F378274

General Info

Members Datasets Scaffolds Average Seq Length
272 183 544 162

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10131866|Ga0075366_101318662
Length 185
Sequence MRKHSLSLADRISRESDRPGMTTIAEFSAEQANGTSVSLADKLGKVLLVVNTASKCGFTPQYAGLEALWQEFGGRGFEILAFPCNQFGGQEPGSAAEIASFCQVNYGLSFPVMAKIEVNGAHAPPLWQWLKAEAPGIFGTQKIKWNFTKFLIGRDGKVVRRYAPRTSPAAIRAAIETELAVSSPD

Samples

Sample ID Description Type Environment
1 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
87 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
88 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
89 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
113 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
114 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
132 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
133 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
134 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
143 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
144 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
145 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
146 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
160 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
161 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
163 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
164 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
165 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
166 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
167 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
168 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
169 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
170 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
171 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
172 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
173 2765235841 Pseudomonas putida AA7 Isolate Unclassified
174 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
175 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
176 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
177 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
178 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
179 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
180 640753048 Serratia proteamaculans 568 Isolate Endosphere
181 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
182 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
183 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.01
Metatranscriptomes 0
Isolates 6.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.19
Nodule 2.21
Rhizoplane 6.99
Rhizosphere 62.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075366_10131866 3300006195 Bacteria 1508
2 SwRhRL2b_contig_1412557 2162886007 Bacteria 1023
3 SwRhRL2b_contig_1816301 2162886007 Bacteria 1337
4 SwRhRL2b_contig_2420720 2162886007 Bacteria 1007
5 SwRhRL2b_contig_2663295 2162886007 Bacteria 6488
6 JGI24748J21848_1004373 3300002074 Bacteria 1622
7 JGI24034J26672_10008359 3300002239 Bacteria 1512
8 Ga0065703_1019541 3300005272 Bacteria 2776
9 Ga0065704_10000280 3300005289 Bacteria 50510
10 Ga0065707_10086681 3300005295 Bacteria 5355
11 Ga0070658_10130794 3300005327 Bacteria 2092
12 Ga0070666_10728602 3300005335 Bacteria 728
