F378249

General Info

Members Datasets Scaffolds Average Seq Length
272 192 269 193

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10019903|Ga0081455_100199032
Length 215
Sequence MPAYKTGPLDASTWDAFAELVERNNGVYGGCWCIAHHVEYQRGVSDPRTLKEELVRAGRARAALVFDEDALAQGWCQYGSPEELGLKHHREYAKDPPPRAHWRIACIFVDKRHRGRGVARAGLEGALAQIAAAGGGLVEAISEVTAGREAQGRFLFSATVELFEEYGFTRRRQVGKHAWIVSREIDPAEWTHTSAHDTSAVSSPRNAHEPPAPRP

Samples

Sample ID Description Type Environment
1 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
2 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
3 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
80 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
85 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
103 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
104 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
105 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
106 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
186 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
187 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.06
Metatranscriptomes 1.84
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.82
Nodule 0
Rhizoplane 5.51
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10063258 3300003320 Bacteria 5383
2 Ga0070658_10030121 3300005327 Bacteria 4361
3 Ga0070683_100089207 3300005329 Bacteria 2894
4 Ga0070680_100198957 3300005336 Bacteria 1689
5 Ga0070660_100088420 3300005339 Unclassified 2440
6 Ga0070661_100025853 3300005344 Bacteria 4220
7 Ga0070661_100290073 3300005344 Bacteria 1271
8 Ga0070659_100083189 3300005366 Bacteria 2558
9 Ga0070659_100745510 3300005366 Bacteria 849
10 Ga0070714_100005523 3300005435 Bacteria 9653
11 Ga0070714_100531576 3300005435 Bacteria 1124
12 Ga0070713_100480937 3300005436 Bacteria 1170
13 Ga0070713_100827059 3300005436 Bacteria 888
14 Ga0070678_101197349 3300005456 Bacteria 704
15 Ga0070681_10260473 3300005458 Bacteria 1646
16 Ga0070681_10346408 3300005458 Bacteria 1396
17 Ga0070706_100334604 3300005467 Bacteria 1412
18 Ga0070707_100150191 3300005468 Bacteria 2268
19 Ga0070707_100308864 3300005468 Bacteria 1537
20 Ga0070699_100085840 3300005518 Bacteria 2746
21 Ga0070679_100008106 3300005530 Bacteria 9870
22 Ga0070684_100026086 3300005535 Bacteria 4919
23 Ga0070686_100081558 3300005544 Bacteria 2143
24 Ga0070664_100450096 3300005564 Bacteria 1182
25 Ga0068857_100460578 3300005577 Bacteria 1190
26 Ga0081455_10003613 3300005937 Bacteria 17728
27 Ga0081455_10019903 3300005937 Bacteria 6336
28 Ga0081455_10108602 3300005937 Bacteria 2209
29 Ga0081455_10337165 3300005937 Bacteria 1068
30 Ga0081538_10000081 3300005981 Bacteria 92176
31 Ga0070717_10042957 3300006028 Bacteria 3688
32 Ga0070717_10049795 3300006028 Bacteria 3440
33 Ga0070717_10127739 3300006028 Bacteria 2184
34 Ga0070717_10218716 3300006028 Bacteria 1673
35 Ga0075365_10005407 3300006038 Bacteria 6881
36 Ga0075365_10013614 3300006038 Bacteria 4874
37 Ga0075365_10070529 3300006038 Bacteria 2351
38 Ga0075365_10137706 3300006038 Unclassified 1693
39 Ga0075363_100019308 3300006048 Bacteria 3406
40 Ga0075363_100159993 3300006048 Bacteria 1274
41 Ga0075364_10034230 3300006051 Bacteria 3276
42 Ga0075364_10050545 3300006051 Bacteria 2713
43 Ga0070716_100676052 3300006173 Bacteria 786
44 Ga0070712_100402787 3300006175 Bacteria 1130
45 Ga0075362_10012962 3300006177 Bacteria 3325
46 Ga0075362_10014253 3300006177 Bacteria 3204
47 Ga0075362_10375687 3300006177 Bacteria 714
48 Ga0075367_10053390 3300006178 Bacteria 2394
49 Ga0075428_100930144 3300006844 Bacteria 922
50 Ga0075428_100979146 3300006844 Bacteria 896
51 Ga0075430_100272550 3300006846 Bacteria 1401
52 Ga0075430_100694448 3300006846 Bacteria 839
53 Ga0075431_100043170 3300006847 Bacteria 4653
54 Ga0075431_100050037 3300006847 Bacteria 4309
55 Ga0075429_100126955 3300006880 Bacteria 2231
56 Ga0075429_100264528 3300006880 Bacteria 1506
57 Ga0111539_10184399 3300009094 Bacteria 2437
58 Ga0111539_11285159 3300009094 Bacteria 849
59 Ga0105245_10891949 3300009098 Unclassified 931
60 Ga0114129_10000696 3300009147 Bacteria 42382
