 2628 |
| 260 | Ga0501082_0274021 | 3300060353 | Bacteria | 1469 |
| 261 | Ga0501082_0350453 | 3300060353 | Bacteria | 1287 |
| 262 | Ga0501082_0404298 | 3300060353 | Bacteria | 1192 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035083 | Ga0373926_0068464 | Ga0373926_0068464_195_917 | 211 |
| 2 | 3300035725 | Ga0373947_0011789 | Ga0373947_0011789_2586_3308 | 211 |
| 3 | 3300037068 | Ga0373925_0009849 | Ga0373925_0009849_2870_3592 | 211 |
| 4 | 3300046459 | Ga0495629_0001088 | Ga0495629_0001088_2466_3188 | 211 |
| 5 | 3300046473 | Ga0495582_0000078 | Ga0495582_0000078_18603_19325 | 211 |
| 6 | 3300046476 | Ga0495662_0145100 | Ga0495662_0145100_124_846 | 211 |
| 7 | 3300046689 | Ga0495613_0000207 | Ga0495613_0000207_32066_32788 | 211 |
| 8 | 3300047321 | Ga0495676_0014628 | Ga0495676_0014628_780_1502 | 211 |
| 9 | 3300048089 | Ga0495614_0030348 | Ga0495614_0030348_793_1515 | 211 |
| 10 | 3300049592 | Ga0501076_0048722 | Ga0501076_0048722_2682_3338 | 211 |
| 11 | 3300035695 | Ga0373927_0262430 | Ga0373927_0262430_57_698 | 213 |
| 12 | 3300044765 | Ga0466970_0090097 | Ga0466970_0090097_220_954 | 213 |
| 13 | 3300005434 | Ga0070709_10013848 | Ga0070709_100138482 | 216 |
| 14 | 3300005436 | Ga0070713_100058795 | Ga0070713_1000587954 | 216 |
| 15 | 3300005439 | Ga0070711_100046134 | Ga0070711_1000461342 | 216 |
| 16 | 3300006028 | Ga0070717_10034295 | Ga0070717_100342952 | 216 |
| 17 | 3300006173 | Ga0070716_100101423 | Ga0070716_1001014232 | 216 |
| 18 | 3300006175 | Ga0070712_100384425 | Ga0070712_1003844252 | 216 |
| 19 | 3300025906 | Ga0207699_10016907 | Ga0207699_100169072 | 216 |
| 20 | 3300025915 | Ga0207693_10297143 | Ga0207693_102971432 | 216 |
| 21 | 3300025916 | Ga0207663_10031802 | Ga0207663_100318022 | 216 |
| 22 | 3300025928 | Ga0207700_10027333 | Ga0207700_100273332 | 216 |
| 23 | 3300025939 | Ga0207665_10164033 | Ga0207665_101640332 | 216 |
| 24 | 3300049743 | Ga0501081_0057303 | Ga0501081_0057303_1637_2362 | 218 |
| 25 | 3300060353 | Ga0501082_0350453 | Ga0501082_0350453_510_1235 | 218 |
| 26 | 3300044656 | Ga0466969_0131523 | Ga0466969_0131523_179_901 | 219 |
| 27 | 3300049582 | Ga0501048_0434254 | Ga0501048_0434254_259_918 | 219 |
| 28 | 3300005616 | Ga0068852_100428475 | Ga0068852_1004284752 | 220 |
| 29 | 3300026142 | Ga0207698_10362779 | Ga0207698_103627792 | 220 |
| 30 | 3300031711 | Ga0265314_10118497 | Ga0265314_101184972 | 220 |
| 31 | 3300050510 | nmdc:mga06r32_204932_c1 | nmdc:mga06r32_204932_c1_936_1661 | 220 |
| 32 | 3300036712 | Ga0316584_0301965 | Ga0316584_0301965_17_700 | 221 |
| 33 | 3300044684 | Ga0466966_0002599 | Ga0466966_0002599_5911_6633 | 221 |
| 34 | 3300044693 | Ga0466961_0002003 | Ga0466961_0002003_10508_11230 | 221 |