13 Ga0070668_100003597 3300005347 Bacteria 11435
14 Ga0070669_100001205 3300005353 Bacteria 18825
15 Ga0070671_100140447 3300005355 Bacteria 2038
16 Ga0070671_100315187 3300005355 Bacteria 1332
17 Ga0070667_100001208 3300005367 Bacteria 23502
18 Ga0070667_100713737 3300005367 Bacteria 928
19 Ga0070665_100149896 3300005548 Bacteria 2335
20 Ga0068855_100059736 3300005563 Bacteria 4460
21 Ga0068855_100118519 3300005563 Bacteria 3031
22 Ga0068855_100264365 3300005563 Bacteria 1915
23 Ga0068852_100185343 3300005616 Bacteria 1960
24 Ga0068859_100011862 3300005617 Bacteria 8754
25 Ga0068870_10413351 3300005840 Bacteria 881
26 Ga0068858_100003271 3300005842 Bacteria 16139
27 Ga0068860_100108820 3300005843 Bacteria 2649
28 Ga0068860_100206249 3300005843 Bacteria 1906
29 Ga0075368_10270829 3300006042 Bacteria 728
30 Ga0075363_100000393 3300006048 Bacteria 13338
31 Ga0075364_10000321 3300006051 Bacteria 23630
32 Ga0075432_10000436 3300006058 Bacteria 12261
33 Ga0075362_10000083 3300006177 Bacteria 26049
34 Ga0075369_10000565 3300006186 Bacteria 11707
35 Ga0075366_10002697 3300006195 Bacteria 9161
36 Ga0075370_10000017 3300006353 Bacteria 60451
37 Ga0075370_10180061 3300006353 Bacteria 1244
38 Ga0075428_100108964 3300006844 Bacteria 3018
39 Ga0075428_100222682 3300006844 Bacteria 2037
40 Ga0075431_100004991 3300006847 Bacteria 13057
41 Ga0097620_100011862 3300006931 Bacteria 8754
42 Ga0079104_1001975 3300006946 Bacteria 12043
43 Ga0079104_1006786 3300006946 Bacteria 4255
44 Ga0079104_1041535 3300006946 Bacteria 1070
45 Ga0105251_10000949 3300009011 Bacteria 25869
46 Ga0105251_10021493 3300009011 Bacteria 3367
47 Ga0105244_10012755 3300009036 Bacteria 4954
48 Ga0105244_10060843 3300009036 Bacteria 1902
49 Ga0105244_10101910 3300009036 Bacteria 1403
50 Ga0105250_10005935 3300009092 Bacteria 5403
51 Ga0111539_10124834 3300009094 Bacteria 3017
52 Ga0111539_11348020 3300009094 Bacteria 828
53 Ga0114129_11462389 3300009147 Bacteria 841
54 Ga0105241_10000002 3300009174 Bacteria 869480
55 Ga0105248_10057071 3300009177 Bacteria 4382
56 Ga0105248_10058366 3300009177 Bacteria 4334
57 Ga0105248_10085725 3300009177 Bacteria 3544
58 Ga0105248_10360901 3300009177 Bacteria 1636
59 Ga0105249_10065374 3300009553 Bacteria 3346
60 Ga0157373_10002923 3300013100 Bacteria 12936
61 Ga0163162_10014289 3300013306 Bacteria 7756
62 Ga0182008_10002508 3300014497 Bacteria 11453
63 Ga0209050_1000929 3300025298 Bacteria 38383
64 Ga0207697_10048886 3300025315 Bacteria 1745
65 Ga0207696_1000019 3300025711 Bacteria 476309
66 Ga0207696_1005361 3300025711 Bacteria 5332
67 Ga0207655_1000614 3300025728 Bacteria 42960
68 Ga0207655_1010378 3300025728 Bacteria 5651
69 Ga0207655_1063870 3300025728 Bacteria 1407
70 Ga0207713_1000944 3300025735 Bacteria 26119
71 Ga0207713_1083854 3300025735 Bacteria 1139
72 Ga0207682_10180660 3300025893 Bacteria 964
73 Ga0207688_10216758 3300025901 Bacteria 1152
74 Ga0207680_10440621 3300025903 Bacteria 924
75 Ga0207645_10569155 3300025907 Bacteria 769
76 Ga0207705_10107861 3300025909 Bacteria 2055
77 Ga0207654_10000005 3300025911 Bacteria 869492
78 Ga0207660_10512784 3300025917 Bacteria 973
79 Ga0207681_10000090 3300025923 Bacteria 78944
80 Ga0207681_10062905 3300025923 Bacteria 2557
81 Ga0207681_10814566 3300025923 Bacteria 780