61 Ga0114129_10010366 3300009147 Bacteria 13292
62 Ga0114129_11479974 3300009147 Bacteria 835
63 Ga0105243_10346788 3300009148 Bacteria 1362
64 Ga0105246_10141525 3300011119 Bacteria 1809
65 Ga0157369_10005507 3300013105 Bacteria 14715
66 Ga0157372_10449786 3300013307 Bacteria 1501
67 Ga0157375_10661220 3300013308 Bacteria 1200
68 Ga0163163_10201440 3300014325 Bacteria 2039
69 Ga0163163_11216465 3300014325 Bacteria 816
70 Ga0157377_10833401 3300014745 Bacteria 683
71 Ga0157379_10236935 3300014968 Bacteria 1655
72 Ga0157376_10258565 3300014969 Bacteria 1630
73 Ga0206356_10835173 3300020070 Bacteria 1379
74 Ga0206354_10444841 3300020081 Bacteria 714
75 Ga0206354_10980750 3300020081 Bacteria 3100
76 Ga0206353_10090436 3300020082 Bacteria 2607
77 Ga0206353_11206652 3300020082 Bacteria 1079
78 Ga0213876_10020808 3300021384 Unclassified 3469
79 Ga0207688_10402946 3300025901 Bacteria 848
80 Ga0207705_10052603 3300025909 Bacteria 2932
81 Ga0207684_10042295 3300025910 Bacteria 3862
82 Ga0207684_10253319 3300025910 Bacteria 1519
83 Ga0207693_10390342 3300025915 Bacteria 1088
84 Ga0207660_10087348 3300025917 Bacteria 2304
85 Ga0207660_10764137 3300025917 Bacteria 789
86 Ga0207657_10103092 3300025919 Bacteria 2365
87 Ga0207646_10132456 3300025922 Bacteria 2244
88 Ga0207646_10991081 3300025922 Bacteria 743
89 Ga0207650_10127753 3300025925 Bacteria 1986
90 Ga0207700_10041626 3300025928 Bacteria 3363
91 Ga0207664_10002370 3300025929 Bacteria 12452
92 Ga0207664_11009045 3300025929 Bacteria 746
93 Ga0207690_10017292 3300025932 Bacteria 4400
94 Ga0207690_10350175 3300025932 Bacteria 1168
95 Ga0207669_10048014 3300025937 Bacteria 2533
96 Ga0207661_10019070 3300025944 Bacteria 5105
97 Ga0207661_10022014 3300025944 Bacteria 4790
98 Ga0207661_10290512 3300025944 Bacteria 1463
99 Ga0207678_10770984 3300026067 Bacteria 848
100 Ga0207702_10365488 3300026078 Bacteria 1384
101 Ga0207648_10450564 3300026089 Bacteria 1172
102 Ga0207674_10306870 3300026116 Bacteria 1536
103 Ga0207428_10062116 3300027907 Bacteria 2955
104 Ga0268266_10139246 3300028379 Bacteria 2177
105 Ga0265338_10304108 3300028800 Bacteria 1158
106 Ga0265327_10035598 3300031251 Bacteria 2749
107 Ga0307513_10026365 3300031456 Bacteria 6702
108 Ga0307508_10132495 3300031616 Bacteria 2096
109 Ga0307518_10112869 3300031838 Bacteria 1934
110 Ga0307409_100067990 3300031995 Bacteria 2816
111 Ga0307415_100620495 3300032126 Bacteria 965
112 Ga0373934_0000018 3300035086 Bacteria 56540
113 Ga0373923_0153941 3300035111 Bacteria 1046
114 Ga0373953_0000105 3300035117 Bacteria 20370
115 Ga0373954_0018938 3300035118 Bacteria 3102
116 Ga0373954_0236728 3300035118 Bacteria 898
117 Ga0373956_0001561 3300035119 Bacteria 9458
118 Ga0373957_0000062 3300035120 Bacteria 26180
119 Ga0373946_0354953 3300035171 Bacteria 734
120 Ga0373955_0000822 3300035172 Bacteria 13279
121 Ga0373924_0003407 3300035410 Bacteria 5468
122 Ga0373931_0302907 3300035691 Bacteria 988
123 Ga0373935_0271728 3300035692 Bacteria 1191
124 Ga0373927_0276679 3300035695 Bacteria 1104
125 Ga0373933_0000371 3300035724 Bacteria 28732
126 Ga0373947_0342659 3300035725 Bacteria 1002
127 Ga0373937_0000191 3300036401 Bacteria 60046
128 Ga0373937_0482595 3300036401 Bacteria 1177
129 Ga0373925_0421427 3300037068 Bacteria 1091
130 Ga0395899_0054583 3300037312 Bacteria 2956
131 Ga0395900_0436677 3300037418 Bacteria 1267
132 Ga0395898_0385388 3300037466 Bacteria 1337
133 Ga0395905_0376828 3300037471 Bacteria 1312
134 Ga0436364_0812384 3300037853 Bacteria 2198
135 Ga0395901_0441038 3300038443 Bacteria 1333
136 Ga0436365_0460988 3300039437 Bacteria 882
137 Ga0436365_0567338 3300039437 Bacteria 8316
138 Ga0439439_0032876 3300041406 Bacteria 1326
139 Ga0451833_0655803 3300041491 Bacteria 762
140 Ga0439433_0004616 3300041999 Bacteria 2960
141 Ga0439442_006628 3300042002 Bacteria 2325
142 Ga0439457_031510 3300042014 Bacteria 1176
143 Ga0439462_0071930 3300042015 Bacteria 939
144 Ga0466966_0214376 3300044684 Bacteria 1163
145 Ga0466961_0086193 3300044693 Bacteria 1985
146 Ga0466963_0084949 3300044694 Bacteria 2148