| 35 | 3300044694 | Ga0466963_0074169 | Ga0466963_0074169_1291_2016 | 221 |
| 36 | 3300045049 | Ga0466959_0010217 | Ga0466959_0010217_777_1499 | 221 |
| 37 | 3300045976 | Ga0466967_0000500 | Ga0466967_0000500_17605_18330 | 221 |
| 38 | 3300048924 | Ga0496121_0029326 | Ga0496121_0029326_3855_4577 | 225 |
| 39 | 3300005356 | Ga0070674_100014090 | Ga0070674_1000140903 | 226 |
| 40 | 3300005367 | Ga0070667_100069162 | Ga0070667_1000691622 | 226 |
| 41 | 3300005441 | Ga0070700_100097795 | Ga0070700_1000977952 | 226 |
| 42 | 3300005618 | Ga0068864_100041976 | Ga0068864_1000419763 | 226 |
| 43 | 3300005834 | Ga0068851_10032371 | Ga0068851_100323712 | 226 |
| 44 | 3300005841 | Ga0068863_100093619 | Ga0068863_1000936192 | 226 |
| 45 | 3300005842 | Ga0068858_100019781 | Ga0068858_1000197813 | 226 |
| 46 | 3300005937 | Ga0081455_10019843 | Ga0081455_100198435 | 226 |
| 47 | 3300006237 | Ga0097621_100036556 | Ga0097621_1000365562 | 226 |
| 48 | 3300006358 | Ga0068871_100027016 | Ga0068871_1000270162 | 226 |
| 49 | 3300009101 | Ga0105247_10020125 | Ga0105247_100201252 | 226 |
| 50 | 3300014968 | Ga0157379_10020396 | Ga0157379_100203963 | 226 |
| 51 | 3300017792 | Ga0163161_10002916 | Ga0163161_1000291610 | 226 |
| 52 | 3300025900 | Ga0207710_10134651 | Ga0207710_101346512 | 226 |
| 53 | 3300025918 | Ga0207662_10115123 | Ga0207662_101151233 | 226 |
| 54 | 3300025986 | Ga0207658_10068013 | Ga0207658_100680133 | 226 |
| 55 | 3300026035 | Ga0207703_10452652 | Ga0207703_104526522 | 226 |
| 56 | 3300026116 | Ga0207674_10088467 | Ga0207674_100884672 | 226 |
| 57 | 3300026121 | Ga0207683_10131512 | Ga0207683_101315122 | 226 |
| 58 | 3300028380 | Ga0268265_10121197 | Ga0268265_101211972 | 226 |
| 59 | 3300048910 | Ga0496107_0366088 | Ga0496107_0366088_271_993 | 226 |
| 60 | 3300048911 | Ga0496108_0130027 | Ga0496108_0130027_265_987 | 226 |
| 61 | 3300048915 | Ga0496112_0083249 | Ga0496112_0083249_1276_1998 | 226 |
| 62 | 3300048916 | Ga0496113_0102612 | Ga0496113_0102612_76_798 | 226 |
| 63 | 3300006844 | Ga0075428_100250544 | Ga0075428_1002505442 | 227 |
| 64 | 3300009147 | Ga0114129_10145946 | Ga0114129_101459462 | 227 |
| 65 | 3300050507 | nmdc:mga05p37_44811_c1 | nmdc:mga05p37_44811_c1_2450_3166 | 227 |
| 66 | 3300003373 | JGI25407J50210_10069397 | JGI25407J50210_100693971 | 228 |
| 67 | 3300049575 | Ga0501039_0186433 | Ga0501039_0186433_266_991 | 228 |
| 68 | 3300049576 | Ga0501040_0208707 | Ga0501040_0208707_207_932 | 228 |
| 69 | 3300049587 | Ga0501071_0014869 | Ga0501071_0014869_1887_2612 | 228 |
| 70 | 3300049591 | Ga0501075_0347671 | Ga0501075_0347671_96_821 | 228 |
| 71 | 3300060353 | Ga0501082_0404298 | Ga0501082_0404298_176_901 | 228 |