82 Ga0207700_10028241 3300025928 Bacteria 3941
83 Ga0207644_10009592 3300025931 Bacteria 6357
84 Ga0207644_10029177 3300025931 Bacteria 3825
85 Ga0207690_10147473 3300025932 Bacteria 1741
86 Ga0207706_10009328 3300025933 Bacteria 9011
87 Ga0207711_10102649 3300025941 Bacteria 2531
88 Ga0207711_10484279 3300025941 Bacteria 1152
89 Ga0207667_10022541 3300025949 Bacteria 6953
90 Ga0207667_10033907 3300025949 Bacteria 5485
91 Ga0207667_10271262 3300025949 Bacteria 1734
92 Ga0207712_10035668 3300025961 Bacteria 3381
93 Ga0207712_10174880 3300025961 Bacteria 1682
94 Ga0207668_10002249 3300025972 Bacteria 11249
95 Ga0207668_10052560 3300025972 Bacteria 2819
96 Ga0207658_10003439 3300025986 Bacteria 11199
97 Ga0207703_10000733 3300026035 Bacteria 32263
98 Ga0207674_10043145 3300026116 Bacteria 4652
99 Ga0207675_100005774 3300026118 Bacteria 11834
100 Ga0207698_10029298 3300026142 Bacteria 3941
101 Ga0207698_10682391 3300026142 Bacteria 1020
102 Ga0209281_1000003 3300027111 Bacteria 1260089
103 Ga0209281_1029321 3300027111 Bacteria 994
104 Ga0209281_1031089 3300027111 Bacteria 954
105 Ga0207428_10078630 3300027907 Bacteria 2581
106 Ga0268266_10131301 3300028379 Bacteria 2240
107 Ga0268265_10002446 3300028380 Bacteria 13987
108 Ga0268264_10024557 3300028381 Bacteria 4921
109 Ga0265332_10390926 3300031238 Bacteria 574
110 Ga0265316_10071167 3300031344 Bacteria 2681
111 Ga0307408_100833585 3300031548 Bacteria 839
112 Ga0307508_10014214 3300031616 Bacteria 7260
113 Ga0307413_10142164 3300031824 Bacteria 1660
114 Ga0307413_10505661 3300031824 Bacteria 971
115 Ga0307406_10016633 3300031901 Bacteria 4280
116 Ga0307406_10876137 3300031901 Bacteria 763
117 Ga0307412_10241742 3300031911 Bacteria 1397
118 Ga0307416_100452812 3300032002 Bacteria 1336
119 Ga0307414_11156179 3300032004 Bacteria 716
120 Ga0307411_11180729 3300032005 Bacteria 693
121 Ga0307411_11280746 3300032005 Bacteria 667
122 Ga0307415_100241923 3300032126 Bacteria 1460
123 Ga0436361_1065701 3300039447 Bacteria 631
124 Ga0450902_000917 3300042137 Bacteria 3859
125 Ga0450905_000156 3300042142 Bacteria 7345
126 Ga0450901_000649 3300042533 Bacteria 4095
127 Ga0439440_0035393 3300042993 Bacteria 1198
128 Ga0466967_0518941 3300045976 Bacteria 1171
129 Ga0495592_0771228 3300046454 Bacteria 573
130 Ga0495650_0093436 3300046471 Bacteria 1140
131 Ga0495650_0252446 3300046471 Bacteria 599
132 Ga0495585_0005864 3300046492 Bacteria 7700
133 Ga0495596_0000074 3300046500 Bacteria 70574
134 Ga0495607_0097163 3300046501 Bacteria 1584
135 Ga0495607_0167152 3300046501 Bacteria 1113
136 Ga0495583_0045091 3300046506 Bacteria 2041
137 Ga0495606_0038359 3300046507 Bacteria 3242
138 Ga0495606_0111285 3300046507 Bacteria 1651
139 Ga0495610_0010856 3300046512 Bacteria 5625
140 Ga0495610_0094571 3300046512 Bacteria 1349
141 Ga0495616_0023551 3300046513 Bacteria 3311
142 Ga0495620_0000450 3300046515 Bacteria 27327
143 Ga0495632_0000578 3300046519 Bacteria 33996
144 Ga0495643_0000866 3300046522 Bacteria 32302
145 Ga0495643_0001366 3300046522 Bacteria 22850
146 Ga0495643_0004377 3300046522 Bacteria 9900
147 Ga0495643_0027926 3300046522 Bacteria 3167
148 Ga0495648_0012440 3300046524 Bacteria 6349
149 Ga0495654_0001346 3300046530 Bacteria 17079
150 Ga0495654_0216050 3300046530 Bacteria 813