147 Ga0495592_0000170 3300046454 Bacteria 57330
148 Ga0495603_0089864 3300046455 Unclassified 1797
149 Ga0495651_0000390 3300046462 Bacteria 33869
150 Ga0495653_0001668 3300046463 Bacteria 17449
151 Ga0495653_0041719 3300046463 Bacteria 3580
152 Ga0495608_0000075 3300046511 Bacteria 76519
153 Ga0495628_0015083 3300046516 Bacteria 6454
154 Ga0495628_0206956 3300046516 Bacteria 1477
155 Ga0495628_0320559 3300046516 Bacteria 1144
156 Ga0495628_0373418 3300046516 Bacteria 1045
157 Ga0495652_0000560 3300046529 Bacteria 43500
158 Ga0495652_0084408 3300046529 Bacteria 2612
159 Ga0495652_0330602 3300046529 Bacteria 1098
160 Ga0495586_0325853 3300046535 Bacteria 881
161 Ga0495587_0000121 3300046536 Bacteria 60046
162 Ga0495645_0012815 3300046543 Bacteria 5917
163 Ga0495667_0000118 3300046559 Bacteria 57665
164 Ga0495667_0326656 3300046559 Bacteria 970
165 Ga0495634_0074060 3300046642 Bacteria 2238
166 Ga0495635_0011976 3300046663 Bacteria 6076
167 Ga0495635_0204799 3300046663 Bacteria 1337
168 Ga0495657_0000122 3300046675 Bacteria 69454
169 Ga0495657_0259207 3300046675 Bacteria 1045
170 Ga0495599_0000160 3300046678 Bacteria 44043
171 Ga0495623_0000296 3300046679 Bacteria 32620
172 Ga0495646_0182270 3300046680 Bacteria 1152
173 Ga0495600_0009182 3300046809 Bacteria 6100
174 Ga0495600_0037341 3300046809 Bacteria 3158
175 Ga0495600_0179140 3300046809 Bacteria 1366
176 Ga0495600_0192865 3300046809 Bacteria 1310
177 Ga0495581_0552095 3300047315 Bacteria 669
178 Ga0495604_0000882 3300047317 Bacteria 24966
179 Ga0495674_0074053 3300047319 Bacteria 2934
180 Ga0495674_0218545 3300047319 Bacteria 1576
181 Ga0495680_0000158 3300047322 Bacteria 69254
182 Ga0495680_0181031 3300047322 Bacteria 1521
183 Ga0495675_0000904 3300047444 Bacteria 18075
184 Ga0495684_0350341 3300047471 Bacteria 1048
185 Ga0495593_0417992 3300047673 Bacteria 671
186 Ga0495602_0000173 3300048088 Bacteria 60166
187 Ga0495602_0205765 3300048088 Bacteria 1498
188 Ga0496102_0290236 3300048905 Bacteria 1542
189 Ga0496105_0058190 3300048908 Bacteria 3190
190 Ga0496106_0159924 3300048909 Bacteria 1781
191 Ga0496108_0014934 3300048911 Bacteria 6337
192 Ga0496109_0030995 3300048912 Bacteria 4795
193 Ga0496109_0406619 3300048912 Bacteria 1286
194 Ga0496110_0004817 3300048913 Bacteria 10511
195 Ga0496111_0002088 3300048914 Bacteria 11917
196 Ga0496112_0007239 3300048915 Bacteria 9836
197 Ga0496112_0123087 3300048915 Bacteria 2564
198 Ga0496112_0424338 3300048915 Bacteria 1268
199 Ga0496112_0998299 3300048915 Bacteria 757
200 Ga0496113_0005319 3300048916 Bacteria 8014
201 Ga0496114_0006812 3300048917 Bacteria 9001
202 Ga0496114_0317517 3300048917 Unclassified 1376
203 Ga0501031_0003206 3300049568 Bacteria 10496
204 Ga0501032_0000108 3300049569 Bacteria 71059
205 Ga0501032_0015152 3300049569 Bacteria 5445
206 Ga0501033_0002426 3300049570 Bacteria 15856
207 Ga0501034_0202161 3300049571 Bacteria 1944
208 Ga0501036_0229643 3300049572 Unclassified 1557
209 Ga0501037_0026036 3300049573 Bacteria 4322
210 Ga0501037_0061387 3300049573 Bacteria 2741
211 Ga0501038_0000161 3300049574 Bacteria 57288
212 Ga0501039_0001019 3300049575 Bacteria 20416
213 Ga0501039_0479536 3300049575 Bacteria 977
214 Ga0501042_0014596 3300049578 Bacteria 5365
215 Ga0501043_0000221 3300049579 Bacteria 51649
216 Ga0501046_0000414 3300049580 Bacteria 42564
217 Ga0501047_0001791 3300049581 Bacteria 20782
218 Ga0501048_0256097 3300049582 Unclassified 1243
219 Ga0501067_0121736 3300049583 Bacteria 1452
220 Ga0501069_0089065 3300049585 Bacteria 1744
221 Ga0501069_0105219 3300049585 Bacteria 1603
222 Ga0501069_0223602 3300049585 Bacteria 1095
223 Ga0501070_0002578 3300049586 Bacteria 15849
224 Ga0501071_0185553 3300049587 Bacteria 1559
225 Ga0501071_0290213 3300049587 Bacteria 1239
226 Ga0501075_0325032 3300049591 Bacteria 1172
227 Ga0501076_0120171 3300049592 Bacteria 2128
228 Ga0501077_0043156 3300049593 Bacteria 2866
229 Ga0501077_0263746 3300049593 Bacteria 1096
230 Ga0501077_0565739 3300049593 Bacteria 730
231 Ga0501079_0533533 3300049741 Bacteria 923
232 Ga0501079_0644068 3300049741 Bacteria 834