| 72 | 3300046689 | Ga0495613_0603138 | Ga0495613_0603138_18_716 | 232 |
| 73 | 3300050507 | nmdc:mga05p37_246627_c1 | nmdc:mga05p37_246627_c1_1030_1737 | 232 |
| 74 | 3300009147 | Ga0114129_10052481 | Ga0114129_100524812 | 233 |
| 75 | 3300035112 | Ga0373932_0016341 | Ga0373932_0016341_370_1092 | 233 |
| 76 | 3300006844 | Ga0075428_100133078 | Ga0075428_1001330783 | 234 |
| 77 | 3300009147 | Ga0114129_10058658 | Ga0114129_100586582 | 234 |
| 78 | iso_pu_bacteria | 2946033335 | 2946034279 | 236 |
| 79 | 3300005937 | Ga0081455_10115746 | Ga0081455_101157463 | 237 |
| 80 | 3300025922 | Ga0207646_10553291 | Ga0207646_105532912 | 237 |
| 81 | 3300021384 | Ga0213876_10026137 | Ga0213876_100261372 | 238 |
| 82 | 3300025912 | Ga0207707_10020941 | Ga0207707_100209417 | 238 |
| 83 | 3300025912 | Ga0207707_10080883 | Ga0207707_100808834 | 238 |
| 84 | 3300031456 | Ga0307513_10037095 | Ga0307513_100370952 | 238 |
| 85 | 3300039437 | Ga0436365_1270537 | Ga0436365_1270537_120_839 | 238 |
| 86 | 3300039453 | Ga0436362_0875499 | Ga0436362_0875499_5513_6232 | 238 |
| 87 | iso_pu_bacteria | 2904501621 | 2904501966 | 238 |
| 88 | iso_pu_bacteria | 2908674828 | 2908675979 | 238 |
| 89 | iso_pu_bacteria | 2909074476 | 2909076456 | 238 |
| 90 | iso_pu_bacteria | 2919039151 | 2919040215 | 238 |
| 91 | iso_pu_bacteria | 2928500415 | 2928501147 | 238 |
| 92 | 3300005347 | Ga0070668_100000248 | Ga0070668_10000024820 | 239 |
| 93 | 3300005614 | Ga0068856_100099525 | Ga0068856_1000995252 | 239 |
| 94 | 3300005616 | Ga0068852_100044425 | Ga0068852_1000444252 | 239 |
| 95 | 3300006844 | Ga0075428_100002298 | Ga0075428_1000022986 | 239 |
| 96 | 3300006846 | Ga0075430_100016777 | Ga0075430_1000167772 | 239 |
| 97 | 3300006846 | Ga0075430_100042396 | Ga0075430_1000423965 | 239 |
| 98 | 3300006847 | Ga0075431_100059916 | Ga0075431_1000599162 | 239 |
| 99 | 3300006847 | Ga0075431_100082952 | Ga0075431_1000829522 | 239 |
| 100 | 3300006880 | Ga0075429_100069339 | Ga0075429_1000693393 | 239 |
| 101 | 3300009098 | Ga0105245_10119925 | Ga0105245_101199252 | 239 |
| 102 | 3300009147 | Ga0114129_10006716 | Ga0114129_1000671614 | 239 |
| 103 | 3300009147 | Ga0114129_10041638 | Ga0114129_100416385 | 239 |
| 104 | 3300013105 | Ga0157369_10023979 | Ga0157369_100239794 | 239 |
| 105 | 3300025927 | Ga0207687_10028249 | Ga0207687_100282494 | 239 |
| 106 | 3300025972 | Ga0207668_10022744 | Ga0207668_100227444 | 239 |
| 107 | 3300026078 | Ga0207702_10071271 | Ga0207702_100712712 | 239 |
| 108 | 3300026142 | Ga0207698_10032862 | Ga0207698_100328622 | 239 |
| 109 | 3300031852 | Ga0307410_10352076 | Ga0307410_103520762 | 239 |