151 Ga0495609_0036763 3300046538 Bacteria 2210
152 Ga0495668_0369986 3300046616 Bacteria 787
153 Ga0495625_0010913 3300046660 Bacteria 7463
154 Ga0495661_0000388 3300046665 Bacteria 47062
155 Ga0495671_0016284 3300046692 Bacteria 3973
156 Ga0495589_0000004 3300046794 Bacteria 439891
157 Ga0495672_0039423 3300047320 Bacteria 2872
158 Ga0495681_0071389 3300047470 Bacteria 1572
159 Ga0495615_0000138 3300048090 Bacteria 18315
160 Ga0495626_0002682 3300048091 Bacteria 12023
161 Ga0496100_0003595 3300048903 Bacteria 8099
162 Ga0496100_0076660 3300048903 Bacteria 2245
163 Ga0496100_0439889 3300048903 Bacteria 998
164 Ga0496100_1008975 3300048903 Bacteria 655
165 Ga0496101_0019522 3300048904 Bacteria 4628
166 Ga0496101_0238092 3300048904 Bacteria 1416
167 Ga0496103_0000190 3300048906 Bacteria 61731
168 Ga0496104_0005413 3300048907 Bacteria 11171
169 Ga0496104_0171127 3300048907 Bacteria 2083
170 Ga0496105_0000395 3300048908 Bacteria 28676
171 Ga0496108_0274314 3300048911 Bacteria 1468
172 Ga0496110_0507591 3300048913 Bacteria 1097
173 Ga0496111_0218051 3300048914 Bacteria 1417
174 Ga0496111_0237418 3300048914 Bacteria 1354
175 Ga0496112_0004154 3300048915 Bacteria 12193
176 Ga0496113_0000233 3300048916 Bacteria 26178
177 Ga0496114_0059292 3300048917 Bacteria 3197
178 Ga0496114_0135464 3300048917 Bacteria 2130
179 Ga0496115_0629875 3300048918 Bacteria 850
180 Ga0496116_0000035 3300048919 Bacteria 402424
181 Ga0496116_0102946 3300048919 Bacteria 1700
182 Ga0496116_0396544 3300048919 Bacteria 612
183 Ga0496117_0000323 3300048920 Bacteria 83916
184 Ga0496117_0011980 3300048920 Bacteria 7703
185 Ga0496117_0037748 3300048920 Bacteria 3594
186 Ga0496117_0040578 3300048920 Bacteria 3420
187 Ga0496118_0003389 3300048921 Bacteria 20144
188 Ga0496118_0023285 3300048921 Bacteria 5384
189 Ga0496118_0032631 3300048921 Bacteria 4284
190 Ga0496119_0000040 3300048922 Bacteria 208180
191 Ga0496119_0034500 3300048922 Bacteria 3331
192 Ga0496120_0006915 3300048923 Bacteria 8558
193 Ga0496121_0037350 3300048924 Bacteria 4315
194 Ga0496121_0054535 3300048924 Bacteria 3338
195 Ga0496121_0110914 3300048924 Bacteria 2093
196 Ga0496121_0156915 3300048924 Bacteria 1669
197 Ga0496122_0002251 3300048925 Bacteria 27964
198 Ga0496122_0126071 3300048925 Bacteria 1638
199 Ga0496122_0191590 3300048925 Bacteria 1206
200 Ga0496123_0001169 3300048926 Bacteria 38781
201 Ga0496123_0002605 3300048926 Bacteria 21912
202 Ga0496123_0007112 3300048926 Bacteria 10629
203 Ga0496123_0049653 3300048926 Bacteria 2810
204 Ga0496123_0215694 3300048926 Bacteria 972
205 Ga0496124_0000087 3300048927 Bacteria 200697
206 Ga0496124_0003117 3300048927 Bacteria 20575
207 Ga0496124_0005357 3300048927 Bacteria 14482
208 Ga0496124_0034943 3300048927 Bacteria 4401
209 Ga0496124_0039930 3300048927 Bacteria 4062
210 Ga0496124_0061075 3300048927 Bacteria 3160
211 Ga0496124_0400742 3300048927 Bacteria 952
212 Ga0496124_0400751 3300048927 Bacteria 952
213 Ga0496125_0003763 3300048928 Bacteria 18060
214 Ga0496125_0008568 3300048928 Bacteria 10681
215 Ga0496125_0029262 3300048928 Bacteria 4954
216 Ga0496125_0051560 3300048928 Bacteria 3392
217 Ga0496126_0000044 3300048929 Bacteria 335904
218 Ga0496126_0000084 3300048929 Bacteria 217111
219 Ga0496126_0027895 3300048929 Bacteria 5386