233 Ga0501080_0004266 3300049742 Bacteria 12687
234 Ga0501081_0515649 3300049743 Unclassified 892
235 Ga0501035_0001969 3300049822 Bacteria 20567
236 Ga0501044_0003012 3300049823 Bacteria 19066
237 Ga0501045_0014682 3300049824 Bacteria 5553
238 Ga0501045_0379651 3300049824 Bacteria 1052
239 nmdc:mga03683_24138_c1 3300050489 Bacteria 1079
240 nmdc:mga03n38_254535_c1 3300050490 Bacteria 929
241 nmdc:mga00v17_146482_c1 3300050491 Bacteria 1516
242 nmdc:mga00v17_62080_c1 3300050491 Unclassified 2298
243 nmdc:mga00v17_9581_c1 3300050491 Bacteria 5248
244 nmdc:mga0yw44_112559_c1 3300050492 Bacteria 1746
245 nmdc:mga0yw44_2636_c1 3300050492 Bacteria 7726
246 nmdc:mga06z11_167133_c1 3300050494 Bacteria 1261
247 nmdc:mga06z11_85172_c1 3300050494 Bacteria 1705
248 nmdc:mga05p37_10209_c1 3300050507 Bacteria 11150
249 nmdc:mga05p37_656763_c1 3300050507 Bacteria 1173
250 nmdc:mga09592_438834_c1 3300050508 Bacteria 1127
251 nmdc:mga0qj67_396414_c1 3300050509 Bacteria 1114
252 nmdc:mga06r32_1101_c3 3300050510 Bacteria 2777
253 nmdc:mga06r32_12860_c1 3300050510 Bacteria 7565
254 nmdc:mga06r32_840834_c1 3300050510 Bacteria 877
255 nmdc:mga08y16_312388_c1 3300050511 Bacteria 1619
256 nmdc:mga0sz30_62049_c2 3300050516 Bacteria 1118
257 Ga0495601_0056907 3300053077 Bacteria 2477
258 Ga0495601_0147692 3300053077 Bacteria 1534
259 Ga0495612_0005955 3300053078 Bacteria 5022
260 Ga0495595_0000793 3300053084 Bacteria 12024
261 Ga0495619_0185556 3300053085 Bacteria 1439
262 Ga0495619_0351441 3300053085 Bacteria 1020
263 Ga0500644_0048244 3300053088 Bacteria 1448
264 Ga0500577_0060639 3300053142 Bacteria 1453
265 Ga0501084_0061918 3300054114 Bacteria 3133
266 Ga0501082_0225169 3300060353 Bacteria 1632
267 Ga0530510_0164695 3300061734 Bacteria 1641
268 Ga0530510_0421459 3300061734 Unclassified 1007
269 Ga0530510_0705876 3300061734 Bacteria 769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025915 Ga0207693_10390342 Ga0207693_103903422 168
2 3300035691 Ga0373931_0302907 Ga0373931_0302907_110_631 168
3 3300048905 Ga0496102_0290236 Ga0496102_0290236_262_783 168
4 3300048908 Ga0496105_0058190 Ga0496105_0058190_856_1377 168
5 3300048909 Ga0496106_0159924 Ga0496106_0159924_411_932 168
6 3300048911 Ga0496108_0014934 Ga0496108_0014934_892_1413 168
7 3300048912 Ga0496109_0030995 Ga0496109_0030995_2401_2922 168
8 3300048913 Ga0496110_0004817 Ga0496110_0004817_6704_7225 168
9 3300048914 Ga0496111_0002088 Ga0496111_0002088_10653_11174 168
10 3300048915 Ga0496112_0998299 Ga0496112_0998299_61_582 168
11 3300048916 Ga0496113_0005319 Ga0496113_0005319_6907_7428 168
12 3300049568 Ga0501031_0003206 Ga0501031_0003206_8829_9422 168
13 3300049569 Ga0501032_0000108 Ga0501032_0000108_9012_9605 168
14 3300049570 Ga0501033_0002426 Ga0501033_0002426_9144_9737 168
15 3300049571 Ga0501034_0202161 Ga0501034_0202161_119_712 168
16 3300049573 Ga0501037_0026036 Ga0501037_0026036_118_711 168
17 3300049574 Ga0501038_0000161 Ga0501038_0000161_47727_48320 168
18 3300049575 Ga0501039_0001019 Ga0501039_0001019_12446_13039 168
19 3300049579 Ga0501043_0000221 Ga0501043_0000221_16954_17547 168
20 3300049580 Ga0501046_0000414 Ga0501046_0000414_6883_7476 168
21 3300049581 Ga0501047_0001791 Ga0501047_0001791_3191_3784 168
22 3300049583 Ga0501067_0121736 Ga0501067_0121736_97_690 168
23 3300049585 Ga0501069_0089065 Ga0501069_0089065_670_1263 168
24 3300049587 Ga0501071_0185553 Ga0501071_0185553_272_865 168
25 3300049742 Ga0501080_0004266 Ga0501080_0004266_3642_4235 168
26 3300049822 Ga0501035_0001969 Ga0501035_0001969_3455_4048 168
27 3300049823 Ga0501044_0003012 Ga0501044_0003012_15502_16095 168
28 3300054114 Ga0501084_0061918 Ga0501084_0061918_1753_2346 168
29 3300049586 Ga0501070_0002578 Ga0501070_0002578_11821_12417 169
30 3300048915 Ga0496112_0424338 Ga0496112_0424338_736_1257 170
31 3300005339 Ga0070660_100088420 Ga0070660_1000884204 182
32 3300005544 Ga0070686_100081558 Ga0070686_1000815583 182
33 3300011119 Ga0105246_10141525 Ga0105246_101415252 182
34 3300013308 Ga0157375_10661220 Ga0157375_106612202 182
35 3300014968 Ga0157379_10236935 Ga0157379_102369352 182