| 110 | 3300048091 | Ga0495626_0059669 | Ga0495626_0059669_345_1073 | 239 |
| 111 | 3300048926 | Ga0496123_0168136 | Ga0496123_0168136_366_1094 | 239 |
| 112 | 3300049571 | Ga0501034_0048784 | Ga0501034_0048784_3300_4025 | 239 |
| 113 | 3300049572 | Ga0501036_0709986 | Ga0501036_0709986_75_797 | 239 |
| 114 | 3300049584 | Ga0501068_0142173 | Ga0501068_0142173_642_1364 | 239 |
| 115 | 3300049587 | Ga0501071_0024351 | Ga0501071_0024351_1983_2708 | 239 |
| 116 | 3300050507 | nmdc:mga05p37_41188_c1 | nmdc:mga05p37_41188_c1_4871_5590 | 239 |
| 117 | 3300050508 | nmdc:mga09592_37291_c1 | nmdc:mga09592_37291_c1_495_1214 | 239 |
| 118 | 3300050508 | nmdc:mga09592_92533_c1 | nmdc:mga09592_92533_c1_568_1287 | 239 |
| 119 | 3300050509 | nmdc:mga0qj67_12416_c1 | nmdc:mga0qj67_12416_c1_1159_1878 | 239 |
| 120 | 3300050510 | nmdc:mga06r32_137015_c1 | nmdc:mga06r32_137015_c1_368_1087 | 239 |
| 121 | 3300050510 | nmdc:mga06r32_365888_c1 | nmdc:mga06r32_365888_c1_663_1382 | 239 |
| 122 | 3300054114 | Ga0501084_0086759 | Ga0501084_0086759_1128_1850 | 239 |
| 123 | 3300060353 | Ga0501082_0274021 | Ga0501082_0274021_579_1298 | 239 |
| 124 | iso_pu_bacteria | 2775506735 | 2775658666 | 239 |
| 125 | iso_pu_bacteria | 2808606357 | 2808829955 | 239 |
| 126 | iso_pu_bacteria | 2811994871 | 2812318356 | 239 |
| 127 | iso_pu_bacteria | 2945941187 | 2945944574 | 239 |
| 128 | 3300002075 | JGI24738J21930_10022186 | JGI24738J21930_100221862 | 240 |
| 129 | 3300005330 | Ga0070690_100201630 | Ga0070690_1002016302 | 240 |
| 130 | 3300005334 | Ga0068869_100016877 | Ga0068869_1000168772 | 240 |
| 131 | 3300005339 | Ga0070660_100043359 | Ga0070660_1000433592 | 240 |
| 132 | 3300005340 | Ga0070689_100032191 | Ga0070689_1000321912 | 240 |
| 133 | 3300005345 | Ga0070692_10008983 | Ga0070692_100089833 | 240 |
| 134 | 3300005347 | Ga0070668_100003935 | Ga0070668_1000039353 | 240 |
| 135 | 3300005355 | Ga0070671_100024218 | Ga0070671_1000242182 | 240 |
| 136 | 3300005364 | Ga0070673_100004719 | Ga0070673_1000047194 | 240 |
| 137 | 3300005365 | Ga0070688_100061633 | Ga0070688_1000616333 | 240 |
| 138 | 3300005434 | Ga0070709_10105537 | Ga0070709_101055373 | 240 |
| 139 | 3300005435 | Ga0070714_100073314 | Ga0070714_1000733142 | 240 |
| 140 | 3300005436 | Ga0070713_100061059 | Ga0070713_1000610593 | 240 |
| 141 | 3300005437 | Ga0070710_10015358 | Ga0070710_100153582 | 240 |
| 142 | 3300005455 | Ga0070663_100028004 | Ga0070663_1000280043 | 240 |
| 143 | 3300005457 | Ga0070662_100003684 | Ga0070662_1000036842 | 240 |
| 144 | 3300005459 | Ga0068867_100433603 | Ga0068867_1004336031 | 240 |
| 145 | 3300005530 | Ga0070679_100346290 | Ga0070679_1003462902 | 240 |
| 146 | 3300005536 | Ga0070697_100129088 | Ga0070697_1001290883 | 240 |