220 Ga0496126_0028302 3300048929 Bacteria 5342
221 Ga0496126_0084975 3300048929 Bacteria 2790
222 Ga0501033_0028551 3300049570 Bacteria 4191
223 Ga0501039_0326002 3300049575 Bacteria 1207
224 Ga0501043_0706515 3300049579 Bacteria 736
225 Ga0501047_0324871 3300049581 Bacteria 1378
226 Ga0501236_072064 3300049670 Bacteria 633
227 Ga0501249_013674 3300049679 Bacteria 1726
228 Ga0501257_035217 3300049686 Bacteria 1217
229 Ga0501259_165118 3300049688 Bacteria 555
230 Ga0501263_024343 3300049760 Bacteria 829
231 Ga0501044_0066025 3300049823 Bacteria 3690
232 Ga0501044_0683533 3300049823 Bacteria 913
233 Ga0501212_105977 3300049851 Bacteria 532
234 nmdc:mga03683_13_c1 3300050489 Bacteria 110533
235 nmdc:mga03n38_3086_c1 3300050490 Bacteria 5287
236 nmdc:mga00v17_698_c1 3300050491 Bacteria 18386
237 nmdc:mga0k408_75522_c1 3300050493 Bacteria 1969
238 nmdc:mga0k408_8_c1 3300050493 Bacteria 161211
239 nmdc:mga06z11_627178_c1 3300050494 Bacteria 654
240 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
241 nmdc:mga07m45_595065_c1 3300050496 Bacteria 639
242 nmdc:mga05p37_1539973_c1 3300050507 Bacteria 659
243 nmdc:mga0qj67_1225887_c1 3300050509 Bacteria 583
244 nmdc:mga0qj67_69085_c1 3300050509 Bacteria 2817
245 nmdc:mga06r32_304_c1 3300050510 Bacteria 40653
246 nmdc:mga08y16_1060439_c1 3300050511 Bacteria 787
247 nmdc:mga08y16_663241_c1 3300050511 Bacteria 1046
248 nmdc:mga0sz30_434_c2 3300050516 Bacteria 11707
249 Ga0500643_000065 3300053087 Bacteria 119995
250 Ga0500654_124972 3300053099 Bacteria 996
251 Ga0500618_108064 3300053125 Bacteria 628
252 Ga0500590_001930 3300053148 Bacteria 8886
253 Ga0500636_0152153 3300053177 Bacteria 1270
254 2508852196 2508501071 Bacteria 5454741
255 2511129603 2510917021 Bacteria 5705459
256 2555246418 2554235231 Bacteria 5215788
257 2738709983 2738541275 Bacteria 4830863
258 2738848408 2738541301 Bacteria 4834102
259 2738864137 2738541304 Bacteria 4833665
260 2739296655 2738543022 Bacteria 4835059
261 2739358333 2738543033 Bacteria 4833336
262 2765585312 2765235841 Bacteria 6137024
263 2807179434 2806310673 Bacteria 4801221
264 2842783771 2842780639 Bacteria 4337790
265 2919141666 2919138771 Bacteria 5281312
266 2928101682 2928100450 Bacteria 4837635
267 2928959772 2928959182 Bacteria 4725774
268 3007804348 3007803356 Bacteria 5931491
269 640937707 640753048 Bacteria 5495657
270 8054302705 8054302542 Bacteria 5698134
271 8054930919 8054929484 Bacteria 5599761
272 8056117791 8056115690 Bacteria 5527654
273 Ga0075366_10131866
274 SwRhRL2b_contig_1412557
275 SwRhRL2b_contig_1816301
276 SwRhRL2b_contig_2420720
277 SwRhRL2b_contig_2663295
278 JGI24748J21848_1004373
279 JGI24034J26672_10008359
280 Ga0065703_1019541
281 Ga0065704_10000280
282 Ga0065707_10086681
283 Ga0070658_10130794
284 Ga0070666_10728602
285 Ga0070668_100003597
286 Ga0070669_100001205
287 Ga0070671_100140447
288 Ga0070671_100315187
289 Ga0070667_100001208
290 Ga0070667_100713737
291 Ga0070665_100149896
292 Ga0068855_100059736
293 Ga0068855_100118519
294 Ga0068855_100264365
295 Ga0068852_100185343
296 Ga0068859_100011862
297 Ga0068870_10413351
298 Ga0068858_100003271
299 Ga0068860_100108820
300 Ga0068860_100206249
301 Ga0075368_10270829
302 Ga0075363_100000393
303 Ga0075364_10000321
304 Ga0075432_10000436