36 3300020081 Ga0206354_10444841 Ga0206354_104448411 182
37 3300025919 Ga0207657_10103092 Ga0207657_101030922 182
38 3300025932 Ga0207690_10017292 Ga0207690_100172922 182
39 3300026067 Ga0207678_10770984 Ga0207678_107709842 182
40 3300048917 Ga0496114_0317517 Ga0496114_0317517_753_1319 182
41 3300006028 Ga0070717_10127739 Ga0070717_101277393 183
42 3300028800 Ga0265338_10304108 Ga0265338_103041082 184
43 3300031251 Ga0265327_10035598 Ga0265327_100355982 184
44 3300006038 Ga0075365_10013614 Ga0075365_100136145 185
45 3300006038 Ga0075365_10137706 Ga0075365_101377062 185
46 3300006048 Ga0075363_100159993 Ga0075363_1001599932 185
47 3300006051 Ga0075364_10050545 Ga0075364_100505453 185
48 3300006177 Ga0075362_10014253 Ga0075362_100142534 185
49 3300006178 Ga0075367_10053390 Ga0075367_100533902 185
50 3300025925 Ga0207650_10127753 Ga0207650_101277533 185
51 3300050490 nmdc:mga03n38_254535_c1 nmdc:mga03n38_254535_c1_241_798 185
52 3300050491 nmdc:mga00v17_62080_c1 nmdc:mga00v17_62080_c1_772_1329 185
53 3300050491 nmdc:mga00v17_9581_c1 nmdc:mga00v17_9581_c1_3611_4168 185
54 3300050492 nmdc:mga0yw44_2636_c1 nmdc:mga0yw44_2636_c1_4172_4729 185
55 3300050494 nmdc:mga06z11_85172_c1 nmdc:mga06z11_85172_c1_724_1281 185
56 3300050516 nmdc:mga0sz30_62049_c2 nmdc:mga0sz30_62049_c2_532_1089 185
57 3300061734 Ga0530510_0705876 Ga0530510_0705876_88_645 185
58 3300005458 Ga0070681_10260473 Ga0070681_102604732 186
59 3300005468 Ga0070707_100308864 Ga0070707_1003088642 186
60 3300005937 Ga0081455_10019903 Ga0081455_100199032 186
61 3300005937 Ga0081455_10108602 Ga0081455_101086022 186
62 3300005981 Ga0081538_10000081 Ga0081538_1000008118 186
63 3300006175 Ga0070712_100402787 Ga0070712_1004027872 186
64 3300006844 Ga0075428_100930144 Ga0075428_1009301441 186
65 3300006846 Ga0075430_100272550 Ga0075430_1002725502 186
66 3300009098 Ga0105245_10891949 Ga0105245_108919492 186
67 3300014969 Ga0157376_10258565 Ga0157376_102585651 186
68 3300020082 Ga0206353_11206652 Ga0206353_112066522 186
69 3300025917 Ga0207660_10764137 Ga0207660_107641371 186
70 3300025922 Ga0207646_10991081 Ga0207646_109910812 186
71 3300028379 Ga0268266_10139246 Ga0268266_101392463 186
72 3300031456 Ga0307513_10026365 Ga0307513_100263652 186
73 3300037312 Ga0395899_0054583 Ga0395899_0054583_1462_2076 186
74 3300037418 Ga0395900_0436677 Ga0395900_0436677_244_858 186
75 3300037471 Ga0395905_0376828 Ga0395905_0376828_289_903 186
76 3300038443 Ga0395901_0441038 Ga0395901_0441038_438_1052 186
77 3300039437 Ga0436365_0460988 Ga0436365_0460988_84_665 186
78 3300041406 Ga0439439_0032876 Ga0439439_0032876_334_948 186
79 3300041491 Ga0451833_0655803 Ga0451833_0655803_98_712 186
80 3300041999 Ga0439433_0004616 Ga0439433_0004616_1528_2142 186
81 3300042002 Ga0439442_006628 Ga0439442_006628_1655_2269 186
82 3300042014 Ga0439457_031510 Ga0439457_031510_447_1061 186
83 3300042015 Ga0439462_0071930 Ga0439462_0071930_109_723 186
84 3300044694 Ga0466963_0084949 Ga0466963_0084949_847_1410 186
85 3300046455 Ga0495603_0089864 Ga0495603_0089864_671_1303 186
86 3300046675 Ga0495657_0259207 Ga0495657_0259207_199_807 186
87 3300046809 Ga0495600_0192865 Ga0495600_0192865_231_839 186
88 3300047319 Ga0495674_0218545 Ga0495674_0218545_29_637 186
89 3300047673 Ga0495593_0417992 Ga0495593_0417992_48_614 186
90 3300048088 Ga0495602_0205765 Ga0495602_0205765_769_1383 186
91 3300048915 Ga0496112_0007239 Ga0496112_0007239_640_1254 186
92 3300049569 Ga0501032_0015152 Ga0501032_0015152_2574_3137 186
93 3300049572 Ga0501036_0229643 Ga0501036_0229643_21_584 186
94 3300049573 Ga0501037_0061387 Ga0501037_0061387_1889_2452 186
95 3300049575 Ga0501039_0479536 Ga0501039_0479536_263_886 186
96 3300049578 Ga0501042_0014596 Ga0501042_0014596_2298_2861 186
97 3300049582 Ga0501048_0256097 Ga0501048_0256097_333_896 186
98 3300049585 Ga0501069_0105219 Ga0501069_0105219_622_1185 186
99 3300049585 Ga0501069_0223602 Ga0501069_0223602_306_869 186
100 3300049587 Ga0501071_0290213 Ga0501071_0290213_67_630 186
101 3300049591 Ga0501075_0325032 Ga0501075_0325032_249_863 186
102 3300049592 Ga0501076_0120171 Ga0501076_0120171_1120_1728 186