| 147 | 3300005545 | Ga0070695_100004873 | Ga0070695_1000048735 | 240 |
| 148 | 3300005548 | Ga0070665_100054214 | Ga0070665_1000542143 | 240 |
| 149 | 3300005563 | Ga0068855_100011040 | Ga0068855_1000110409 | 240 |
| 150 | 3300005615 | Ga0070702_100004665 | Ga0070702_1000046655 | 240 |
| 151 | 3300005616 | Ga0068852_100036694 | Ga0068852_1000366942 | 240 |
| 152 | 3300005618 | Ga0068864_100332819 | Ga0068864_1003328192 | 240 |
| 153 | 3300005719 | Ga0068861_100174835 | Ga0068861_1001748352 | 240 |
| 154 | 3300005841 | Ga0068863_100002554 | Ga0068863_10000255414 | 240 |
| 155 | 3300005842 | Ga0068858_100012311 | Ga0068858_1000123112 | 240 |
| 156 | 3300005843 | Ga0068860_100104434 | Ga0068860_1001044342 | 240 |
| 157 | 3300005844 | Ga0068862_100380262 | Ga0068862_1003802622 | 240 |
| 158 | 3300005937 | Ga0081455_10071729 | Ga0081455_100717293 | 240 |
| 159 | 3300005983 | Ga0081540_1008222 | Ga0081540_10082225 | 240 |
| 160 | 3300005983 | Ga0081540_1106771 | Ga0081540_11067712 | 240 |
| 161 | 3300006173 | Ga0070716_100088676 | Ga0070716_1000886762 | 240 |
| 162 | 3300006175 | Ga0070712_100042819 | Ga0070712_1000428192 | 240 |
| 163 | 3300006847 | Ga0075431_100024079 | Ga0075431_1000240798 | 240 |
| 164 | 3300006847 | Ga0075431_100356786 | Ga0075431_1003567862 | 240 |
| 165 | 3300006881 | Ga0068865_100088987 | Ga0068865_1000889872 | 240 |
| 166 | 3300009093 | Ga0105240_10154764 | Ga0105240_101547643 | 240 |
| 167 | 3300009094 | Ga0111539_10033925 | Ga0111539_100339256 | 240 |
| 168 | 3300009098 | Ga0105245_10046238 | Ga0105245_100462382 | 240 |
| 169 | 3300009098 | Ga0105245_10112384 | Ga0105245_101123843 | 240 |
| 170 | 3300009174 | Ga0105241_10026403 | Ga0105241_100264032 | 240 |
| 171 | 3300009174 | Ga0105241_10038794 | Ga0105241_100387942 | 240 |
| 172 | 3300009177 | Ga0105248_10650203 | Ga0105248_106502031 | 240 |
| 173 | 3300009553 | Ga0105249_10182163 | Ga0105249_101821632 | 240 |
| 174 | 3300010375 | Ga0105239_10070395 | Ga0105239_100703953 | 240 |
| 175 | 3300011119 | Ga0105246_10885096 | Ga0105246_108850961 | 240 |
| 176 | 3300013104 | Ga0157370_10018423 | Ga0157370_100184236 | 240 |
| 177 | 3300013104 | Ga0157370_10024321 | Ga0157370_100243213 | 240 |
| 178 | 3300013297 | Ga0157378_10049163 | Ga0157378_100491634 | 240 |
| 179 | 3300013307 | Ga0157372_10000046 | Ga0157372_1000004640 | 240 |
| 180 | 3300013308 | Ga0157375_10054884 | Ga0157375_100548843 | 240 |
| 181 | 3300013308 | Ga0157375_10272103 | Ga0157375_102721032 | 240 |
| 182 | 3300014326 | Ga0157380_10068993 | Ga0157380_100689931 | 240 |
| 183 | 3300014969 | Ga0157376_10555281 | Ga0157376_105552812 | 240 |