305 Ga0075362_10000083
306 Ga0075369_10000565
307 Ga0075366_10002697
308 Ga0075370_10000017
309 Ga0075370_10180061
310 Ga0075428_100108964
311 Ga0075428_100222682
312 Ga0075431_100004991
313 Ga0097620_100011862
314 Ga0079104_1001975
315 Ga0079104_1006786
316 Ga0079104_1041535
317 Ga0105251_10000949
318 Ga0105251_10021493
319 Ga0105244_10012755
320 Ga0105244_10060843
321 Ga0105244_10101910
322 Ga0105250_10005935
323 Ga0111539_10124834
324 Ga0111539_11348020
325 Ga0114129_11462389
326 Ga0105241_10000002
327 Ga0105248_10057071
328 Ga0105248_10058366
329 Ga0105248_10085725
330 Ga0105248_10360901
331 Ga0105249_10065374
332 Ga0157373_10002923
333 Ga0163162_10014289
334 Ga0182008_10002508
335 Ga0209050_1000929
336 Ga0207697_10048886
337 Ga0207696_1000019
338 Ga0207696_1005361
339 Ga0207655_1000614
340 Ga0207655_1010378
341 Ga0207655_1063870
342 Ga0207713_1000944
343 Ga0207713_1083854
344 Ga0207682_10180660
345 Ga0207688_10216758
346 Ga0207680_10440621
347 Ga0207645_10569155
348 Ga0207705_10107861
349 Ga0207654_10000005
350 Ga0207660_10512784
351 Ga0207681_10000090
352 Ga0207681_10062905
353 Ga0207681_10814566
354 Ga0207700_10028241
355 Ga0207644_10009592
356 Ga0207644_10029177
357 Ga0207690_10147473
358 Ga0207706_10009328
359 Ga0207711_10102649
360 Ga0207711_10484279
361 Ga0207667_10022541
362 Ga0207667_10033907
363 Ga0207667_10271262
364 Ga0207712_10035668
365 Ga0207712_10174880
366 Ga0207668_10002249
367 Ga0207668_10052560
368 Ga0207658_10003439
369 Ga0207703_10000733
370 Ga0207674_10043145
371 Ga0207675_100005774
372 Ga0207698_10029298
373 Ga0207698_10682391
374 Ga0209281_1000003
375 Ga0209281_1029321
376 Ga0209281_1031089
377 Ga0207428_10078630
378 Ga0268266_10131301
379 Ga0268265_10002446
380 Ga0268264_10024557
381 Ga0265332_10390926
382 Ga0265316_10071167
383 Ga0307408_100833585
384 Ga0307508_10014214
385 Ga0307413_10142164
386 Ga0307413_10505661
387 Ga0307406_10016633
388 Ga0307406_10876137
389 Ga0307412_10241742
390 Ga0307416_100452812
391 Ga0307414_11156179
392 Ga0307411_11180729
393 Ga0307411_11280746
394 Ga0307415_100241923
395 Ga0436361_1065701
396 Ga0450902_000917
397 Ga0450905_000156
398 Ga0450901_000649
399 Ga0439440_0035393
400 Ga0466967_0518941
401 Ga0495592_0771228
402 Ga0495650_0093436
403 Ga0495650_0252446
404 Ga0495585_0005864
405 Ga0495596_0000074
406 Ga0495607_0097163
407 Ga0495607_0167152
408 Ga0495583_0045091
409 Ga0495606_0038359
410 Ga0495606_0111285
411 Ga0495610_0010856
412 Ga0495610_0094571
413 Ga0495616_0023551
414 Ga0495620_0000450
415 Ga0495632_0000578
416 Ga0495643_0000866
417 Ga0495643_0001366
418 Ga0495643_0004377
419 Ga0495643_0027926
420 Ga0495648_0012440
421 Ga0495654_0001346
422 Ga0495654_0216050
423 Ga0495609_0036763
424 Ga0495668_0369986
425 Ga0495625_0010913
426 Ga0495661_0000388
427 Ga0495671_0016284
428 Ga0495589_0000004
429 Ga0495672_0039423
430 Ga0495681_0071389
431 Ga0495615_0000138
432 Ga0495626_0002682
433 Ga0496100_0003595
434 Ga0496100_0076660
435 Ga0496100_0439889
436 Ga0496100_1008975
437 Ga0496101_0019522
438 Ga0496101_0238092
439 Ga0496103_0000190
440 Ga0496104_0005413
441 Ga0496104_0171127
442 Ga0496105_0000395
443 Ga0496108_0274314
444 Ga0496110_0507591
445 Ga0496111_0218051
446 Ga0496111_0237418
447 Ga0496112_0004154
448 Ga0496113_0000233
449 Ga0496114_0059292