103 3300049593 Ga0501077_0043156 Ga0501077_0043156_1898_2461 186
104 3300049593 Ga0501077_0263746 Ga0501077_0263746_259_873 186
105 3300049593 Ga0501077_0565739 Ga0501077_0565739_120_689 186
106 3300049741 Ga0501079_0533533 Ga0501079_0533533_108_677 186
107 3300049743 Ga0501081_0515649 Ga0501081_0515649_155_718 186
108 3300049824 Ga0501045_0014682 Ga0501045_0014682_2745_3308 186
109 3300049824 Ga0501045_0379651 Ga0501045_0379651_312_881 186
110 3300050509 nmdc:mga0qj67_396414_c1 nmdc:mga0qj67_396414_c1_163_777 186
111 3300053085 Ga0495619_0351441 Ga0495619_0351441_192_800 186
112 3300060353 Ga0501082_0225169 Ga0501082_0225169_938_1552 186
113 3300061734 Ga0530510_0164695 Ga0530510_0164695_1016_1579 186
114 3300061734 Ga0530510_0421459 Ga0530510_0421459_235_798 186
115 3300005937 Ga0081455_10003613 Ga0081455_100036133 187
116 3300009147 Ga0114129_10000696 Ga0114129_1000069611 187
117 3300037853 Ga0436364_0812384 Ga0436364_0812384_1342_1923 187
118 3300046463 Ga0495653_0041719 Ga0495653_0041719_2076_2738 187
119 3300050507 nmdc:mga05p37_10209_c1 nmdc:mga05p37_10209_c1_9186_9752 187
120 3300005329 Ga0070683_100089207 Ga0070683_1000892073 188
121 3300005344 Ga0070661_100290073 Ga0070661_1002900732 188
122 3300005366 Ga0070659_100745510 Ga0070659_1007455101 188
123 3300005456 Ga0070678_101197349 Ga0070678_1011973491 188
124 3300005467 Ga0070706_100334604 Ga0070706_1003346041 188
125 3300005468 Ga0070707_100150191 Ga0070707_1001501913 188
126 3300005518 Ga0070699_100085840 Ga0070699_1000858401 188
127 3300005937 Ga0081455_10337165 Ga0081455_103371651 188
128 3300006028 Ga0070717_10049795 Ga0070717_100497956 188
129 3300006028 Ga0070717_10218716 Ga0070717_102187161 188
130 3300006038 Ga0075365_10005407 Ga0075365_100054076 188
131 3300006038 Ga0075365_10070529 Ga0075365_100705292 188
132 3300006048 Ga0075363_100019308 Ga0075363_1000193083 188
133 3300006051 Ga0075364_10034230 Ga0075364_100342304 188
134 3300006177 Ga0075362_10012962 Ga0075362_100129624 188
135 3300006177 Ga0075362_10375687 Ga0075362_103756871 188
136 3300006844 Ga0075428_100979146 Ga0075428_1009791462 188
137 3300006846 Ga0075430_100694448 Ga0075430_1006944482 188
138 3300006847 Ga0075431_100043170 Ga0075431_1000431702 188
139 3300006847 Ga0075431_100050037 Ga0075431_1000500374 188
140 3300006880 Ga0075429_100126955 Ga0075429_1001269552 188
141 3300006880 Ga0075429_100264528 Ga0075429_1002645282 188
142 3300009094 Ga0111539_10184399 Ga0111539_101843992 188
143 3300009094 Ga0111539_11285159 Ga0111539_112851591 188
144 3300009147 Ga0114129_10010366 Ga0114129_1001036610 188
145 3300009147 Ga0114129_11479974 Ga0114129_114799742 188
146 3300009148 Ga0105243_10346788 Ga0105243_103467882 188
147 3300014325 Ga0163163_11216465 Ga0163163_112164651 188
148 3300014745 Ga0157377_10833401 Ga0157377_108334011 188
149 3300021384 Ga0213876_10020808 Ga0213876_100208083 188
150 3300025901 Ga0207688_10402946 Ga0207688_104029461 188
151 3300025910 Ga0207684_10042295 Ga0207684_100422953 188
152 3300025910 Ga0207684_10253319 Ga0207684_102533193 188
153 3300025922 Ga0207646_10132456 Ga0207646_101324562 188
154 3300025937 Ga0207669_10048014 Ga0207669_100480143 188
155 3300025944 Ga0207661_10290512 Ga0207661_102905122 188
156 3300026089 Ga0207648_10450564 Ga0207648_104505642 188
157 3300027907 Ga0207428_10062116 Ga0207428_100621162 188
158 3300031616 Ga0307508_10132495 Ga0307508_101324953 188
159 3300031838 Ga0307518_10112869 Ga0307518_101128692 188
160 3300031995 Ga0307409_100067990 Ga0307409_1000679902 188
161 3300032126 Ga0307415_100620495 Ga0307415_1006204952 188
162 3300035086 Ga0373934_0000018 Ga0373934_0000018_41759_42328 188
163 3300035117 Ga0373953_0000105 Ga0373953_0000105_1348_1917 188
164 3300035118 Ga0373954_0018938 Ga0373954_0018938_2326_2895 188
165 3300035119 Ga0373956_0001561 Ga0373956_0001561_7209_7778 188
166 3300035120 Ga0373957_0000062 Ga0373957_0000062_10806_11375 188
167 3300035172 Ga0373955_0000822 Ga0373955_0000822_7868_8437 188
168 3300035410 Ga0373924_0003407 Ga0373924_0003407_3515_4084 188
169 3300035724 Ga0373933_0000371 Ga0373933_0000371_4714_5283 188