| 184 | 3300017792 | Ga0163161_10167759 | Ga0163161_101677592 | 240 |
| 185 | 3300025898 | Ga0207692_10134427 | Ga0207692_101344272 | 240 |
| 186 | 3300025904 | Ga0207647_10085519 | Ga0207647_100855192 | 240 |
| 187 | 3300025913 | Ga0207695_10032266 | Ga0207695_100322662 | 240 |
| 188 | 3300025914 | Ga0207671_10027199 | Ga0207671_100271995 | 240 |
| 189 | 3300025915 | Ga0207693_10002076 | Ga0207693_100020766 | 240 |
| 190 | 3300025919 | Ga0207657_10008753 | Ga0207657_100087537 | 240 |
| 191 | 3300025921 | Ga0207652_10232964 | Ga0207652_102329642 | 240 |
| 192 | 3300025924 | Ga0207694_10009057 | Ga0207694_100090577 | 240 |
| 193 | 3300025927 | Ga0207687_10022725 | Ga0207687_100227252 | 240 |
| 194 | 3300025928 | Ga0207700_10075660 | Ga0207700_100756602 | 240 |
| 195 | 3300025929 | Ga0207664_10065355 | Ga0207664_100653553 | 240 |
| 196 | 3300025931 | Ga0207644_10282784 | Ga0207644_102827842 | 240 |
| 197 | 3300025931 | Ga0207644_10404592 | Ga0207644_104045921 | 240 |
| 198 | 3300025932 | Ga0207690_10006623 | Ga0207690_100066232 | 240 |
| 199 | 3300025933 | Ga0207706_10007216 | Ga0207706_100072162 | 240 |
| 200 | 3300025934 | Ga0207686_10024929 | Ga0207686_100249292 | 240 |
| 201 | 3300025935 | Ga0207709_10048259 | Ga0207709_100482593 | 240 |
| 202 | 3300025938 | Ga0207704_10046399 | Ga0207704_100463992 | 240 |
| 203 | 3300025939 | Ga0207665_10000414 | Ga0207665_1000041412 | 240 |
| 204 | 3300025941 | Ga0207711_10252890 | Ga0207711_102528902 | 240 |
| 205 | 3300025942 | Ga0207689_10005301 | Ga0207689_100053017 | 240 |
| 206 | 3300025945 | Ga0207679_10390200 | Ga0207679_103902002 | 240 |
| 207 | 3300025961 | Ga0207712_10003349 | Ga0207712_100033497 | 240 |
| 208 | 3300025972 | Ga0207668_10007126 | Ga0207668_100071265 | 240 |
| 209 | 3300025986 | Ga0207658_10059524 | Ga0207658_100595242 | 240 |
| 210 | 3300026067 | Ga0207678_10060470 | Ga0207678_100604702 | 240 |
| 211 | 3300026067 | Ga0207678_10163113 | Ga0207678_101631132 | 240 |
| 212 | 3300026075 | Ga0207708_10188489 | Ga0207708_101884892 | 240 |
| 213 | 3300026088 | Ga0207641_10002240 | Ga0207641_1000224012 | 240 |
| 214 | 3300026089 | Ga0207648_10155253 | Ga0207648_101552532 | 240 |
| 215 | 3300026118 | Ga0207675_100037998 | Ga0207675_1000379983 | 240 |
| 216 | 3300028379 | Ga0268266_10376633 | Ga0268266_103766332 | 240 |
| 217 | 3300028381 | Ga0268264_10043391 | Ga0268264_100433912 | 240 |
| 218 | 3300031251 | Ga0265327_10001394 | Ga0265327_100013943 | 240 |
| 219 | 3300031456 | Ga0307513_10014621 | Ga0307513_100146218 | 240 |
| 220 | 3300031691 | Ga0316579_10113709 | Ga0316579_101137092 | 240 |
| 221 | 3300033179 | Ga0307507_10179466 | Ga0307507_101794661 | 240 |