450 Ga0496114_0135464
451 Ga0496115_0629875
452 Ga0496116_0000035
453 Ga0496116_0102946
454 Ga0496116_0396544
455 Ga0496117_0000323
456 Ga0496117_0011980
457 Ga0496117_0037748
458 Ga0496117_0040578
459 Ga0496118_0003389
460 Ga0496118_0023285
461 Ga0496118_0032631
462 Ga0496119_0000040
463 Ga0496119_0034500
464 Ga0496120_0006915
465 Ga0496121_0037350
466 Ga0496121_0054535
467 Ga0496121_0110914
468 Ga0496121_0156915
469 Ga0496122_0002251
470 Ga0496122_0126071
471 Ga0496122_0191590
472 Ga0496123_0001169
473 Ga0496123_0002605
474 Ga0496123_0007112
475 Ga0496123_0049653
476 Ga0496123_0215694
477 Ga0496124_0000087
478 Ga0496124_0003117
479 Ga0496124_0005357
480 Ga0496124_0034943
481 Ga0496124_0039930
482 Ga0496124_0061075
483 Ga0496124_0400742
484 Ga0496124_0400751
485 Ga0496125_0003763
486 Ga0496125_0008568
487 Ga0496125_0029262
488 Ga0496125_0051560
489 Ga0496126_0000044
490 Ga0496126_0000084
491 Ga0496126_0027895
492 Ga0496126_0028302
493 Ga0496126_0084975
494 Ga0501033_0028551
495 Ga0501039_0326002
496 Ga0501043_0706515
497 Ga0501047_0324871
498 Ga0501236_072064
499 Ga0501249_013674
500 Ga0501257_035217
501 Ga0501259_165118
502 Ga0501263_024343
503 Ga0501044_0066025
504 Ga0501044_0683533
505 Ga0501212_105977
506 nmdc:mga03683_13_c1
507 nmdc:mga03n38_3086_c1
508 nmdc:mga00v17_698_c1
509 nmdc:mga0k408_75522_c1
510 nmdc:mga0k408_8_c1
511 nmdc:mga06z11_627178_c1
512 nmdc:mga07m45_3_c1
513 nmdc:mga07m45_595065_c1
514 nmdc:mga05p37_1539973_c1
515 nmdc:mga0qj67_1225887_c1
516 nmdc:mga0qj67_69085_c1
517 nmdc:mga06r32_304_c1
518 nmdc:mga08y16_1060439_c1
519 nmdc:mga08y16_663241_c1
520 nmdc:mga0sz30_434_c2
521 Ga0500643_000065
522 Ga0500654_124972
523 Ga0500618_108064
524 Ga0500590_001930
525 Ga0500636_0152153
526 2508852196
527 2511129603
528 2555246418
529 2738709983
530 2738848408
531 2738864137
532 2739296655
533 2739358333
534 2765585312
535 2807179434
536 2842783771
537 2919141666
538 2928101682
539 2928959772
540 3007804348
541 640937707
542 8054302705
543 8054930919
544 8056117791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

24

131

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9323 5 162
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9312 4 162
2vup-assembly1.cif.gz_A crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei 0.9255 5 162
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9251 5 162
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9126 4 162
ID Description Score Start End Superfamily
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9395 2 162 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9348 5 159 3.40.30.10
af_A0A1D6K2D3_10_119_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9251 59 160 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9228 2 162 3.40.30.10
af_Q7FS88_1_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9185 5 162 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3M6F251-F1-model_v4 Glutathione peroxidase 0.9575 2 160 GO:0004601
GO:0034599
AF-Q48FR3-F1-model_v4 Glutathione peroxidase 0.9572 2 160 GO:0004601
GO:0034599
AF-A0A3M4QYY1-F1-model_v4 deleted 0.9567 2 160
AF-A0A3M3YJA7-F1-model_v4 Glutathione peroxidase 0.9566 2 160 GO:0004601
GO:0034599
AF-A0A3D9EBT1-F1-model_v4 Glutathione peroxidase 0.9549 1 162 GO:0004601
GO:0034599

Map