170 3300036401 Ga0373937_0000191 Ga0373937_0000191_45202_45771 188
171 3300037068 Ga0373925_0421427 Ga0373925_0421427_142_708 188
172 3300037466 Ga0395898_0385388 Ga0395898_0385388_723_1310 188
173 3300039437 Ga0436365_0567338 Ga0436365_0567338_775_1350 188
174 3300044693 Ga0466961_0086193 Ga0466961_0086193_973_1539 188
175 3300046454 Ga0495592_0000170 Ga0495592_0000170_14306_14875 188
176 3300046462 Ga0495651_0000390 Ga0495651_0000390_23483_24052 188
177 3300046463 Ga0495653_0001668 Ga0495653_0001668_4555_5124 188
178 3300046511 Ga0495608_0000075 Ga0495608_0000075_52494_53063 188
179 3300046516 Ga0495628_0015083 Ga0495628_0015083_1414_1983 188
180 3300046516 Ga0495628_0373418 Ga0495628_0373418_228_812 188
181 3300046529 Ga0495652_0000560 Ga0495652_0000560_499_1068 188
182 3300046529 Ga0495652_0084408 Ga0495652_0084408_1579_2169 188
183 3300046536 Ga0495587_0000121 Ga0495587_0000121_45202_45771 188
184 3300046559 Ga0495667_0000118 Ga0495667_0000118_14374_14943 188
185 3300046642 Ga0495634_0074060 Ga0495634_0074060_392_976 188
186 3300046663 Ga0495635_0011976 Ga0495635_0011976_1780_2364 188
187 3300046675 Ga0495657_0000122 Ga0495657_0000122_23472_24041 188
188 3300046678 Ga0495599_0000160 Ga0495599_0000160_1019_1588 188
189 3300046679 Ga0495623_0000296 Ga0495623_0000296_10187_10756 188
190 3300046809 Ga0495600_0009182 Ga0495600_0009182_4551_5120 188
191 3300046809 Ga0495600_0037341 Ga0495600_0037341_170_754 188
192 3300047317 Ga0495604_0000882 Ga0495604_0000882_9941_10510 188
193 3300047322 Ga0495680_0000158 Ga0495680_0000158_45203_45772 188
194 3300047444 Ga0495675_0000904 Ga0495675_0000904_3203_3772 188
195 3300048088 Ga0495602_0000173 Ga0495602_0000173_45141_45710 188
196 3300048917 Ga0496114_0006812 Ga0496114_0006812_5533_6120 188
197 3300049741 Ga0501079_0644068 Ga0501079_0644068_203_781 188
198 3300050489 nmdc:mga03683_24138_c1 nmdc:mga03683_24138_c1_94_660 188
199 3300050491 nmdc:mga00v17_146482_c1 nmdc:mga00v17_146482_c1_731_1297 188
200 3300050492 nmdc:mga0yw44_112559_c1 nmdc:mga0yw44_112559_c1_332_898 188
201 3300050494 nmdc:mga06z11_167133_c1 nmdc:mga06z11_167133_c1_257_823 188
202 3300050507 nmdc:mga05p37_656763_c1 nmdc:mga05p37_656763_c1_404_997 188
203 3300050508 nmdc:mga09592_438834_c1 nmdc:mga09592_438834_c1_195_776 188
204 3300050510 nmdc:mga06r32_1101_c3 nmdc:mga06r32_1101_c3_586_1152 188
205 3300050510 nmdc:mga06r32_12860_c1 nmdc:mga06r32_12860_c1_1835_2401 188
206 3300050510 nmdc:mga06r32_840834_c1 nmdc:mga06r32_840834_c1_249_818 188
207 3300050511 nmdc:mga08y16_312388_c1 nmdc:mga08y16_312388_c1_760_1356 188
208 3300053077 Ga0495601_0056907 Ga0495601_0056907_1624_2214 188
209 3300053077 Ga0495601_0147692 Ga0495601_0147692_90_674 188
210 3300053078 Ga0495612_0005955 Ga0495612_0005955_605_1189 188
211 3300053084 Ga0495595_0000793 Ga0495595_0000793_9536_10105 188
212 3300053085 Ga0495619_0185556 Ga0495619_0185556_118_708 188
213 3300053088 Ga0500644_0048244 Ga0500644_0048244_562_1128 188
214 3300053142 Ga0500577_0060639 Ga0500577_0060639_140_706 188
215 iso_pu_bacteria 2954380949 2954381775 188
216 iso_pu_bacteria 2954691527 2954692595 188
217 iso_pu_bacteria 2954701450 2954707668 188
218 3300005435 Ga0070714_100531576 Ga0070714_1005315761 189
219 3300005436 Ga0070713_100480937 Ga0070713_1004809373 189
220 3300025929 Ga0207664_11009045 Ga0207664_110090451 189
221 3300035111 Ga0373923_0153941 Ga0373923_0153941_140_742 189
222 3300035118 Ga0373954_0236728 Ga0373954_0236728_160_762 189
223 3300035171 Ga0373946_0354953 Ga0373946_0354953_62_664 189
224 3300035692 Ga0373935_0271728 Ga0373935_0271728_213_815 189
225 3300035695 Ga0373927_0276679 Ga0373927_0276679_437_1039 189
226 3300035725 Ga0373947_0342659 Ga0373947_0342659_335_937 189
227 3300036401 Ga0373937_0482595 Ga0373937_0482595_13_615 189
228 3300046516 Ga0495628_0320559 Ga0495628_0320559_312_914 189
229 3300046529 Ga0495652_0330602 Ga0495652_0330602_402_1004 189
230 3300046535 Ga0495586_0325853 Ga0495586_0325853_49_639 189
231 3300046543 Ga0495645_0012815 Ga0495645_0012815_4333_4935 189