| 222 | 3300034818 | Ga0373950_0011415 | Ga0373950_0011415_321_1043 | 240 |
| 223 | 3300034820 | Ga0373959_0043498 | Ga0373959_0043498_22_744 | 240 |
| 224 | 3300034957 | Ga0373938_0011118 | Ga0373938_0011118_238_960 | 240 |
| 225 | 3300035084 | Ga0373928_0002271 | Ga0373928_0002271_2151_2873 | 240 |
| 226 | 3300035088 | Ga0373940_0011522 | Ga0373940_0011522_499_1221 | 240 |
| 227 | 3300035090 | Ga0373949_0012323 | Ga0373949_0012323_70_792 | 240 |
| 228 | 3300035092 | Ga0373952_0019701 | Ga0373952_0019701_265_987 | 240 |
| 229 | 3300035114 | Ga0373939_0004080 | Ga0373939_0004080_1578_2300 | 240 |
| 230 | 3300035115 | Ga0373941_0081754 | Ga0373941_0081754_184_906 | 240 |
| 231 | 3300035242 | Ga0373962_0003770 | Ga0373962_0003770_654_1376 | 240 |
| 232 | 3300035695 | Ga0373927_0152679 | Ga0373927_0152679_775_1497 | 240 |
| 233 | 3300036712 | Ga0316584_0032289 | Ga0316584_0032289_1828_2571 | 240 |
| 234 | 3300036712 | Ga0316584_0087880 | Ga0316584_0087880_853_1641 | 240 |
| 235 | 3300037312 | Ga0395899_0076720 | Ga0395899_0076720_675_1397 | 240 |
| 236 | 3300037418 | Ga0395900_0038975 | Ga0395900_0038975_1607_2329 | 240 |
| 237 | 3300037466 | Ga0395898_0004795 | Ga0395898_0004795_976_1701 | 240 |
| 238 | 3300037471 | Ga0395905_0097434 | Ga0395905_0097434_1646_2368 | 240 |
| 239 | 3300037471 | Ga0395905_0172850 | Ga0395905_0172850_1136_1861 | 240 |
| 240 | 3300038443 | Ga0395901_0001235 | Ga0395901_0001235_13478_14203 | 240 |
| 241 | 3300038443 | Ga0395901_0025340 | Ga0395901_0025340_2598_3320 | 240 |
| 242 | 3300038443 | Ga0395901_0179574 | Ga0395901_0179574_566_1291 | 240 |
| 243 | 3300038443 | Ga0395901_0276999 | Ga0395901_0276999_960_1682 | 240 |
| 244 | 3300039437 | Ga0436365_0268684 | Ga0436365_0268684_1417_2139 | 240 |
| 245 | 3300042009 | Ga0439451_031779 | Ga0439451_031779_186_911 | 240 |
| 246 | 3300042993 | Ga0439440_0034153 | Ga0439440_0034153_454_1179 | 240 |
| 247 | 3300044693 | Ga0466961_0013715 | Ga0466961_0013715_3865_4590 | 240 |
| 248 | 3300044693 | Ga0466961_0393560 | Ga0466961_0393560_94_816 | 240 |
| 249 | 3300044719 | Ga0466971_0138911 | Ga0466971_0138911_109_831 | 240 |
| 250 | 3300045049 | Ga0466959_0044512 | Ga0466959_0044512_1671_2393 | 240 |
| 251 | 3300045049 | Ga0466959_0286335 | Ga0466959_0286335_153_878 | 240 |
| 252 | 3300045051 | Ga0451576_0224255 | Ga0451576_0224255_754_1476 | 240 |
| 253 | 3300045836 | Ga0466958_0128611 | Ga0466958_0128611_430_1155 | 240 |
| 254 | 3300045976 | Ga0466967_0344909 | Ga0466967_0344909_480_1202 | 240 |
| 255 | 3300046517 | Ga0495630_0419043 | Ga0495630_0419043_77_799 | 240 |
| 256 | 3300048907 | Ga0496104_0372238 | Ga0496104_0372238_539_1261 | 240 |
| 257 | 3300048907 | Ga0496104_0566237 | Ga0496104_0566237_127_852 | 240 |