232 3300046559 Ga0495667_0326656 Ga0495667_0326656_12_614 189
233 3300046663 Ga0495635_0204799 Ga0495635_0204799_347_949 189
234 3300046680 Ga0495646_0182270 Ga0495646_0182270_526_1128 189
235 3300046809 Ga0495600_0179140 Ga0495600_0179140_308_910 189
236 3300047315 Ga0495581_0552095 Ga0495581_0552095_45_647 189
237 3300047319 Ga0495674_0074053 Ga0495674_0074053_1901_2491 189
238 3300047322 Ga0495680_0181031 Ga0495680_0181031_353_955 189
239 3300047471 Ga0495684_0350341 Ga0495684_0350341_138_740 189
240 3300005327 Ga0070658_10030121 Ga0070658_100301211 190
241 3300005336 Ga0070680_100198957 Ga0070680_1001989572 190
242 3300005344 Ga0070661_100025853 Ga0070661_1000258531 190
243 3300005366 Ga0070659_100083189 Ga0070659_1000831895 190
244 3300005435 Ga0070714_100005523 Ga0070714_10000552311 190
245 3300005436 Ga0070713_100827059 Ga0070713_1008270592 190
246 3300005458 Ga0070681_10346408 Ga0070681_103464082 190
247 3300005530 Ga0070679_100008106 Ga0070679_1000081067 190
248 3300005535 Ga0070684_100026086 Ga0070684_1000260861 190
249 3300005564 Ga0070664_100450096 Ga0070664_1004500961 190
250 3300005577 Ga0068857_100460578 Ga0068857_1004605783 190
251 3300006028 Ga0070717_10042957 Ga0070717_100429576 190
252 3300006173 Ga0070716_100676052 Ga0070716_1006760522 190
253 3300013105 Ga0157369_10005507 Ga0157369_1000550711 190
254 3300013307 Ga0157372_10449786 Ga0157372_104497863 190
255 3300014325 Ga0163163_10201440 Ga0163163_102014404 190
256 3300020070 Ga0206356_10835173 Ga0206356_108351732 190
257 3300020081 Ga0206354_10980750 Ga0206354_109807503 190
258 3300020082 Ga0206353_10090436 Ga0206353_100904363 190
259 3300025909 Ga0207705_10052603 Ga0207705_100526034 190
260 3300025917 Ga0207660_10087348 Ga0207660_100873484 190
261 3300025928 Ga0207700_10041626 Ga0207700_100416262 190
262 3300025929 Ga0207664_10002370 Ga0207664_1000237014 190
263 3300025932 Ga0207690_10350175 Ga0207690_103501752 190
264 3300025944 Ga0207661_10019070 Ga0207661_100190704 190
265 3300025944 Ga0207661_10022014 Ga0207661_100220144 190
266 3300026078 Ga0207702_10365488 Ga0207702_103654882 190
267 3300026116 Ga0207674_10306870 Ga0207674_103068703 190
268 3300044684 Ga0466966_0214376 Ga0466966_0214376_276_887 190
269 3300048912 Ga0496109_0406619 Ga0496109_0406619_194_820 190
270 3300048915 Ga0496112_0123087 Ga0496112_0123087_723_1349 190
271 3300003320 rootH2_10063258 rootH2_100632582 191
272 3300046516 Ga0495628_0206956 Ga0495628_0206956_562_1152 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

36

168

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fxt-assembly1.cif.gz_A crystal structure of the n-terminal domain of human nudt6 0.7661 120 188
7n1l-assembly3.cif.gz_C crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.7185 2 133
7dai-assembly2.cif.gz_C the crystal structure of a serotonin n-acetyltransferase from oryza sativa 0.712 47 133
7n1l-assembly4.cif.gz_F crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.7063 2 133
7n1l-assembly1.cif.gz_A crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis biovar abortus 2308 0.6909 2 133
ID Description Score Start End Superfamily
2fl4A02 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7466 64 187 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7352 60 133 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7306 69 133 3.40.630.30
af_A0A1D6PIZ8_8_224_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.716 64 81 2.40.160.200
2gu1A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.71 62 79 3.10.450.350
ID Description Score Start End GO Terms
AF-A0A838KHK6-F1-model_v4 GNAT family N-acetyltransferase 0.9826 1 143 GO:0016747
AF-A0A323V478-F1-model_v4 GNAT family N-acetyltransferase (GNAT superfamily N-acetyltransferase) 0.9715 1 188 GO:0016747
AF-A0A1I3ZGM2-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9705 3 191 GO:0016747
AF-A0A7V9IQZ9-F1-model_v4 GNAT family N-acetyltransferase 0.9679 1 182 GO:0016747
AF-A0A7W0T9J4-F1-model_v4 GNAT family N-acetyltransferase 0.9675 2 190 GO:0016747

Feature Viewer

pLDDT pTM Quality
89.2 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map