| 258 | 3300048908 | Ga0496105_0283054 | Ga0496105_0283054_145_867 | 240 |
| 259 | 3300048913 | Ga0496110_0064795 | Ga0496110_0064795_731_1453 | 240 |
| 260 | 3300048913 | Ga0496110_0103363 | Ga0496110_0103363_920_1642 | 240 |
| 261 | 3300048914 | Ga0496111_0025280 | Ga0496111_0025280_1366_2088 | 240 |
| 262 | 3300048915 | Ga0496112_0673609 | Ga0496112_0673609_131_853 | 240 |
| 263 | 3300048916 | Ga0496113_0012047 | Ga0496113_0012047_2054_2776 | 240 |
| 264 | 3300048916 | Ga0496113_0146791 | Ga0496113_0146791_277_999 | 240 |
| 265 | 3300048921 | Ga0496118_0127916 | Ga0496118_0127916_426_1148 | 240 |
| 266 | 3300049585 | Ga0501069_0154260 | Ga0501069_0154260_288_1013 | 240 |
| 267 | 3300050507 | nmdc:mga05p37_116054_c1 | nmdc:mga05p37_116054_c1_1166_1891 | 240 |
| 268 | 3300050507 | nmdc:mga05p37_134982_c1 | nmdc:mga05p37_134982_c1_1578_2300 | 240 |
| 269 | 3300050510 | nmdc:mga06r32_152180_c1 | nmdc:mga06r32_152180_c1_1338_2063 | 240 |
| 270 | 3300050511 | nmdc:mga08y16_409869_c1 | nmdc:mga08y16_409869_c1_197_919 | 240 |
| 271 | 3300050512 | nmdc:mga0n895_5213_c1 | nmdc:mga0n895_5213_c1_8520_9242 | 240 |
| 272 | 3300050515 | nmdc:mga0a205_75677_c1 | nmdc:mga0a205_75677_c1_1176_1898 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9685 | 1 | 226 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9601 | 1 | 226 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9497 | 4 | 227 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9484 | 1 | 224 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9464 | 3 | 219 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9602 | 1 | 226 | 3.40.50.300 |
| af_P0A9T8_2_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.958 | 2 | 225 | 3.40.50.300 |
| af_Q2FVR1_1_221_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9526 | 4 | 222 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9519 | 1 | 226 | 3.40.50.300 |
| af_P9WQK5_1_219_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9505 | 1 | 214 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N4ZAL6-F1-model_v4 | Putative ABC transport system ATP-binding protein | 0.9711 | 2 | 222 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A5C0AW49-F1-model_v4 | ABC transporter ATP-binding protein | 0.9708 | 2 | 229 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A3D6A155-F1-model_v4 | deleted | 0.9707 | 1 | 229 |
|
| AF-A0A346PK27-F1-model_v4 | ABC-type antimicrobial peptide transport system, ATPase component | 0.9686 | 2 | 228 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7J0BSF2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9672 | 2 | 226 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar